F467489

General Info

Members Datasets Scaffolds Average Seq Length
595 396 460 272

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0184319|Ga0501034_0184319_1040_1897
Length 285
Sequence MARRGILTRNRTAYRTPDPHPSGARPPKIPGELVPKHVAIVMDGNGRWAKERGLPRTEGHKVGEGVVLDVLKGCLEIGVKNLSLYAFSTENWKRSPEVRFLMNFNRDVIRRRRDEMDELGIRIRWVGRMPRMWKSVVQELQVAQEQTVGNDAMTLYFCVNYGGRAEIADAAQAIARDVAAGRLDPSKVNEKTFAKYLYYPDMPDVDLFLRPSGEQRTSNYLIWQSSYAEMVFQDVLWPDFDRRDLWRGCLEYAQRDRRFGGALPNEAERSAGALPGDGRAQPETS

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
8 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
9 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
10 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
11 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
12 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
13 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
14 2643221647 Streptomyces sp. Root369 Isolate Unclassified
15 2643221670 Streptomyces sp. Root431 Isolate Unclassified
16 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
17 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
20 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
21 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
22 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
23 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
24 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
25 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
26 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
27 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
28 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
29 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
30 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
31 2808606448 Streptomyces sp. 193411 Isolate Unclassified
32 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
33 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
34 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
35 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
36 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
37 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
38 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
39 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
40 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
41 2855683550 Micromonospora sp. RP3T Isolate Unclassified
42 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
43 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
44 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
45 2858868258 Micromonospora sp. MH33 Isolate Unclassified
46 2858882152 Micromonospora noduli MED15 Isolate Nodule
47 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
48 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
49 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
50 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
51 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
52 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
53 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
54 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
55 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
56 2862574272 Streptomyces sp. AcE210 Isolate Nodule
57 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
58 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
59 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
60 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
61 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
62 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
63 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
64 2867428634 Streptomyces sp. RP5T Isolate Unclassified
65 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
66 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
67 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
68 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
69 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
70 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
71 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
72 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
73 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
74 2902582711 Micromonospora sp. AP08 Isolate Unclassified
75 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
76 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
77 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
78 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
79 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
80 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
81 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
82 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
83 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
84 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
85 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
86 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
87 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
88 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
89 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
90 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
91 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
92 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
93 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
94 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
95 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
96 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
97 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
98 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
99 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
100 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
101 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
102 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
103 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
104 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
105 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
106 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
107 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
108 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
109 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
111 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
112 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
113 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
116 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
129 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
130 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
131 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
181 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
208 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
209 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
210 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
216 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
223 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
224 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
225 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
226 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
363 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
364 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
365 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
366 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 649633069 Micromonospora sp. L5 Isolate Unclassified
371 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
372 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
373 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
374 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
375 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
376 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
377 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
378 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
379 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
380 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
381 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
382 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
383 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
384 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
385 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
386 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
387 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
388 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
389 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
390 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
391 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
392 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
393 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
394 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
395 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
396 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.14
Metatranscriptomes 0.17
Isolates 22.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 1.34
Rhizoplane 3.53
Rhizosphere 72.1
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10022793 3300003203 Bacteria 2487
2 JGI25406J46586_10036472 3300003203 Bacteria 1784
3 rootL2_10030927 3300003322 Bacteria 5505
4 JGI25160J50197_1016879 3300003354 Bacteria 2335
5 Ga0070658_10547019 3300005327 Bacteria 1002
6 Ga0070670_100267917 3300005331 Bacteria 1490
7 Ga0070682_100148920 3300005337 Bacteria 1604
8 Ga0070668_100001221 3300005347 Bacteria 18265
9 Ga0070668_100002192 3300005347 Bacteria 14332
10 Ga0070675_100282798 3300005354 Bacteria 1458
11 Ga0070667_100049665 3300005367 Bacteria 3534
12 Ga0070714_100263500 3300005435 Bacteria 1596
13 Ga0070663_100000545 3300005455 Bacteria 19990
14 Ga0070678_100477279 3300005456 Bacteria 1097
15 Ga0070684_100614767 3300005535 Bacteria 1011
16 Ga0070672_100451162 3300005543 Bacteria 1108
17 Ga0068855_100182206 3300005563 Bacteria 2374
18 Ga0068852_100630837 3300005616 Bacteria 1078
19 Ga0068864_100005044 3300005618 Bacteria 10813
20 Ga0068858_100031908 3300005842 Bacteria 4894
21 Ga0068858_100397331 3300005842 Bacteria 1324
22 Ga0068862_100328394 3300005844 Bacteria 1414
23 Ga0081455_10173680 3300005937 Bacteria 1638
24 Ga0081540_1009407 3300005983 Bacteria 6734
25 Ga0081539_10002173 3300005985 Bacteria 28814
26 Ga0081539_10008387 3300005985 Bacteria 9018
27 Ga0081539_10012722 3300005985 Bacteria 6441
28 Ga0075365_10099219 3300006038 Bacteria 1993
29 Ga0075367_10000221 3300006178 Bacteria 19037
30 Ga0075428_100000289 3300006844 Bacteria 49296
31 Ga0075428_100069453 3300006844 Bacteria 3852
32 Ga0075428_100227610 3300006844 Bacteria 2013
33 Ga0075428_100681372 3300006844 Bacteria 1096
34 Ga0111539_10492664 3300009094 Bacteria 1427
35 Ga0105245_10023911 3300009098 Bacteria 5363
36 Ga0114129_10000056 3300009147 Bacteria 99329
37 Ga0105243_10560347 3300009148 Bacteria 1093
38 Ga0105248_10037187 3300009177 Bacteria 5445
39 Ga0163162_10459128 3300013306 Bacteria 1405
40 Ga0157372_10227788 3300013307 Bacteria 2161
41 Ga0157375_10298223 3300013308 Bacteria 1775
42 Ga0182008_10000271 3300014497 Bacteria 40629
43 Ga0182007_10000743 3300015262 Bacteria 18440
44 Ga0182005_1007173 3300015265 Bacteria 3360
45 Ga0183367_1009 3300015688 Bacteria 484598
46 Ga0209758_1008986 3300025297 Bacteria 6319
47 Ga0207426_1006442 3300025302 Bacteria 5112
48 Ga0207647_10004516 3300025904 Bacteria 10308
49 Ga0207699_10260369 3300025906 Bacteria 1199
50 Ga0207693_10145955 3300025915 Bacteria 1860
51 Ga0207652_10448634 3300025921 Bacteria 1163
52 Ga0207659_10155919 3300025926 Bacteria 1788
53 Ga0207664_10064446 3300025929 Bacteria 2931
54 Ga0207665_10069436 3300025939 Bacteria 2403
55 Ga0207691_10357068 3300025940 Bacteria 1250
56 Ga0207711_10011074 3300025941 Bacteria 7497
57 Ga0207661_10350897 3300025944 Bacteria 1331
58 Ga0207679_10322143 3300025945 Bacteria 1339
59 Ga0207668_10000735 3300025972 Bacteria 20068
60 Ga0207668_10104391 3300025972 Bacteria 2112
61 Ga0207703_10123313 3300026035 Bacteria 2227
62 Ga0207703_10213897 3300026035 Bacteria 1720
63 Ga0207639_10272944 3300026041 Bacteria 1484
64 Ga0207678_10026537 3300026067 Bacteria 5053
65 Ga0207641_10066476 3300026088 Bacteria 3086
66 Ga0207676_10019709 3300026095 Bacteria 4925
67 Ga0207683_10263502 3300026121 Bacteria 1574
68 Ga0207698_10368386 3300026142 Bacteria 1363
69 Ga0268264_10189576 3300028381 Bacteria 1873
70 Ga0268264_10206991 3300028381 Bacteria 1799
71 Ga0307517_10010178 3300028786 Bacteria 13195
72 Ga0307515_10000148 3300028794 Bacteria 170303
73 Ga0307515_10000694 3300028794 Bacteria 77618
74 Ga0307515_10021362 3300028794 Bacteria 11487
75 Ga0307515_10054707 3300028794 Bacteria 5852
76 Ga0307515_10103338 3300028794 Bacteria 3416
77 Ga0307511_10013070 3300030521 Bacteria 8119
78 Ga0307511_10171527 3300030521 Bacteria 1191
79 Ga0307512_10006851 3300030522 Bacteria 11422
80 Ga0307512_10009078 3300030522 Bacteria 9618
81 Ga0307512_10175445 3300030522 Bacteria 1217
82 Ga0316181_1228097 3300030744 Bacteria 1970
83 Ga0307513_10000001 3300031456 Bacteria 1660464
84 Ga0307513_10004273 3300031456 Bacteria 19112
85 Ga0307513_10006041 3300031456 Bacteria 15886
86 Ga0307513_10010821 3300031456 Bacteria 11395
87 Ga0307513_10081266 3300031456 Bacteria 3340
88 Ga0307509_10033617 3300031507 Bacteria 5644
89 Ga0307509_10059563 3300031507 Bacteria 4040
90 Ga0307509_10062980 3300031507 Bacteria 3908
91 Ga0307509_10107151 3300031507 Bacteria 2811
92 Ga0307508_10016608 3300031616 Bacteria 6698
93 Ga0307508_10017565 3300031616 Bacteria 6504
94 Ga0307508_10022091 3300031616 Bacteria 5784
95 Ga0307508_10024158 3300031616 Bacteria 5516
96 Ga0307508_10027186 3300031616 Bacteria 5183
97 Ga0307508_10030804 3300031616 Bacteria 4848
98 Ga0307508_10153435 3300031616 Bacteria 1907
99 Ga0307514_10015333 3300031649 Bacteria 6327
100 Ga0307516_10000602 3300031730 Bacteria 48705
101 Ga0307516_10004212 3300031730 Bacteria 17915
102 Ga0307516_10062340 3300031730 Bacteria 3614
103 Ga0307516_10294801 3300031730 Bacteria 1299
104 Ga0307516_10405541 3300031730 Bacteria 1022
105 Ga0307516_10447080 3300031730 Bacteria 949
106 Ga0307405_10199703 3300031731 Bacteria 1451
107 Ga0307405_10242827 3300031731 Bacteria 1335
108 Ga0307413_10275242 3300031824 Bacteria 1263
109 Ga0307518_10001334 3300031838 Bacteria 18445
110 Ga0307518_10131776 3300031838 Bacteria 1756
111 Ga0326468_10001011 3300031889 Bacteria 2680
112 Ga0307406_10238098 3300031901 Bacteria 1363
113 Ga0307406_10381628 3300031901 Bacteria 1111
114 Ga0307412_10058211 3300031911 Bacteria 2584
115 Ga0307412_10115339 3300031911 Bacteria 1925
116 Ga0307412_10278689 3300031911 Bacteria 1312
117 Ga0307409_100000172 3300031995 Bacteria 25235
118 Ga0307409_100009630 3300031995 Bacteria 5950
119 Ga0307409_100032523 3300031995 Bacteria 3783
120 Ga0307416_100000245 3300032002 Bacteria 28776
121 Ga0307416_100001922 3300032002 Bacteria 11601
122 Ga0307411_10162503 3300032005 Bacteria 1675
123 Ga0307411_10194142 3300032005 Bacteria 1553
124 Ga0307415_100000019 3300032126 Bacteria 70406
125 Ga0307415_100074940 3300032126 Bacteria 2393
126 Ga0307415_100132932 3300032126 Bacteria 1887
127 Ga0307415_100259848 3300032126 Bacteria 1416
128 Ga0307507_10006953 3300033179 Bacteria 16832
129 Ga0307507_10038082 3300033179 Bacteria 4882
130 Ga0307507_10295104 3300033179 Bacteria 999
131 Ga0307510_10006420 3300033180 Bacteria 14024
132 Ga0307510_10014199 3300033180 Bacteria 9432
133 Ga0307510_10032673 3300033180 Bacteria 5860
134 Ga0373950_0003253 3300034818 Bacteria 2306
135 Ga0373934_0106970 3300035086 Bacteria 1133
136 Ga0373951_0000210 3300035091 Bacteria 20860
137 Ga0373953_0023871 3300035117 Bacteria 2319
138 Ga0373942_0000805 3300035207 Bacteria 8646
139 Ga0373942_0028637 3300035207 Bacteria 1457
140 Ga0373962_0008823 3300035242 Bacteria 2489
141 Ga0373935_0566953 3300035692 Bacteria 829
142 Ga0373937_0052921 3300036401 Bacteria 3724
143 Ga0373925_0103955 3300037068 Bacteria 2187
144 Ga0395899_0259864 3300037312 Bacteria 1188
145 Ga0395898_0002018 3300037466 Bacteria 25458
146 Ga0395898_0007217 3300037466 Bacteria 11791
147 Ga0395898_0018932 3300037466 Bacteria 7015
148 Ga0395905_0065652 3300037471 Bacteria 3398
149 Ga0395905_0214074 3300037471 Bacteria 1805
150 Ga0436364_0564746 3300037853 Bacteria 49630
151 Ga0436364_0829014 3300037853 Bacteria 10267
152 Ga0395901_0090688 3300038443 Bacteria 3199
153 Ga0395901_0381834 3300038443 Bacteria 1450
154 Ga0436365_1749326 3300039437 Bacteria 4296
155 Ga0436365_1844330 3300039437 Bacteria 6853
156 Ga0436362_0578357 3300039453 Bacteria 15297
157 Ga0439436_0001613 3300041404 Bacteria 6566
158 Ga0439436_0008087 3300041404 Bacteria 3233
159 Ga0439439_0007230 3300041406 Bacteria 2591
160 Ga0451789_0057754 3300041443 Bacteria 5209
161 Ga0451793_0438160 3300041452 Bacteria 5193
162 Ga0451797_1149328 3300041453 Bacteria 1532
163 Ga0451807_2244245 3300041486 Bacteria 2131
164 Ga0451837_0805466 3300041494 Bacteria 4342
165 Ga0451843_1434338 3300041509 Bacteria 1885
166 Ga0451853_0264747 3300041512 Bacteria 5134
167 Ga0451853_3177368 3300041512 Bacteria 8201
168 Ga0451853_3778753 3300041512 Bacteria 2968
169 Ga0439433_0012778 3300041999 Bacteria 1842
170 Ga0439442_038226 3300042002 Bacteria 1006
171 Ga0439448_0004081 3300042005 Bacteria 4108
172 Ga0439449_0002877 3300042007 Bacteria 6695
173 Ga0439449_0007001 3300042007 Bacteria 4296
174 Ga0439455_0012667 3300042012 Bacteria 1898
175 Ga0439457_000207 3300042014 Bacteria 15627
176 Ga0439457_002396 3300042014 Bacteria 5360
177 Ga0439457_006016 3300042014 Bacteria 2998
178 Ga0439462_0020069 3300042015 Bacteria 1742
179 Ga0439462_0055513 3300042015 Bacteria 1068
180 Ga0450894_000078 3300042131 Bacteria 15648
181 Ga0450899_000512 3300042135 Bacteria 4389
182 Ga0450900_006566 3300042136 Bacteria 1411
183 Ga0450903_000278 3300042138 Bacteria 11255
184 Ga0450906_001212 3300042145 Bacteria 5706
185 Ga0439458_0000893 3300042157 Bacteria 7699
186 Ga0466972_0001629 3300044658 Bacteria 10979
187 Ga0466972_0009786 3300044658 Bacteria 4813
188 Ga0466972_0027826 3300044658 Bacteria 2794
189 Ga0466972_0113082 3300044658 Bacteria 1282
190 Ga0466965_0005287 3300044683 Bacteria 5807
191 Ga0466966_0003198 3300044684 Bacteria 10785
192 Ga0466966_0007208 3300044684 Bacteria 7371
193 Ga0466966_0018532 3300044684 Bacteria 4590
194 Ga0466961_0002755 3300044693 Bacteria 10934
195 Ga0466961_0032047 3300044693 Bacteria 3378
196 Ga0466963_0000228 3300044694 Bacteria 24082
197 Ga0466963_0000242 3300044694 Bacteria 23718
198 Ga0466963_0006692 3300044694 Bacteria 6846
199 Ga0466964_0020813 3300044706 Bacteria 2530
200 Ga0466964_0024384 3300044706 Bacteria 2358
201 Ga0466964_0072242 3300044706 Bacteria 1462
202 Ga0466971_0051495 3300044719 Bacteria 1853
203 Ga0466971_0057197 3300044719 Bacteria 1759
204 Ga0466971_0080761 3300044719 Bacteria 1482
205 Ga0466968_0012641 3300044735 Bacteria 3309
206 Ga0466970_0000447 3300044765 Bacteria 20242
207 Ga0466957_0000135 3300044842 Bacteria 31380
208 Ga0466957_0001560 3300044842 Bacteria 12065
209 Ga0466959_0000505 3300045049 Bacteria 22659
210 Ga0466959_0047231 3300045049 Bacteria 3167
211 Ga0466959_0116045 3300045049 Bacteria 1907
212 Ga0466958_0000091 3300045836 Bacteria 27740
213 Ga0466958_0000191 3300045836 Bacteria 22382
214 Ga0466967_0000338 3300045976 Bacteria 21486
215 Ga0466967_0001768 3300045976 Bacteria 12927
216 Ga0466967_0010303 3300045976 Bacteria 7001
217 Ga0466967_0011101 3300045976 Bacteria 6804
218 Ga0466967_0219170 3300045976 Bacteria 1807
219 Ga0495617_007183 3300046452 Bacteria 3880
220 Ga0495592_0000576 3300046454 Bacteria 26018
221 Ga0495592_0029821 3300046454 Bacteria 4128
222 Ga0495603_0004509 3300046455 Bacteria 8308
223 Ga0495603_0027006 3300046455 Bacteria 3466
224 Ga0495629_0018180 3300046459 Bacteria 5036
225 Ga0495629_0025615 3300046459 Bacteria 4191
226 Ga0495629_0063406 3300046459 Bacteria 2581
227 Ga0495629_0082706 3300046459 Bacteria 2241
228 Ga0495629_0103633 3300046459 Bacteria 1984
229 Ga0495638_0098416 3300046460 Bacteria 1752
230 Ga0495638_0109831 3300046460 Bacteria 1639
231 Ga0495651_0006756 3300046462 Bacteria 8766
232 Ga0495651_0027217 3300046462 Bacteria 4454
233 Ga0495651_0080489 3300046462 Bacteria 2460
234 Ga0495580_0083826 3300046472 Bacteria 2221
235 Ga0495582_0017390 3300046473 Bacteria 3935
236 Ga0495605_0001658 3300046474 Bacteria 14310
237 Ga0495639_0010319 3300046475 Bacteria 4020
238 Ga0495639_0075259 3300046475 Bacteria 1565
239 Ga0495662_0010186 3300046476 Bacteria 4605
240 Ga0495662_0032816 3300046476 Bacteria 2508
241 Ga0495662_0042962 3300046476 Bacteria 2181
242 Ga0495664_0012030 3300046477 Bacteria 4891
243 Ga0495664_0025636 3300046477 Bacteria 3433
244 Ga0495664_0058198 3300046477 Bacteria 2299
245 Ga0495585_0061702 3300046492 Bacteria 2060
246 Ga0495585_0075279 3300046492 Bacteria 1835
247 Ga0495585_0107153 3300046492 Bacteria 1489
248 Ga0495594_0023731 3300046499 Bacteria 3288
249 Ga0495596_0044250 3300046500 Bacteria 1753
250 Ga0495607_0003648 3300046501 Bacteria 11688
251 Ga0495606_0002794 3300046507 Bacteria 19482
252 Ga0495606_0011812 3300046507 Bacteria 7076
253 Ga0495616_0002816 3300046513 Bacteria 11354
254 Ga0495618_0030681 3300046514 Bacteria 3359
255 Ga0495618_0087402 3300046514 Bacteria 1993
256 Ga0495620_0005411 3300046515 Bacteria 7126
257 Ga0495628_0009609 3300046516 Bacteria 8252
258 Ga0495630_0081537 3300046517 Bacteria 2441
259 Ga0495631_0002350 3300046518 Bacteria 10758
260 Ga0495632_0058869 3300046519 Bacteria 1871
261 Ga0495632_0063300 3300046519 Bacteria 1791
262 Ga0495643_0003597 3300046522 Bacteria 11258
263 Ga0495648_0047005 3300046524 Bacteria 2671
264 Ga0495648_0113603 3300046524 Bacteria 1468
265 Ga0495666_0028119 3300046526 Bacteria 2767
266 Ga0495652_0045219 3300046529 Bacteria 3787
267 Ga0495652_0075361 3300046529 Bacteria 2802
268 Ga0495654_0068714 3300046530 Bacteria 1683
269 Ga0495640_0068556 3300046533 Bacteria 2387
270 Ga0495587_0001673 3300046536 Bacteria 14794
271 Ga0495597_0005535 3300046542 Bacteria 6676
272 Ga0495645_0057379 3300046543 Bacteria 2826
273 Ga0495622_0015894 3300046557 Bacteria 3499
274 Ga0495667_0217262 3300046559 Bacteria 1221
275 Ga0495668_0001860 3300046616 Bacteria 18957
276 Ga0495634_0001729 3300046642 Bacteria 18914
277 Ga0495634_0021084 3300046642 Bacteria 4613
278 Ga0495611_0023970 3300046648 Bacteria 2651
279 Ga0495611_0088749 3300046648 Bacteria 1427
280 Ga0495625_0005758 3300046660 Bacteria 11206
281 Ga0495625_0007465 3300046660 Bacteria 9508
282 Ga0495625_0063276 3300046660 Bacteria 2613
283 Ga0495625_0091755 3300046660 Bacteria 2099
284 Ga0495625_0091787 3300046660 Bacteria 2099
285 Ga0495635_0005862 3300046663 Bacteria 8562
286 Ga0495635_0040128 3300046663 Bacteria 3235
287 Ga0495661_0066485 3300046665 Bacteria 2121
288 Ga0495661_0117273 3300046665 Bacteria 1475
289 Ga0495588_0038888 3300046674 Bacteria 2421
290 Ga0495657_0025823 3300046675 Bacteria 4167
291 Ga0495657_0032769 3300046675 Bacteria 3623
292 Ga0495657_0129550 3300046675 Bacteria 1581
293 Ga0495599_0130424 3300046678 Bacteria 1561
294 Ga0495623_0045568 3300046679 Bacteria 2785
295 Ga0495646_0008466 3300046680 Bacteria 6530
296 Ga0495658_0086832 3300046683 Bacteria 1846
297 Ga0495613_0001343 3300046689 Bacteria 18743
298 Ga0495613_0006541 3300046689 Bacteria 8710
299 Ga0495613_0011024 3300046689 Bacteria 6712
300 Ga0495613_0013617 3300046689 Bacteria 6035
301 Ga0495624_0011734 3300046690 Bacteria 6016
302 Ga0495624_0037842 3300046690 Bacteria 3102
303 Ga0495670_0066372 3300046691 Bacteria 1820
304 Ga0495671_0002481 3300046692 Bacteria 11641
305 Ga0495589_0021485 3300046794 Bacteria 3298
306 Ga0495600_0029472 3300046809 Bacteria 3553
307 Ga0495600_0031695 3300046809 Bacteria 3426
308 Ga0495660_0073382 3300046810 Bacteria 1809
309 Ga0495581_0006597 3300047315 Bacteria 6723
310 Ga0495581_0034568 3300047315 Bacteria 2924
311 Ga0495581_0314483 3300047315 Bacteria 915
312 Ga0495604_0001115 3300047317 Bacteria 22276
313 Ga0495604_0004851 3300047317 Bacteria 10654
314 Ga0495604_0028758 3300047317 Bacteria 4422
315 Ga0495604_0078399 3300047317 Bacteria 2479
316 Ga0495636_0021125 3300047318 Bacteria 2627
317 Ga0495636_0049494 3300047318 Bacteria 1757
318 Ga0495672_0072310 3300047320 Bacteria 1948
319 Ga0495676_0012698 3300047321 Bacteria 7575
320 Ga0495676_0014435 3300047321 Bacteria 7066
321 Ga0495676_0050055 3300047321 Bacteria 3353
322 Ga0495680_0003920 3300047322 Bacteria 14396
323 Ga0495680_0291099 3300047322 Bacteria 1149
324 Ga0495680_0354187 3300047322 Bacteria 1021
325 Ga0495683_0028230 3300047323 Bacteria 2869
326 Ga0495683_0075920 3300047323 Bacteria 1645
327 Ga0495687_000383 3300047443 Bacteria 54908
328 Ga0495687_003440 3300047443 Bacteria 11476
329 Ga0495687_071847 3300047443 Bacteria 1384
330 Ga0495675_0015624 3300047444 Bacteria 4798
331 Ga0495685_013841 3300047447 Bacteria 2738
332 Ga0495681_0001710 3300047470 Bacteria 16254
333 Ga0495681_0036632 3300047470 Bacteria 2424
334 Ga0495684_0023325 3300047471 Bacteria 4758
335 Ga0495686_0014889 3300047472 Bacteria 5336
336 Ga0495686_0034886 3300047472 Bacteria 3236
337 Ga0495686_0068049 3300047472 Bacteria 2197
338 Ga0495593_0069859 3300047673 Bacteria 1825
339 Ga0495593_0117684 3300047673 Bacteria 1353
340 Ga0495602_0031956 3300048088 Bacteria 4964
341 Ga0495626_0000124 3300048091 Bacteria 99577
342 Ga0495626_0025416 3300048091 Bacteria 2897
343 Ga0496104_0008215 3300048907 Bacteria 9266
344 Ga0496105_0002425 3300048908 Bacteria 13513
345 Ga0496108_0000065 3300048911 Bacteria 117405
346 Ga0496108_0002432 3300048911 Bacteria 14881
347 Ga0496108_0009514 3300048911 Bacteria 7873
348 Ga0496108_0802924 3300048911 Bacteria 812
349 Ga0496109_0004257 3300048912 Bacteria 11954
350 Ga0496109_0107978 3300048912 Bacteria 2586
351 Ga0496109_0280415 3300048912 Bacteria 1571
352 Ga0496109_0549928 3300048912 Bacteria 1089
353 Ga0496110_0005344 3300048913 Bacteria 10062
354 Ga0496111_0111638 3300048914 Bacteria 2013
355 Ga0496111_0254144 3300048914 Bacteria 1304
356 Ga0496112_0288402 3300048915 Bacteria 1587
357 Ga0496113_0256938 3300048916 Bacteria 1395
358 Ga0496114_0265996 3300048917 Bacteria 1511
359 Ga0501306_003016 3300049127 Bacteria 1781
360 Ga0495682_0053165 3300049460 Bacteria 1471
361 Ga0501031_0075630 3300049568 Bacteria 2192
362 Ga0501031_0223972 3300049568 Bacteria 1224
363 Ga0501032_0050096 3300049569 Bacteria 2816
364 Ga0501032_0218501 3300049569 Bacteria 1241
365 Ga0501033_0001330 3300049570 Bacteria 21988
366 Ga0501033_0001528 3300049570 Bacteria 20447
367 Ga0501033_0074206 3300049570 Bacteria 2497
368 Ga0501033_0076698 3300049570 Bacteria 2454
369 Ga0501033_0087284 3300049570 Bacteria 2283
370 Ga0501034_0005839 3300049571 Bacteria 13386
371 Ga0501034_0013930 3300049571 Bacteria 8278
372 Ga0501034_0085647 3300049571 Bacteria 3152
373 Ga0501034_0121725 3300049571 Bacteria 2595
374 Ga0501034_0184319 3300049571 Bacteria 2051
375 Ga0501034_0185356 3300049571 Bacteria 2045
376 Ga0501036_0000194 3300049572 Bacteria 40472
377 Ga0501036_0023220 3300049572 Bacteria 5221
378 Ga0501036_0148903 3300049572 Bacteria 1974
379 Ga0501037_0022403 3300049573 Bacteria 4673
380 Ga0501037_0090626 3300049573 Bacteria 2211
381 Ga0501037_0228215 3300049573 Bacteria 1308
382 Ga0501038_0000407 3300049574 Bacteria 37327
383 Ga0501038_0069943 3300049574 Bacteria 2981
384 Ga0501038_0123758 3300049574 Bacteria 2130
385 Ga0501039_0003711 3300049575 Bacteria 11465
386 Ga0501039_0170371 3300049575 Bacteria 1712
387 Ga0501042_0031922 3300049578 Bacteria 3727
388 Ga0501043_0006818 3300049579 Bacteria 9118
389 Ga0501043_0020682 3300049579 Bacteria 5162
390 Ga0501043_0049387 3300049579 Bacteria 3307
391 Ga0501043_0066618 3300049579 Bacteria 2828
392 Ga0501043_0237917 3300049579 Bacteria 1405
393 Ga0501046_0093395 3300049580 Bacteria 2312
394 Ga0501046_0142304 3300049580 Bacteria 1814
395 Ga0501047_0000262 3300049581 Bacteria 61769
396 Ga0501047_0009638 3300049581 Bacteria 9129
397 Ga0501047_0017013 3300049581 Bacteria 6952
398 Ga0501047_0018821 3300049581 Bacteria 6624
399 Ga0501047_0043464 3300049581 Bacteria 4341
400 Ga0501047_0050900 3300049581 Bacteria 4000
401 Ga0501047_0069500 3300049581 Bacteria 3391
402 Ga0501047_0122051 3300049581 Bacteria 2487
403 Ga0501047_0284191 3300049581 Bacteria 1498
404 Ga0501048_0120439 3300049582 Bacteria 1854
405 Ga0501048_0130251 3300049582 Bacteria 1778
406 Ga0501067_0137271 3300049583 Bacteria 1361
407 Ga0501067_0330014 3300049583 Bacteria 850
408 Ga0501068_0007474 3300049584 Bacteria 6047
409 Ga0501069_0240123 3300049585 Bacteria 1056
410 Ga0501070_0002266 3300049586 Bacteria 16913
411 Ga0501071_0014708 3300049587 Bacteria 5355
412 Ga0501072_0239304 3300049588 Bacteria 1445
413 Ga0501073_0024135 3300049589 Bacteria 4366
414 Ga0501073_0203964 3300049589 Bacteria 1367
415 Ga0501074_0000943 3300049590 Bacteria 18760
416 Ga0501074_0018823 3300049590 Bacteria 5015
417 Ga0501079_0406776 3300049741 Bacteria 1067
418 Ga0501080_0255837 3300049742 Bacteria 1596
419 Ga0501081_0373474 3300049743 Bacteria 1053
420 Ga0501083_0100761 3300049744 Bacteria 1904
421 Ga0501035_0000782 3300049822 Bacteria 34040
422 Ga0501035_0009426 3300049822 Bacteria 9076
423 Ga0501035_0021875 3300049822 Bacteria 5875
424 Ga0501035_0050190 3300049822 Bacteria 3739
425 Ga0501035_0068672 3300049822 Bacteria 3142
426 Ga0501035_0087588 3300049822 Bacteria 2744
427 Ga0501035_0099971 3300049822 Bacteria 2546
428 Ga0501044_0001691 3300049823 Bacteria 25916
429 Ga0501044_0021405 3300049823 Bacteria 6898
430 Ga0501044_0029546 3300049823 Bacteria 5778
431 Ga0501044_0041202 3300049823 Bacteria 4808
432 Ga0501044_0056501 3300049823 Bacteria 4030
433 Ga0501044_0080595 3300049823 Bacteria 3297
434 Ga0501044_0124494 3300049823 Bacteria 2576
435 nmdc:mga03n38_237899_c1 3300050490 Bacteria 957
436 nmdc:mga06z11_10347_c1 3300050494 Bacteria 3971
437 nmdc:mga07m45_53377_c1 3300050496 Bacteria 2283
438 nmdc:mga05p37_369254_c1 3300050507 Bacteria 1684
439 nmdc:mga05p37_720_c1 3300050507 Bacteria 36593
440 nmdc:mga09592_274606_c1 3300050508 Bacteria 1462
441 nmdc:mga06r32_3216_c1 3300050510 Bacteria 14621
442 nmdc:mga06r32_32708_c1 3300050510 Bacteria 4896
443 nmdc:mga08y16_418234_c1 3300050511 Bacteria 1370
444 Ga0495619_0012519 3300053085 Bacteria 5344
445 Ga0495619_0450543 3300053085 Bacteria 887
446 Ga0500644_0133705 3300053088 Bacteria 979
447 Ga0500646_0000120 3300053090 Bacteria 22128
448 Ga0500583_0069510 3300053092 Bacteria 1681
449 Ga0500640_017076 3300053095 Bacteria 3073
450 Ga0500641_0022250 3300053096 Bacteria 2425
451 Ga0500572_014561 3300053111 Bacteria 1968
452 Ga0500652_051716 3300053131 Bacteria 1679
453 Ga0500573_0071923 3300053140 Bacteria 1972
454 Ga0500600_0172216 3300053149 Bacteria 1051
455 Ga0500633_0043633 3300053160 Bacteria 1519
456 Ga0501084_0042775 3300054114 Bacteria 3789
457 Ga0501084_0083518 3300054114 Bacteria 2681
458 Ga0501082_0417552 3300060353 Bacteria 1171
459 Ga0466962_0000553 3300061719 Bacteria 16454
460 Ga0466962_0002936 3300061719 Bacteria 8128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10547019 Ga0070658_105470192 225
2 3300041512 Ga0451853_3177368 Ga0451853_3177368_2169_2882 226
3 3300048911 Ga0496108_0802924 Ga0496108_0802924_70_780 228
4 3300037853 Ga0436364_0564746 Ga0436364_0564746_21987_22703 230
5 3300039437 Ga0436365_1844330 Ga0436365_1844330_1135_1851 230
6 3300046559 Ga0495667_0217262 Ga0495667_0217262_23_772 231
7 3300047322 Ga0495680_0291099 Ga0495680_0291099_228_977 231
8 3300048907 Ga0496104_0008215 Ga0496104_0008215_248_1003 231
9 3300048908 Ga0496105_0002425 Ga0496105_0002425_9314_10063 231
10 3300048911 Ga0496108_0002432 Ga0496108_0002432_12845_13594 231
11 3300048912 Ga0496109_0004257 Ga0496109_0004257_10033_10782 231
12 3300048913 Ga0496110_0005344 Ga0496110_0005344_277_1026 231
13 3300048914 Ga0496111_0111638 Ga0496111_0111638_1245_1994 231
14 3300044735 Ga0466968_0012641 Ga0466968_0012641_2088_2801 233
15 3300009098 Ga0105245_10023911 Ga0105245_100239113 234
16 3300013306 Ga0163162_10459128 Ga0163162_104591282 234
17 3300042012 Ga0439455_0012667 Ga0439455_0012667_12_737 234
18 3300044684 Ga0466966_0003198 Ga0466966_0003198_4879_5607 234
19 3300044694 Ga0466963_0000242 Ga0466963_0000242_18134_18862 234
20 3300044706 Ga0466964_0020813 Ga0466964_0020813_1239_1967 234
21 3300044842 Ga0466957_0001560 Ga0466957_0001560_4408_5136 234
22 3300045049 Ga0466959_0047231 Ga0466959_0047231_659_1387 234
23 3300045836 Ga0466958_0000191 Ga0466958_0000191_7816_8544 234
24 3300045976 Ga0466967_0011101 Ga0466967_0011101_5794_6522 234
25 3300061719 Ga0466962_0002936 Ga0466962_0002936_5327_6055 234
26 3300009177 Ga0105248_10037187 Ga0105248_100371875 235
27 3300050490 nmdc:mga03n38_237899_c1 nmdc:mga03n38_237899_c1_217_945 236
28 3300047322 Ga0495680_0354187 Ga0495680_0354187_220_939 237
29 3300009148 Ga0105243_10560347 Ga0105243_105603472 238
30 3300013308 Ga0157375_10298223 Ga0157375_102982232 238
31 3300025944 Ga0207661_10350897 Ga0207661_103508972 238
32 3300049573 Ga0501037_0228215 Ga0501037_0228215_20_754 238
33 3300049583 Ga0501067_0330014 Ga0501067_0330014_100_837 238
34 3300049585 Ga0501069_0240123 Ga0501069_0240123_248_982 238
35 3300049823 Ga0501044_0041202 Ga0501044_0041202_4057_4797 238
36 3300045049 Ga0466959_0116045 Ga0466959_0116045_44_787 239
37 3300045976 Ga0466967_0000338 Ga0466967_0000338_14984_15727 239
38 3300050511 nmdc:mga08y16_418234_c1 nmdc:mga08y16_418234_c1_65_913 239
39 3300053085 Ga0495619_0450543 Ga0495619_0450543_97_861 239
40 3300009094 Ga0111539_10492664 Ga0111539_104926641 240
41 3300025906 Ga0207699_10260369 Ga0207699_102603692 244
42 3300054114 Ga0501084_0083518 Ga0501084_0083518_1362_2192 245
43 3300035117 Ga0373953_0023871 Ga0373953_0023871_1471_2274 247
44 3300053090 Ga0500646_0000120 Ga0500646_0000120_15638_16477 247
45 3300053092 Ga0500583_0069510 Ga0500583_0069510_71_910 247
46 3300053096 Ga0500641_0022250 Ga0500641_0022250_819_1658 247
47 3300053160 Ga0500633_0043633 Ga0500633_0043633_477_1316 247
48 iso_pu_bacteria 2904770941 2904773063 253
49 iso_pu_bacteria 2908811453 2908814105 253
50 iso_pu_bacteria 2919432681 2919435168 253
51 3300049568 Ga0501031_0075630 Ga0501031_0075630_419_1216 254
52 3300049569 Ga0501032_0050096 Ga0501032_0050096_36_833 254
53 3300049570 Ga0501033_0076698 Ga0501033_0076698_976_1773 254
54 3300049571 Ga0501034_0085647 Ga0501034_0085647_1898_2695 254
55 3300049574 Ga0501038_0069943 Ga0501038_0069943_321_1118 254
56 3300049581 Ga0501047_0000262 Ga0501047_0000262_45298_46095 254
57 3300049822 Ga0501035_0099971 Ga0501035_0099971_745_1542 254
58 3300049823 Ga0501044_0029546 Ga0501044_0029546_171_968 254
59 iso_pu_bacteria 2501939600 2501942335 254
60 iso_pu_bacteria 2929219909 2929225057 254
61 iso_pu_bacteria 2996221748 2996224848 254
62 3300006844 Ga0075428_100000289 Ga0075428_10000028928 255
63 3300050510 nmdc:mga06r32_3216_c1 nmdc:mga06r32_3216_c1_1810_2586 255
64 3300005347 Ga0070668_100002192 Ga0070668_10000219215 256
65 3300005367 Ga0070667_100049665 Ga0070667_1000496654 256
66 3300005435 Ga0070714_100263500 Ga0070714_1002635002 256
67 3300005455 Ga0070663_100000545 Ga0070663_1000005456 256
68 3300005842 Ga0068858_100031908 Ga0068858_1000319082 256
69 3300005842 Ga0068858_100397331 Ga0068858_1003973312 256
70 3300005844 Ga0068862_100328394 Ga0068862_1003283941 256
71 3300006844 Ga0075428_100227610 Ga0075428_1002276103 256
72 3300025929 Ga0207664_10064446 Ga0207664_100644463 256
73 3300025972 Ga0207668_10104391 Ga0207668_101043913 256
74 3300026067 Ga0207678_10026537 Ga0207678_100265376 256
75 3300033179 Ga0307507_10006953 Ga0307507_100069534 256
76 3300033179 Ga0307507_10295104 Ga0307507_102951042 256
77 3300044658 Ga0466972_0001629 Ga0466972_0001629_9243_10058 256
78 3300044706 Ga0466964_0024384 Ga0466964_0024384_258_1073 256
79 iso_pu_bacteria 2767802112 2768647974 256
80 iso_pu_bacteria 2862290372 2862296909 256
81 iso_pu_bacteria 2917736166 2917737326 256
82 iso_pu_bacteria 8003314358 8003318297 256
83 3300026035 Ga0207703_10213897 Ga0207703_102138972 257
84 3300028381 Ga0268264_10189576 Ga0268264_101895762 257
85 3300031838 Ga0307518_10001334 Ga0307518_100013345 257
86 3300042136 Ga0450900_006566 Ga0450900_006566_227_1051 257
87 iso_pu_bacteria 2585427649 2586063114 257
88 iso_pu_bacteria 2808606522 2809587739 257
89 iso_pu_bacteria 2861520306 2861522252 257
90 iso_pu_bacteria 2915768154 2915770195 257
91 iso_pu_bacteria 8056054917 8056058774 257
92 iso_pu_bacteria 8025530807 8025531269 258
93 3300005354 Ga0070675_100282798 Ga0070675_1002827982 259
94 3300005456 Ga0070678_100477279 Ga0070678_1004772791 259
95 3300005616 Ga0068852_100630837 Ga0068852_1006308372 259
96 3300025926 Ga0207659_10155919 Ga0207659_101559192 259
97 3300026121 Ga0207683_10263502 Ga0207683_102635022 259
98 3300026142 Ga0207698_10368386 Ga0207698_103683862 259
99 3300028794 Ga0307515_10000148 Ga0307515_1000014888 259
100 3300028794 Ga0307515_10021362 Ga0307515_100213625 259
101 3300028794 Ga0307515_10054707 Ga0307515_100547073 259
102 3300030522 Ga0307512_10009078 Ga0307512_100090789 259
103 3300030522 Ga0307512_10175445 Ga0307512_101754451 259
104 3300030744 Ga0316181_1228097 Ga0316181_12280971 259
105 3300031456 Ga0307513_10006041 Ga0307513_100060418 259
106 3300031507 Ga0307509_10062980 Ga0307509_100629802 259
107 3300031616 Ga0307508_10017565 Ga0307508_100175655 259
108 3300031616 Ga0307508_10030804 Ga0307508_100308044 259
109 3300031616 Ga0307508_10153435 Ga0307508_101534352 259
110 3300031730 Ga0307516_10000602 Ga0307516_1000060227 259
111 3300031730 Ga0307516_10294801 Ga0307516_102948012 259
112 3300031731 Ga0307405_10199703 Ga0307405_101997032 259
113 3300031911 Ga0307412_10115339 Ga0307412_101153392 259
114 3300031911 Ga0307412_10278689 Ga0307412_102786892 259
115 3300031995 Ga0307409_100000172 Ga0307409_10000017213 259
116 3300031995 Ga0307409_100032523 Ga0307409_1000325234 259
117 3300032002 Ga0307416_100000245 Ga0307416_1000002453 259
118 3300032005 Ga0307411_10162503 Ga0307411_101625031 259
119 3300032126 Ga0307415_100000019 Ga0307415_10000001927 259
120 3300032126 Ga0307415_100074940 Ga0307415_1000749403 259
121 3300032126 Ga0307415_100259848 Ga0307415_1002598482 259
122 3300034818 Ga0373950_0003253 Ga0373950_0003253_618_1499 259
123 3300035242 Ga0373962_0008823 Ga0373962_0008823_801_1760 259
124 3300041404 Ga0439436_0001613 Ga0439436_0001613_3664_4449 259
125 3300041999 Ga0439433_0012778 Ga0439433_0012778_52_837 259
126 3300042007 Ga0439449_0007001 Ga0439449_0007001_1608_2393 259
127 3300042014 Ga0439457_006016 Ga0439457_006016_408_1193 259
128 3300046455 Ga0495603_0004509 Ga0495603_0004509_6094_6912 259
129 3300046459 Ga0495629_0025615 Ga0495629_0025615_2499_3317 259
130 3300046462 Ga0495651_0027217 Ga0495651_0027217_1752_2570 259
131 3300046477 Ga0495664_0058198 Ga0495664_0058198_104_922 259
132 3300046492 Ga0495585_0107153 Ga0495585_0107153_118_933 259
133 3300046514 Ga0495618_0030681 Ga0495618_0030681_1415_2233 259
134 3300046516 Ga0495628_0009609 Ga0495628_0009609_1171_1989 259
135 3300046529 Ga0495652_0075361 Ga0495652_0075361_863_1681 259
136 3300046533 Ga0495640_0068556 Ga0495640_0068556_313_1128 259
137 3300046642 Ga0495634_0021084 Ga0495634_0021084_2068_2886 259
138 3300046675 Ga0495657_0032769 Ga0495657_0032769_2135_2953 259
139 3300046689 Ga0495613_0006541 Ga0495613_0006541_6547_7365 259
140 3300046690 Ga0495624_0011734 Ga0495624_0011734_513_1331 259
141 3300046809 Ga0495600_0031695 Ga0495600_0031695_1197_2015 259
142 3300047317 Ga0495604_0028758 Ga0495604_0028758_2411_3229 259
143 3300047321 Ga0495676_0012698 Ga0495676_0012698_2140_2958 259
144 3300049581 Ga0501047_0017013 Ga0501047_0017013_2717_3532 259
145 3300049581 Ga0501047_0018821 Ga0501047_0018821_5324_6139 259
146 3300049583 Ga0501067_0137271 Ga0501067_0137271_227_1042 259
147 3300049584 Ga0501068_0007474 Ga0501068_0007474_5062_5877 259
148 3300049587 Ga0501071_0014708 Ga0501071_0014708_144_959 259
149 3300049588 Ga0501072_0239304 Ga0501072_0239304_408_1223 259
150 3300049590 Ga0501074_0018823 Ga0501074_0018823_786_1601 259
151 3300049741 Ga0501079_0406776 Ga0501079_0406776_220_1035 259
152 3300053088 Ga0500644_0133705 Ga0500644_0133705_97_876 259
153 3300053131 Ga0500652_051716 Ga0500652_051716_745_1524 259
154 3300060353 Ga0501082_0417552 Ga0501082_0417552_206_1021 259
155 iso_pu_bacteria 2751185782 2753267308 259
156 iso_pu_bacteria 2795385472 2795797878 259
157 iso_pu_bacteria 2867346516 2867347174 259
158 iso_pu_bacteria 8057568493 8057572663 259
159 3300005347 Ga0070668_100001221 Ga0070668_1000012216 260
160 3300005618 Ga0068864_100005044 Ga0068864_1000050444 260
161 3300005985 Ga0081539_10008387 Ga0081539_100083871 260
162 3300006844 Ga0075428_100681372 Ga0075428_1006813721 260
163 3300025915 Ga0207693_10145955 Ga0207693_101459551 260
164 3300025939 Ga0207665_10069436 Ga0207665_100694362 260
165 3300025941 Ga0207711_10011074 Ga0207711_100110743 260
166 3300025945 Ga0207679_10322143 Ga0207679_103221432 260
167 3300025972 Ga0207668_10000735 Ga0207668_100007356 260
168 3300026035 Ga0207703_10123313 Ga0207703_101233133 260
169 3300026088 Ga0207641_10066476 Ga0207641_100664765 260
170 3300026095 Ga0207676_10019709 Ga0207676_100197095 260
171 3300028381 Ga0268264_10206991 Ga0268264_102069912 260
172 3300031731 Ga0307405_10242827 Ga0307405_102428272 260
173 3300031824 Ga0307413_10275242 Ga0307413_102752422 260
174 3300031889 Ga0326468_10001011 Ga0326468_100010113 260
175 3300031911 Ga0307412_10058211 Ga0307412_100582112 260
176 3300031995 Ga0307409_100009630 Ga0307409_1000096302 260
177 3300032002 Ga0307416_100001922 Ga0307416_10000192210 260
178 3300032126 Ga0307415_100132932 Ga0307415_1001329322 260
179 3300035207 Ga0373942_0000805 Ga0373942_0000805_2166_3002 260
180 3300042007 Ga0439449_0002877 Ga0439449_0002877_2172_3005 260
181 3300042014 Ga0439457_000207 Ga0439457_000207_5634_6470 260
182 3300042015 Ga0439462_0020069 Ga0439462_0020069_85_921 260
183 3300042131 Ga0450894_000078 Ga0450894_000078_6420_7256 260
184 3300042135 Ga0450899_000512 Ga0450899_000512_1121_1957 260
185 3300042145 Ga0450906_001212 Ga0450906_001212_169_1005 260
186 3300046455 Ga0495603_0027006 Ga0495603_0027006_2373_3194 260
187 3300048911 Ga0496108_0009514 Ga0496108_0009514_4808_5662 260
188 3300048912 Ga0496109_0107978 Ga0496109_0107978_1062_1916 260
189 3300048915 Ga0496112_0288402 Ga0496112_0288402_227_1081 260
190 3300048916 Ga0496113_0256938 Ga0496113_0256938_141_995 260
191 3300049575 Ga0501039_0170371 Ga0501039_0170371_203_1063 260
192 3300049579 Ga0501043_0066618 Ga0501043_0066618_646_1506 260
193 3300049581 Ga0501047_0069500 Ga0501047_0069500_753_1613 260
194 3300049589 Ga0501073_0024135 Ga0501073_0024135_1486_2304 260
195 3300049743 Ga0501081_0373474 Ga0501081_0373474_231_1016 260
196 3300049744 Ga0501083_0100761 Ga0501083_0100761_96_914 260
197 3300050507 nmdc:mga05p37_369254_c1 nmdc:mga05p37_369254_c1_170_973 260
198 3300054114 Ga0501084_0042775 Ga0501084_0042775_560_1378 260
199 iso_pu_bacteria 2784746763 2785344380 260
200 iso_pu_bacteria 2862574272 2862580087 260
201 iso_pu_bacteria 2990059506 2990060465 260
202 iso_pu_bacteria 3006493962 3006501046 260
203 iso_pu_bacteria 8048406513 8048408492 260
204 3300003203 JGI25406J46586_10036472 JGI25406J46586_100364722 261
205 3300005337 Ga0070682_100148920 Ga0070682_1001489201 261
206 3300005985 Ga0081539_10012722 Ga0081539_100127224 261
207 3300030521 Ga0307511_10171527 Ga0307511_101715271 261
208 3300031456 Ga0307513_10000001 Ga0307513_10000001956 261
209 3300031456 Ga0307513_10010821 Ga0307513_100108213 261
210 3300031456 Ga0307513_10081266 Ga0307513_100812664 261
211 3300031616 Ga0307508_10027186 Ga0307508_100271862 261
212 3300031730 Ga0307516_10062340 Ga0307516_100623404 261
213 3300032005 Ga0307411_10194142 Ga0307411_101941422 261
214 3300037068 Ga0373925_0103955 Ga0373925_0103955_933_1790 261
215 3300037471 Ga0395905_0065652 Ga0395905_0065652_2478_3263 261
216 3300038443 Ga0395901_0090688 Ga0395901_0090688_1977_2762 261
217 3300047315 Ga0495581_0314483 Ga0495581_0314483_40_897 261
218 3300050510 nmdc:mga06r32_32708_c1 nmdc:mga06r32_32708_c1_2761_3546 261
219 iso_pu_bacteria 2515154088 2515498230 261
220 iso_pu_bacteria 2515154129 2515722817 261
221 iso_pu_bacteria 2515154137 2515757125 261
222 iso_pu_bacteria 2515154202 2516086653 261
223 iso_pu_bacteria 2515154203 2516092092 261
224 iso_pu_bacteria 2547132111 2547407900 261
225 iso_pu_bacteria 2622736626 2623591175 261
226 iso_pu_bacteria 2772190715 2772647221 261
227 iso_pu_bacteria 2784132148 2784587774 261
228 iso_pu_bacteria 2808606448 2809231355 261
229 iso_pu_bacteria 2831935698 2831938520 261
230 iso_pu_bacteria 2832004796 2832005418 261
231 iso_pu_bacteria 2855670206 2855674079 261
232 iso_pu_bacteria 2855676851 2855677096 261
233 iso_pu_bacteria 2855683550 2855688849 261
234 iso_pu_bacteria 2856858025 2856858129 261
235 iso_pu_bacteria 2857288857 2857295368 261
236 iso_pu_bacteria 2858848962 2858852770 261
237 iso_pu_bacteria 2858868258 2858872013 261
238 iso_pu_bacteria 2858882152 2858886606 261
239 iso_pu_bacteria 2858888857 2858894306 261
240 iso_pu_bacteria 2858895516 2858898185 261
241 iso_pu_bacteria 2858902515 2858908252 261
242 iso_pu_bacteria 2862705112 2862706211 261
243 iso_pu_bacteria 2866065130 2866065799 261
244 iso_pu_bacteria 2867302475 2867307654 261
245 iso_pu_bacteria 2867507094 2867512924 261
246 iso_pu_bacteria 2869048445 2869054904 261
247 iso_pu_bacteria 2869061728 2869067440 261
248 iso_pu_bacteria 2869068681 2869072598 261
249 iso_pu_bacteria 2873151551 2873156661 261
250 iso_pu_bacteria 2880489317 2880495946 261
251 iso_pu_bacteria 2880495981 2880496422 261
252 iso_pu_bacteria 2902582711 2902584863 261
253 iso_pu_bacteria 2929226422 2929231979 261
254 iso_pu_bacteria 2935390628 2935392204 261
255 iso_pu_bacteria 2947224130 2947230437 261
256 iso_pu_bacteria 649633069 649813630 261
257 iso_pu_bacteria 8003830390 8003835068 261
258 iso_pu_bacteria 8003870546 8003877093 261
259 iso_pu_bacteria 8008485437 8008488980 261
260 iso_pu_bacteria 8023623736 8023628180 261
261 iso_pu_bacteria 8025524527 8025528463 261
262 iso_pu_bacteria 8054704163 8054705262 261
263 iso_pu_bacteria 8054727385 8054729993 261
264 iso_pu_bacteria 8055412473 8055416588 261
265 iso_pu_bacteria 8056447290 8056453288 261
266 3300006178 Ga0075367_10000221 Ga0075367_1000022119 262
267 3300009147 Ga0114129_10000056 Ga0114129_1000005684 262
268 3300014497 Ga0182008_10000271 Ga0182008_1000027138 262
269 3300015262 Ga0182007_10000743 Ga0182007_100007436 262
270 3300015265 Ga0182005_1007173 Ga0182005_10071734 262
271 3300015688 Ga0183367_1009 Ga0183367_100937 262
272 3300025297 Ga0209758_1008986 Ga0209758_10089865 262
273 3300026041 Ga0207639_10272944 Ga0207639_102729441 262
274 3300031649 Ga0307514_10015333 Ga0307514_100153336 262
275 3300031730 Ga0307516_10004212 Ga0307516_1000421213 262
276 3300033180 Ga0307510_10014199 Ga0307510_1001419911 262
277 3300035091 Ga0373951_0000210 Ga0373951_0000210_4662_5450 262
278 3300035207 Ga0373942_0028637 Ga0373942_0028637_105_941 262
279 3300041404 Ga0439436_0008087 Ga0439436_0008087_1800_2636 262
280 3300041406 Ga0439439_0007230 Ga0439439_0007230_1623_2459 262
281 3300041443 Ga0451789_0057754 Ga0451789_0057754_2388_3206 262
282 3300041452 Ga0451793_0438160 Ga0451793_0438160_2965_3783 262
283 3300041512 Ga0451853_0264747 Ga0451853_0264747_2695_3513 262
284 3300042002 Ga0439442_038226 Ga0439442_038226_144_980 262
285 3300042014 Ga0439457_002396 Ga0439457_002396_1849_2685 262
286 3300042015 Ga0439462_0055513 Ga0439462_0055513_202_1038 262
287 3300044658 Ga0466972_0027826 Ga0466972_0027826_381_1214 262
288 3300044658 Ga0466972_0113082 Ga0466972_0113082_395_1228 262
289 3300044683 Ga0466965_0005287 Ga0466965_0005287_520_1353 262
290 3300044684 Ga0466966_0007208 Ga0466966_0007208_520_1353 262
291 3300044684 Ga0466966_0018532 Ga0466966_0018532_804_1637 262
292 3300044693 Ga0466961_0002755 Ga0466961_0002755_4083_4916 262
293 3300044693 Ga0466961_0032047 Ga0466961_0032047_661_1494 262
294 3300044694 Ga0466963_0000228 Ga0466963_0000228_561_1400 262
295 3300044694 Ga0466963_0006692 Ga0466963_0006692_537_1370 262
296 3300044719 Ga0466971_0057197 Ga0466971_0057197_851_1684 262
297 3300044719 Ga0466971_0080761 Ga0466971_0080761_113_946 262
298 3300044765 Ga0466970_0000447 Ga0466970_0000447_12814_13647 262
299 3300044842 Ga0466957_0000135 Ga0466957_0000135_23952_24785 262
300 3300045049 Ga0466959_0000505 Ga0466959_0000505_8600_9433 262
301 3300045836 Ga0466958_0000091 Ga0466958_0000091_4041_4874 262
302 3300045976 Ga0466967_0001768 Ga0466967_0001768_10409_11242 262
303 3300045976 Ga0466967_0010303 Ga0466967_0010303_2638_3477 262
304 3300046459 Ga0495629_0063406 Ga0495629_0063406_223_1053 262
305 3300046459 Ga0495629_0082706 Ga0495629_0082706_1381_2211 262
306 3300046460 Ga0495638_0098416 Ga0495638_0098416_886_1716 262
307 3300046475 Ga0495639_0075259 Ga0495639_0075259_205_1029 262
308 3300046492 Ga0495585_0061702 Ga0495585_0061702_83_913 262
309 3300046648 Ga0495611_0088749 Ga0495611_0088749_585_1415 262
310 3300046660 Ga0495625_0063276 Ga0495625_0063276_73_903 262
311 3300046665 Ga0495661_0117273 Ga0495661_0117273_538_1368 262
312 3300047318 Ga0495636_0021125 Ga0495636_0021125_1414_2238 262
313 3300047318 Ga0495636_0049494 Ga0495636_0049494_429_1259 262
314 3300047323 Ga0495683_0075920 Ga0495683_0075920_786_1616 262
315 3300048911 Ga0496108_0000065 Ga0496108_0000065_98375_99172 262
316 3300048912 Ga0496109_0280415 Ga0496109_0280415_148_966 262
317 3300048912 Ga0496109_0549928 Ga0496109_0549928_18_842 262
318 3300048914 Ga0496111_0254144 Ga0496111_0254144_190_1014 262
319 3300048917 Ga0496114_0265996 Ga0496114_0265996_517_1335 262
320 3300049568 Ga0501031_0223972 Ga0501031_0223972_34_870 262
321 3300049570 Ga0501033_0001528 Ga0501033_0001528_4080_4919 262
322 3300049570 Ga0501033_0074206 Ga0501033_0074206_535_1374 262
323 3300049570 Ga0501033_0087284 Ga0501033_0087284_518_1354 262
324 3300049571 Ga0501034_0005839 Ga0501034_0005839_12011_12850 262
325 3300049571 Ga0501034_0121725 Ga0501034_0121725_317_1153 262
326 3300049571 Ga0501034_0185356 Ga0501034_0185356_779_1645 262
327 3300049572 Ga0501036_0000194 Ga0501036_0000194_33564_34403 262
328 3300049572 Ga0501036_0023220 Ga0501036_0023220_4132_4971 262
329 3300049573 Ga0501037_0022403 Ga0501037_0022403_33_899 262
330 3300049573 Ga0501037_0090626 Ga0501037_0090626_134_970 262
331 3300049574 Ga0501038_0123758 Ga0501038_0123758_497_1336 262
332 3300049575 Ga0501039_0003711 Ga0501039_0003711_5836_6675 262
333 3300049578 Ga0501042_0031922 Ga0501042_0031922_402_1238 262
334 3300049579 Ga0501043_0006818 Ga0501043_0006818_2657_3496 262
335 3300049579 Ga0501043_0020682 Ga0501043_0020682_1645_2481 262
336 3300049579 Ga0501043_0237917 Ga0501043_0237917_42_896 262
337 3300049580 Ga0501046_0093395 Ga0501046_0093395_666_1502 262
338 3300049580 Ga0501046_0142304 Ga0501046_0142304_677_1543 262
339 3300049581 Ga0501047_0009638 Ga0501047_0009638_3661_4527 262
340 3300049581 Ga0501047_0122051 Ga0501047_0122051_274_1113 262
341 3300049581 Ga0501047_0284191 Ga0501047_0284191_496_1332 262
342 3300049582 Ga0501048_0120439 Ga0501048_0120439_597_1463 262
343 3300049582 Ga0501048_0130251 Ga0501048_0130251_295_1131 262
344 3300049586 Ga0501070_0002266 Ga0501070_0002266_4132_4971 262
345 3300049590 Ga0501074_0000943 Ga0501074_0000943_17410_18249 262
346 3300049822 Ga0501035_0000782 Ga0501035_0000782_7916_8755 262
347 3300049822 Ga0501035_0050190 Ga0501035_0050190_195_1031 262
348 3300049822 Ga0501035_0087588 Ga0501035_0087588_414_1280 262
349 3300049823 Ga0501044_0080595 Ga0501044_0080595_2061_2927 262
350 3300049823 Ga0501044_0124494 Ga0501044_0124494_1056_1895 262
351 3300050494 nmdc:mga06z11_10347_c1 nmdc:mga06z11_10347_c1_2027_2866 262
352 3300050496 nmdc:mga07m45_53377_c1 nmdc:mga07m45_53377_c1_181_1020 262
353 3300050507 nmdc:mga05p37_720_c1 nmdc:mga05p37_720_c1_4795_5625 262
354 3300050508 nmdc:mga09592_274606_c1 nmdc:mga09592_274606_c1_107_937 262
355 3300061719 Ga0466962_0000553 Ga0466962_0000553_323_1156 262
356 iso_pu_bacteria 2643221587 2643944767 262
357 iso_pu_bacteria 2643221670 2644385296 262
358 iso_pu_bacteria 2643221677 2644431665 262
359 iso_pu_bacteria 2675903059 2676482395 262
360 iso_pu_bacteria 2811994879 2812359093 262
361 iso_pu_bacteria 2852635781 2852641177 262
362 iso_pu_bacteria 2862281513 2862288255 262
363 iso_pu_bacteria 2862507626 2862510849 262
364 iso_pu_bacteria 2912715099 2912721021 262
365 iso_pu_bacteria 2912723979 2912725105 262
366 iso_pu_bacteria 2918501144 2918503729 262
367 iso_pu_bacteria 2946064051 2946066784 262
368 iso_pu_bacteria 8003856774 8003861930 262
369 iso_pu_bacteria 8025478263 8025484081 262
370 iso_pu_bacteria 8056667051 8056673341 262
371 3300003354 JGI25160J50197_1016879 JGI25160J50197_10168791 263
372 3300005535 Ga0070684_100614767 Ga0070684_1006147671 263
373 3300005983 Ga0081540_1009407 Ga0081540_10094076 263
374 3300006844 Ga0075428_100069453 Ga0075428_1000694534 263
375 3300025302 Ga0207426_1006442 Ga0207426_10064424 263
376 3300031507 Ga0307509_10059563 Ga0307509_100595635 263
377 3300031616 Ga0307508_10016608 Ga0307508_100166082 263
378 3300031730 Ga0307516_10447080 Ga0307516_104470801 263
379 3300031901 Ga0307406_10238098 Ga0307406_102380981 263
380 3300031901 Ga0307406_10381628 Ga0307406_103816281 263
381 3300035692 Ga0373935_0566953 Ga0373935_0566953_16_816 263
382 3300046507 Ga0495606_0002794 Ga0495606_0002794_12792_13607 263
383 3300046519 Ga0495632_0058869 Ga0495632_0058869_219_1013 263
384 3300046616 Ga0495668_0001860 Ga0495668_0001860_12230_13045 263
385 3300046660 Ga0495625_0005758 Ga0495625_0005758_5875_6690 263
386 3300047323 Ga0495683_0028230 Ga0495683_0028230_470_1285 263
387 3300048091 Ga0495626_0000124 Ga0495626_0000124_5879_6694 263
388 3300049127 Ga0501306_003016 Ga0501306_003016_82_915 263
389 iso_pu_bacteria 2811994917 2812481327 263
390 iso_pu_bacteria 2862178590 2862182581 263
391 iso_pu_bacteria 2867312974 2867316445 263
392 iso_pu_bacteria 2867319477 2867324919 263
393 iso_pu_bacteria 2887478801 2887480724 263
394 iso_pu_bacteria 2990044586 2990046329 263
395 iso_pu_bacteria 2997600082 2997608245 263
396 iso_pu_bacteria 3006486233 3006487073 263
397 iso_pu_bacteria 8001781756 8001786181 263
398 iso_pu_bacteria 8048127548 8048127606 263
399 3300003322 rootL2_10030927 rootL2_100309275 264
400 3300005331 Ga0070670_100267917 Ga0070670_1002679172 264
401 3300005543 Ga0070672_100451162 Ga0070672_1004511622 264
402 3300005563 Ga0068855_100182206 Ga0068855_1001822063 264
403 3300005937 Ga0081455_10173680 Ga0081455_101736802 264
404 3300006038 Ga0075365_10099219 Ga0075365_100992192 264
405 3300013307 Ga0157372_10227788 Ga0157372_102277882 264
406 3300025904 Ga0207647_10004516 Ga0207647_100045166 264
407 3300025921 Ga0207652_10448634 Ga0207652_104486341 264
408 3300025940 Ga0207691_10357068 Ga0207691_103570682 264
409 3300028786 Ga0307517_10010178 Ga0307517_100101785 264
410 3300028794 Ga0307515_10000694 Ga0307515_1000069438 264
411 3300028794 Ga0307515_10103338 Ga0307515_101033382 264
412 3300030521 Ga0307511_10013070 Ga0307511_100130708 264
413 3300030522 Ga0307512_10006851 Ga0307512_100068519 264
414 3300031456 Ga0307513_10004273 Ga0307513_1000427315 264
415 3300031507 Ga0307509_10033617 Ga0307509_100336176 264
416 3300031507 Ga0307509_10107151 Ga0307509_101071513 264
417 3300031616 Ga0307508_10022091 Ga0307508_100220914 264
418 3300031616 Ga0307508_10024158 Ga0307508_100241586 264
419 3300031730 Ga0307516_10405541 Ga0307516_104055412 264
420 3300031838 Ga0307518_10131776 Ga0307518_101317763 264
421 3300033179 Ga0307507_10038082 Ga0307507_100380826 264
422 3300033180 Ga0307510_10006420 Ga0307510_100064204 264
423 3300033180 Ga0307510_10032673 Ga0307510_100326737 264
424 3300035086 Ga0373934_0106970 Ga0373934_0106970_116_973 264
425 3300036401 Ga0373937_0052921 Ga0373937_0052921_438_1295 264
426 3300037312 Ga0395899_0259864 Ga0395899_0259864_147_995 264
427 3300037466 Ga0395898_0002018 Ga0395898_0002018_8758_9609 264
428 3300037466 Ga0395898_0007217 Ga0395898_0007217_6676_7524 264
429 3300037466 Ga0395898_0018932 Ga0395898_0018932_5795_6643 264
430 3300037471 Ga0395905_0214074 Ga0395905_0214074_480_1328 264
431 3300038443 Ga0395901_0381834 Ga0395901_0381834_316_1164 264
432 3300039437 Ga0436365_1749326 Ga0436365_1749326_3166_4029 264
433 3300039453 Ga0436362_0578357 Ga0436362_0578357_2021_2884 264
434 3300041453 Ga0451797_1149328 Ga0451797_1149328_136_981 264
435 3300041486 Ga0451807_2244245 Ga0451807_2244245_536_1384 264
436 3300041494 Ga0451837_0805466 Ga0451837_0805466_2810_3661 264
437 3300041509 Ga0451843_1434338 Ga0451843_1434338_329_1177 264
438 3300041512 Ga0451853_3778753 Ga0451853_3778753_519_1367 264
439 3300042005 Ga0439448_0004081 Ga0439448_0004081_459_1307 264
440 3300042138 Ga0450903_000278 Ga0450903_000278_1138_1986 264
441 3300042157 Ga0439458_0000893 Ga0439458_0000893_73_921 264
442 3300044658 Ga0466972_0009786 Ga0466972_0009786_889_1737 264
443 3300044706 Ga0466964_0072242 Ga0466964_0072242_97_945 264
444 3300044719 Ga0466971_0051495 Ga0466971_0051495_434_1282 264
445 3300045976 Ga0466967_0219170 Ga0466967_0219170_905_1756 264
446 3300046452 Ga0495617_007183 Ga0495617_007183_953_1798 264
447 3300046454 Ga0495592_0000576 Ga0495592_0000576_17952_18803 264
448 3300046454 Ga0495592_0029821 Ga0495592_0029821_1037_1882 264
449 3300046459 Ga0495629_0018180 Ga0495629_0018180_21_866 264
450 3300046459 Ga0495629_0103633 Ga0495629_0103633_641_1486 264
451 3300046460 Ga0495638_0109831 Ga0495638_0109831_263_1108 264
452 3300046462 Ga0495651_0006756 Ga0495651_0006756_2194_3039 264
453 3300046462 Ga0495651_0080489 Ga0495651_0080489_1516_2367 264
454 3300046472 Ga0495580_0083826 Ga0495580_0083826_678_1523 264
455 3300046473 Ga0495582_0017390 Ga0495582_0017390_963_1808 264
456 3300046474 Ga0495605_0001658 Ga0495605_0001658_12970_13815 264
457 3300046475 Ga0495639_0010319 Ga0495639_0010319_1969_2814 264
458 3300046476 Ga0495662_0010186 Ga0495662_0010186_531_1376 264
459 3300046476 Ga0495662_0032816 Ga0495662_0032816_440_1285 264
460 3300046476 Ga0495662_0042962 Ga0495662_0042962_1233_2084 264
461 3300046477 Ga0495664_0012030 Ga0495664_0012030_778_1629 264
462 3300046477 Ga0495664_0025636 Ga0495664_0025636_1344_2189 264
463 3300046492 Ga0495585_0075279 Ga0495585_0075279_578_1423 264
464 3300046499 Ga0495594_0023731 Ga0495594_0023731_794_1639 264
465 3300046500 Ga0495596_0044250 Ga0495596_0044250_59_904 264
466 3300046501 Ga0495607_0003648 Ga0495607_0003648_10012_10857 264
467 3300046507 Ga0495606_0011812 Ga0495606_0011812_1447_2292 264
468 3300046513 Ga0495616_0002816 Ga0495616_0002816_4987_5832 264
469 3300046514 Ga0495618_0087402 Ga0495618_0087402_801_1646 264
470 3300046515 Ga0495620_0005411 Ga0495620_0005411_4323_5168 264
471 3300046517 Ga0495630_0081537 Ga0495630_0081537_1540_2391 264
472 3300046518 Ga0495631_0002350 Ga0495631_0002350_6321_7166 264
473 3300046519 Ga0495632_0063300 Ga0495632_0063300_639_1484 264
474 3300046522 Ga0495643_0003597 Ga0495643_0003597_7241_8086 264
475 3300046524 Ga0495648_0047005 Ga0495648_0047005_1213_2058 264
476 3300046524 Ga0495648_0113603 Ga0495648_0113603_540_1385 264
477 3300046526 Ga0495666_0028119 Ga0495666_0028119_445_1290 264
478 3300046529 Ga0495652_0045219 Ga0495652_0045219_2297_3142 264
479 3300046530 Ga0495654_0068714 Ga0495654_0068714_37_882 264
480 3300046536 Ga0495587_0001673 Ga0495587_0001673_1659_2510 264
481 3300046542 Ga0495597_0005535 Ga0495597_0005535_5365_6210 264
482 3300046543 Ga0495645_0057379 Ga0495645_0057379_1815_2666 264
483 3300046557 Ga0495622_0015894 Ga0495622_0015894_578_1423 264
484 3300046642 Ga0495634_0001729 Ga0495634_0001729_17777_18628 264
485 3300046648 Ga0495611_0023970 Ga0495611_0023970_1035_1880 264
486 3300046660 Ga0495625_0007465 Ga0495625_0007465_6584_7426 264
487 3300046660 Ga0495625_0091755 Ga0495625_0091755_680_1528 264
488 3300046660 Ga0495625_0091787 Ga0495625_0091787_10_858 264
489 3300046663 Ga0495635_0005862 Ga0495635_0005862_4367_5212 264
490 3300046663 Ga0495635_0040128 Ga0495635_0040128_1015_1866 264
491 3300046665 Ga0495661_0066485 Ga0495661_0066485_423_1268 264
492 3300046674 Ga0495588_0038888 Ga0495588_0038888_1506_2348 264
493 3300046675 Ga0495657_0025823 Ga0495657_0025823_1240_2091 264
494 3300046675 Ga0495657_0129550 Ga0495657_0129550_636_1481 264
495 3300046678 Ga0495599_0130424 Ga0495599_0130424_555_1400 264
496 3300046679 Ga0495623_0045568 Ga0495623_0045568_97_942 264
497 3300046680 Ga0495646_0008466 Ga0495646_0008466_5339_6190 264
498 3300046683 Ga0495658_0086832 Ga0495658_0086832_852_1694 264
499 3300046689 Ga0495613_0001343 Ga0495613_0001343_17816_18667 264
500 3300046689 Ga0495613_0011024 Ga0495613_0011024_908_1753 264
501 3300046689 Ga0495613_0013617 Ga0495613_0013617_4044_4889 264
502 3300046690 Ga0495624_0037842 Ga0495624_0037842_1923_2768 264
503 3300046691 Ga0495670_0066372 Ga0495670_0066372_73_918 264
504 3300046692 Ga0495671_0002481 Ga0495671_0002481_6860_7702 264
505 3300046794 Ga0495589_0021485 Ga0495589_0021485_282_1127 264
506 3300046809 Ga0495600_0029472 Ga0495600_0029472_1816_2667 264
507 3300046810 Ga0495660_0073382 Ga0495660_0073382_411_1256 264
508 3300047315 Ga0495581_0006597 Ga0495581_0006597_1093_1944 264
509 3300047315 Ga0495581_0034568 Ga0495581_0034568_1357_2202 264
510 3300047317 Ga0495604_0004851 Ga0495604_0004851_6873_7724 264
511 3300047317 Ga0495604_0078399 Ga0495604_0078399_1427_2272 264
512 3300047320 Ga0495672_0072310 Ga0495672_0072310_577_1422 264
513 3300047321 Ga0495676_0014435 Ga0495676_0014435_4323_5168 264
514 3300047321 Ga0495676_0050055 Ga0495676_0050055_912_1763 264
515 3300047322 Ga0495680_0003920 Ga0495680_0003920_5913_6758 264
516 3300047443 Ga0495687_000383 Ga0495687_000383_29449_30300 264
517 3300047443 Ga0495687_003440 Ga0495687_003440_5982_6833 264
518 3300047443 Ga0495687_071847 Ga0495687_071847_29_874 264
519 3300047444 Ga0495675_0015624 Ga0495675_0015624_1248_2093 264
520 3300047447 Ga0495685_013841 Ga0495685_013841_1072_1920 264
521 3300047470 Ga0495681_0001710 Ga0495681_0001710_5764_6606 264
522 3300047470 Ga0495681_0036632 Ga0495681_0036632_734_1579 264
523 3300047471 Ga0495684_0023325 Ga0495684_0023325_701_1552 264
524 3300047472 Ga0495686_0014889 Ga0495686_0014889_1031_1882 264
525 3300047472 Ga0495686_0034886 Ga0495686_0034886_551_1396 264
526 3300047472 Ga0495686_0068049 Ga0495686_0068049_787_1629 264
527 3300047673 Ga0495593_0069859 Ga0495593_0069859_286_1137 264
528 3300047673 Ga0495593_0117684 Ga0495593_0117684_141_986 264
529 3300048088 Ga0495602_0031956 Ga0495602_0031956_114_965 264
530 3300048091 Ga0495626_0025416 Ga0495626_0025416_555_1400 264
531 3300049460 Ga0495682_0053165 Ga0495682_0053165_330_1175 264
532 3300049569 Ga0501032_0218501 Ga0501032_0218501_379_1224 264
533 3300049570 Ga0501033_0001330 Ga0501033_0001330_2077_2925 264
534 3300049571 Ga0501034_0013930 Ga0501034_0013930_2558_3403 264
535 3300049571 Ga0501034_0184319 Ga0501034_0184319_1040_1897 264
536 3300049572 Ga0501036_0148903 Ga0501036_0148903_768_1613 264
537 3300049574 Ga0501038_0000407 Ga0501038_0000407_34052_34897 264
538 3300049579 Ga0501043_0049387 Ga0501043_0049387_562_1407 264
539 3300049581 Ga0501047_0043464 Ga0501047_0043464_762_1607 264
540 3300049581 Ga0501047_0050900 Ga0501047_0050900_2275_3120 264
541 3300049589 Ga0501073_0203964 Ga0501073_0203964_30_875 264
542 3300049742 Ga0501080_0255837 Ga0501080_0255837_433_1278 264
543 3300049822 Ga0501035_0021875 Ga0501035_0021875_2756_3601 264
544 3300049822 Ga0501035_0068672 Ga0501035_0068672_1384_2229 264
545 3300049823 Ga0501044_0001691 Ga0501044_0001691_4780_5631 264
546 3300049823 Ga0501044_0056501 Ga0501044_0056501_2432_3277 264
547 3300053085 Ga0495619_0012519 Ga0495619_0012519_1893_2750 264
548 3300053095 Ga0500640_017076 Ga0500640_017076_2113_2964 264
549 3300053111 Ga0500572_014561 Ga0500572_014561_1056_1907 264
550 3300053140 Ga0500573_0071923 Ga0500573_0071923_108_959 264
551 3300053149 Ga0500600_0172216 Ga0500600_0172216_13_855 264
552 iso_pu_bacteria 2582581313 2585304950 264
553 iso_pu_bacteria 2582581314 2585318891 264
554 iso_pu_bacteria 2616644814 2616694793 264
555 iso_pu_bacteria 2643221647 2644269144 264
556 iso_pu_bacteria 2643221678 2644436263 264
557 iso_pu_bacteria 2643221714 2644625864 264
558 iso_pu_bacteria 2784746768 2785368471 264
559 iso_pu_bacteria 2786546132 2786669478 264
560 iso_pu_bacteria 2791355406 2793977794 264
561 iso_pu_bacteria 2808606359 2808841160 264
562 iso_pu_bacteria 2808606375 2808919666 264
563 iso_pu_bacteria 2862382967 2862386659 264
564 iso_pu_bacteria 2863404153 2863405626 264
565 iso_pu_bacteria 2867428634 2867430134 264
566 iso_pu_bacteria 2877676314 2877682060 264
567 iso_pu_bacteria 2919468124 2919468560 264
568 iso_pu_bacteria 2954002825 2954003811 264
569 iso_pu_bacteria 2954380949 2954387180 264
570 iso_pu_bacteria 2954673503 2954675967 264
571 iso_pu_bacteria 2954682443 2954688199 264
572 iso_pu_bacteria 2954691527 2954698021 264
573 iso_pu_bacteria 2954701450 2954704194 264
574 iso_pu_bacteria 2954711539 2954717131 264
575 iso_pu_bacteria 2954721474 2954727099 264
576 iso_pu_bacteria 2954731030 2954734702 264
577 iso_pu_bacteria 2954740390 2954746004 264
578 iso_pu_bacteria 2954749733 2954753589 264
579 iso_pu_bacteria 2954759201 2954764974 264
580 iso_pu_bacteria 2990088156 2990092495 264
581 iso_pu_bacteria 3006393351 3006396269 264
582 iso_pu_bacteria 8008558824 8008559441 264
583 iso_pu_bacteria 8008574985 8008579705 264
584 iso_pu_bacteria 8047893842 8047899044 264
585 iso_pu_bacteria 8048356638 8048359876 264
586 iso_pu_bacteria 8048369669 8048376008 264
587 iso_pu_bacteria 8048379754 8048382112 264
588 iso_pu_bacteria 8056829672 8056836838 264
589 3300037853 Ga0436364_0829014 Ga0436364_0829014_8934_9797 265
590 3300047317 Ga0495604_0001115 Ga0495604_0001115_16902_17768 265
591 3300049822 Ga0501035_0009426 Ga0501035_0009426_6440_7300 265
592 3300049823 Ga0501044_0021405 Ga0501044_0021405_5762_6622 265
593 iso_pu_bacteria 2808606982 2811848190 265
594 3300003203 JGI25406J46586_10022793 JGI25406J46586_100227934 266
595 3300005985 Ga0081539_10002173 Ga0081539_1000217315 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

41

260

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cpn-assembly2.cif.gz_D crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca 0.9877 15 245
7cpn-assembly2.cif.gz_D crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca 0.9789 15 245
4onc-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9717 9 248
4onc-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9715 3 252
2vg3-assembly1.cif.gz_A rv2361 with citronellyl pyrophosphate 0.965 9 252
ID Description Score Start End Superfamily
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9761 9 245 3.40.1180.10
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9519 23 243 3.40.1180.10
af_Q58767_31_280_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9473 21 250 3.40.1180.10
5hxoA00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9459 23 245 3.40.1180.10
af_A0A1D8PFD1_28_274_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9435 23 243 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A368T142-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9813 3 116 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-V6KUZ3-F1-model_v4 UDP pyrophosphate synthase (EC 2.5.1.31) 0.9802 3 230 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-W7SQ64-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.98 2 212 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A6B3EBL5-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9768 1 118 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A3S3PS96-F1-model_v4 deleted 0.9759 4 221

Feature Viewer

pLDDT pTM Quality
85.8 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map