F467480
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 398 | 524 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300047318|Ga0495636_0017663|Ga0495636_0017663_1082_2185 |
| Length | 367 |
| Sequence | MRLVTRGVFPRRGQFALPLFRLPALSGVKPLYLAESDRARNSRSLIHMEISMQKRRLGRTGLEVSPVILGGNVFGWTADEATSFSVLDAAFDAGLNTIDTADVYSSWVPGNVGGESEVIIGKWLKRGKISRDQVVLITKVGSEMGEGKKGLTAAYIAEAVEASLNRLQTDYIDVYLSHWHDPETPYEETLGAYEKLKTQGKIRAFGCSNLDAEQLQASIDTATVNGVPRYDVLQPEYNLYDRAGFEGPLADLCAKEEIAVITYYSLASGFLSGKYKSKADVQGRPRGDGLLKYFDDKGLRILSALNQVAEEVGAKPAEVALAWLLRKNAVTAPIASATSIPQVAGLANAAQLSLSDRLIAKLDEAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 5 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 10 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 11 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 12 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 13 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 14 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 15 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 16 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 17 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 18 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 19 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 20 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 21 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 22 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 23 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 24 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 25 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 26 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 27 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 28 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 29 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 30 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 31 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 32 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 33 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 34 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 35 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 36 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 37 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 38 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 39 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 40 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 41 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 42 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 43 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 44 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 45 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 46 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 47 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 48 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 49 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 50 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 51 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 52 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 53 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 54 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 55 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 56 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 57 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 58 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 59 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 60 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 61 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 62 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 63 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 64 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 65 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 66 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 67 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 68 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 69 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 70 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 71 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 72 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 74 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 77 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 82 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 112 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 113 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 120 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 129 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 130 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 247 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 248 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 249 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 250 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 372 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 375 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 376 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 377 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 378 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 382 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 387 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 388 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 389 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 394 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 397 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 398 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.36 |
| Metatranscriptomes | 0 |
| Isolates | 11.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.94 |
| Nodule | 4.87 |
| Rhizoplane | 4.2 |
| Rhizosphere | 68.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1759361 | 2162886007 | Bacteria | 232727 |
| 2 | SwRhRL2b_contig_938321 | 2162886007 | Bacteria | 1842 |
| 3 | JGI24740J21852_10030582 | 3300001979 | Bacteria | 1749 |
| 4 | JGI25154J39366_1000717 | 3300002738 | Bacteria | 15031 |
| 5 | JGI25157J39369_1000235 | 3300002741 | Bacteria | 42844 |
| 6 | JGI25159J45721_1000653 | 3300002987 | Bacteria | 15377 |
| 7 | rootH1_10036229 | 3300003316 | Bacteria | 2127 |
| 8 | rootH2_10005184 | 3300003320 | Bacteria | 18219 |
| 9 | rootL2_10261344 | 3300003322 | Bacteria | 1233 |
| 10 | JGI25160J50197_1000012 | 3300003354 | Bacteria | 267582 |
| 11 | JGI25160J50197_1000116 | 3300003354 | Bacteria | 72316 |
| 12 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 13 | Ga0055539_1000558 | 3300003752 | Bacteria | 10776 |
| 14 | Ga0055539_1006577 | 3300003752 | Bacteria | 1485 |
| 15 | Ga0055533_1000221 | 3300003756 | Bacteria | 40020 |
| 16 | Ga0055531_10002117 | 3300003794 | Bacteria | 13614 |
| 17 | Ga0055543_1000011 | 3300004625 | Bacteria | 196089 |
| 18 | Ga0065165_1000082 | 3300005262 | Bacteria | 158536 |
| 19 | Ga0065704_10070132 | 3300005289 | Bacteria | 1955461 |
| 20 | Ga0065704_10072323 | 3300005289 | Bacteria | 8740 |
| 21 | Ga0070658_10035828 | 3300005327 | Bacteria | 3997 |
| 22 | Ga0070658_10208231 | 3300005327 | Bacteria | 1651 |
| 23 | Ga0070658_10246362 | 3300005327 | Bacteria | 1515 |
| 24 | Ga0070676_10009808 | 3300005328 | Bacteria | 5179 |
| 25 | Ga0070690_100041586 | 3300005330 | Bacteria | 2910 |
| 26 | Ga0068869_100009844 | 3300005334 | Bacteria | 6208 |
| 27 | Ga0070680_100094661 | 3300005336 | Bacteria | 2476 |
| 28 | Ga0070680_100128625 | 3300005336 | Bacteria | 2117 |
| 29 | Ga0070680_100379728 | 3300005336 | Bacteria | 1203 |
| 30 | Ga0070682_100131430 | 3300005337 | Bacteria | 1695 |
| 31 | Ga0070660_100004122 | 3300005339 | Bacteria | 10029 |
| 32 | Ga0070687_100048167 | 3300005343 | Bacteria | 2190 |
| 33 | Ga0070668_100066896 | 3300005347 | Bacteria | 2790 |
| 34 | Ga0070668_100093620 | 3300005347 | Bacteria | 2371 |
| 35 | Ga0070669_100304505 | 3300005353 | Bacteria | 1283 |
| 36 | Ga0070673_100046996 | 3300005364 | Bacteria | 3356 |
| 37 | Ga0070673_100244950 | 3300005364 | Bacteria | 1560 |
| 38 | Ga0070659_100015584 | 3300005366 | Bacteria | 5693 |
| 39 | Ga0070659_100288740 | 3300005366 | Bacteria | 1366 |
| 40 | Ga0070667_100122220 | 3300005367 | Bacteria | 2266 |
| 41 | Ga0070703_10091846 | 3300005406 | Bacteria | 1054 |
| 42 | Ga0070701_10219930 | 3300005438 | Bacteria | 1132 |
| 43 | Ga0070694_100223060 | 3300005444 | Bacteria | 1415 |
| 44 | Ga0070678_100056996 | 3300005456 | Bacteria | 2860 |
| 45 | Ga0070662_100065375 | 3300005457 | Bacteria | 2666 |
| 46 | Ga0068867_100078952 | 3300005459 | Bacteria | 2476 |
| 47 | Ga0070699_100100239 | 3300005518 | Bacteria | 2538 |
| 48 | Ga0070679_100111658 | 3300005530 | Bacteria | 2720 |
| 49 | Ga0070679_100318694 | 3300005530 | Bacteria | 1504 |
| 50 | Ga0070684_100051008 | 3300005535 | Bacteria | 3594 |
| 51 | Ga0070684_100567753 | 3300005535 | Bacteria | 1054 |
| 52 | Ga0070697_100116966 | 3300005536 | Bacteria | 2227 |
| 53 | Ga0068853_100030535 | 3300005539 | Bacteria | 4553 |
| 54 | Ga0070686_100215106 | 3300005544 | Bacteria | 1386 |
| 55 | Ga0070695_100010938 | 3300005545 | Bacteria | 5423 |
| 56 | Ga0070695_100031858 | 3300005545 | Bacteria | 3292 |
| 57 | Ga0070695_100157465 | 3300005545 | Bacteria | 1591 |
| 58 | Ga0070696_100005524 | 3300005546 | Bacteria | 8438 |
| 59 | Ga0070693_100063193 | 3300005547 | Bacteria | 2157 |
| 60 | Ga0070665_100141382 | 3300005548 | Bacteria | 2410 |
| 61 | Ga0070665_100362646 | 3300005548 | Bacteria | 1455 |
| 62 | Ga0070704_100041136 | 3300005549 | Bacteria | 3187 |
| 63 | Ga0068855_100022308 | 3300005563 | Bacteria | 7586 |
| 64 | Ga0068855_100052341 | 3300005563 | Bacteria | 4807 |
| 65 | Ga0068855_100061156 | 3300005563 | Bacteria | 4401 |
| 66 | Ga0068855_100343224 | 3300005563 | Bacteria | 1646 |
| 67 | Ga0068855_100648873 | 3300005563 | Bacteria | 1134 |
| 68 | Ga0068857_100008138 | 3300005577 | Bacteria | 9052 |
| 69 | Ga0068857_100123427 | 3300005577 | Bacteria | 2333 |
| 70 | Ga0068854_100009624 | 3300005578 | Bacteria | 6241 |
| 71 | Ga0068856_100008119 | 3300005614 | Bacteria | 10244 |
| 72 | Ga0068856_100086516 | 3300005614 | Bacteria | 3114 |
| 73 | Ga0068859_100353174 | 3300005617 | Bacteria | 1565 |
| 74 | Ga0068864_100172371 | 3300005618 | Bacteria | 1973 |
| 75 | Ga0068864_100256794 | 3300005618 | Bacteria | 1624 |
| 76 | Ga0068863_100043421 | 3300005841 | Bacteria | 4268 |
| 77 | Ga0068858_100179574 | 3300005842 | Bacteria | 1998 |
| 78 | Ga0068860_100067683 | 3300005843 | Bacteria | 3393 |
| 79 | Ga0081539_10051365 | 3300005985 | Bacteria | 2324 |
| 80 | Ga0075365_10004322 | 3300006038 | Bacteria | 7502 |
| 81 | Ga0075368_10000383 | 3300006042 | Bacteria | 13025 |
| 82 | Ga0075367_10009877 | 3300006178 | Bacteria | 4999 |
| 83 | Ga0097621_100015498 | 3300006237 | Bacteria | 5737 |
| 84 | Ga0068871_100009488 | 3300006358 | Bacteria | 7055 |
| 85 | Ga0068871_100151094 | 3300006358 | Bacteria | 1980 |
| 86 | Ga0075428_100031091 | 3300006844 | Bacteria | 5903 |
| 87 | Ga0075428_100053461 | 3300006844 | Bacteria | 4425 |
| 88 | Ga0075431_100267959 | 3300006847 | Bacteria | 1732 |
| 89 | Ga0068865_100004472 | 3300006881 | Bacteria | 8433 |
| 90 | Ga0075436_100013171 | 3300006914 | Bacteria | 5670 |
| 91 | Ga0097620_100353139 | 3300006931 | Bacteria | 1565 |
| 92 | Ga0099824_1002075 | 3300006942 | Bacteria | 29088 |
| 93 | Ga0099822_1002298 | 3300006943 | Bacteria | 23651 |
| 94 | Ga0075435_100448309 | 3300007076 | Bacteria | 1113 |
| 95 | Ga0105240_10024980 | 3300009093 | Bacteria | 7864 |
| 96 | Ga0111539_10014044 | 3300009094 | Bacteria | 10007 |
| 97 | Ga0111539_10476025 | 3300009094 | Bacteria | 1454 |
| 98 | Ga0105245_10127336 | 3300009098 | Bacteria | 2385 |
| 99 | Ga0105247_10013502 | 3300009101 | Bacteria | 4898 |
| 100 | Ga0114129_10455642 | 3300009147 | Bacteria | 1677 |
| 101 | Ga0105243_10068107 | 3300009148 | Bacteria | 2868 |
| 102 | Ga0105241_10062972 | 3300009174 | Bacteria | 2860 |
| 103 | Ga0105242_10207713 | 3300009176 | Bacteria | 1743 |
| 104 | Ga0105237_10333378 | 3300009545 | Bacteria | 1521 |
| 105 | Ga0105239_10064136 | 3300010375 | Bacteria | 4033 |
| 106 | Ga0105239_10227061 | 3300010375 | Bacteria | 2095 |
| 107 | Ga0105239_10321088 | 3300010375 | Bacteria | 1746 |
| 108 | Ga0157370_10000045 | 3300013104 | Bacteria | 127627 |
| 109 | Ga0157370_10102572 | 3300013104 | Bacteria | 2678 |
| 110 | Ga0157369_10164783 | 3300013105 | Bacteria | 2338 |
| 111 | Ga0157374_10074256 | 3300013296 | Bacteria | 3211 |
| 112 | Ga0157374_10107146 | 3300013296 | Bacteria | 2686 |
| 113 | Ga0157374_10141839 | 3300013296 | Bacteria | 2333 |
| 114 | Ga0157374_10176129 | 3300013296 | Bacteria | 2088 |
| 115 | Ga0157374_10294662 | 3300013296 | Bacteria | 1604 |
| 116 | Ga0157378_10053983 | 3300013297 | Bacteria | 3578 |
| 117 | Ga0163162_10008551 | 3300013306 | Bacteria | 9979 |
| 118 | Ga0163162_10130206 | 3300013306 | Bacteria | 2624 |
| 119 | Ga0163162_10269201 | 3300013306 | Bacteria | 1835 |
| 120 | Ga0163162_10350356 | 3300013306 | Bacteria | 1609 |
| 121 | Ga0163162_10454114 | 3300013306 | Bacteria | 1413 |
| 122 | Ga0157372_10036839 | 3300013307 | Bacteria | 5394 |
| 123 | Ga0157372_10059461 | 3300013307 | Bacteria | 4275 |
| 124 | Ga0157375_10007956 | 3300013308 | Bacteria | 9281 |
| 125 | Ga0163163_10014280 | 3300014325 | Bacteria | 7299 |
| 126 | Ga0157380_10015078 | 3300014326 | Bacteria | 5671 |
| 127 | Ga0157379_10452328 | 3300014968 | Unclassified | 1186 |
| 128 | Ga0157376_10001442 | 3300014969 | Bacteria | 15638 |
| 129 | Ga0157376_10141768 | 3300014969 | Bacteria | 2157 |
| 130 | Ga0182005_1000036 | 3300015265 | Bacteria | 166586 |
| 131 | Ga0163161_10008698 | 3300017792 | Bacteria | 7021 |
| 132 | Ga0163161_10203230 | 3300017792 | Bacteria | 1527 |
| 133 | Ga0213876_10000053 | 3300021384 | Bacteria | 142404 |
| 134 | Ga0209674_100270 | 3300025226 | Bacteria | 39854 |
| 135 | Ga0209147_105065 | 3300025229 | Bacteria | 2044 |
| 136 | Ga0209563_100178 | 3300025230 | Bacteria | 41597 |
| 137 | Ga0207427_100650 | 3300025231 | Bacteria | 16837 |
| 138 | Ga0209258_100714 | 3300025242 | Bacteria | 22241 |
| 139 | Ga0209646_1000157 | 3300025246 | Bacteria | 94054 |
| 140 | Ga0209026_1000328 | 3300025250 | Bacteria | 47719 |
| 141 | Ga0209677_100405 | 3300025253 | Bacteria | 25877 |
| 142 | Ga0209677_101568 | 3300025253 | Bacteria | 9707 |
| 143 | Ga0209759_1000448 | 3300025256 | Bacteria | 47719 |
| 144 | Ga0209759_1001026 | 3300025256 | Bacteria | 18741 |
| 145 | Ga0209759_1005335 | 3300025256 | Bacteria | 4529 |
| 146 | Ga0209759_1009355 | 3300025256 | Bacteria | 2966 |
| 147 | Ga0209233_1004855 | 3300025261 | Bacteria | 4527 |
| 148 | Ga0209455_1011301 | 3300025272 | Bacteria | 2207 |
| 149 | Ga0209130_1000028 | 3300025284 | Bacteria | 325668 |
| 150 | Ga0209676_1003188 | 3300025292 | Bacteria | 10410 |
| 151 | Ga0209758_1000383 | 3300025297 | Bacteria | 76487 |
| 152 | Ga0209758_1002558 | 3300025297 | Bacteria | 18310 |
| 153 | Ga0209050_1018640 | 3300025298 | Bacteria | 2683 |
| 154 | Ga0209256_1011806 | 3300025299 | Bacteria | 3439 |
| 155 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 156 | Ga0209051_1002507 | 3300025303 | Bacteria | 13042 |
| 157 | Ga0209051_1016208 | 3300025303 | Bacteria | 3387 |
| 158 | Ga0209257_1000074 | 3300025304 | Bacteria | 325641 |
| 159 | Ga0209257_1004287 | 3300025304 | Bacteria | 11238 |
| 160 | Ga0207710_10061166 | 3300025900 | Bacteria | 1708 |
| 161 | Ga0207645_10024130 | 3300025907 | Bacteria | 3946 |
| 162 | Ga0207705_10186222 | 3300025909 | Bacteria | 1568 |
| 163 | Ga0207707_10043786 | 3300025912 | Bacteria | 3903 |
| 164 | Ga0207707_10064395 | 3300025912 | Bacteria | 3191 |
| 165 | Ga0207707_10217124 | 3300025912 | Bacteria | 1665 |
| 166 | Ga0207707_10302894 | 3300025912 | Bacteria | 1382 |
| 167 | Ga0207695_10038504 | 3300025913 | Bacteria | 5147 |
| 168 | Ga0207695_10309529 | 3300025913 | Bacteria | 1470 |
| 169 | Ga0207660_10324097 | 3300025917 | Bacteria | 1231 |
| 170 | Ga0207657_10009860 | 3300025919 | Bacteria | 9566 |
| 171 | Ga0207657_10070586 | 3300025919 | Bacteria | 2960 |
| 172 | Ga0207652_10088129 | 3300025921 | Bacteria | 2722 |
| 173 | Ga0207652_10093510 | 3300025921 | Bacteria | 2646 |
| 174 | Ga0207652_10138280 | 3300025921 | Bacteria | 2176 |
| 175 | Ga0207652_10325031 | 3300025921 | Bacteria | 1389 |
| 176 | Ga0207646_10041621 | 3300025922 | Bacteria | 4129 |
| 177 | Ga0207681_10098788 | 3300025923 | Bacteria | 2101 |
| 178 | Ga0207694_10074201 | 3300025924 | Bacteria | 2663 |
| 179 | Ga0207659_10284457 | 3300025926 | Bacteria | 1353 |
| 180 | Ga0207687_10128752 | 3300025927 | Bacteria | 1905 |
| 181 | Ga0207706_10029038 | 3300025933 | Bacteria | 4938 |
| 182 | Ga0207706_10143857 | 3300025933 | Bacteria | 2098 |
| 183 | Ga0207709_10290635 | 3300025935 | Bacteria | 1211 |
| 184 | Ga0207669_10311575 | 3300025937 | Bacteria | 1201 |
| 185 | Ga0207704_10062164 | 3300025938 | Bacteria | 2320 |
| 186 | Ga0207689_10085674 | 3300025942 | Bacteria | 2590 |
| 187 | Ga0207667_10036269 | 3300025949 | Bacteria | 5286 |
| 188 | Ga0207667_10049853 | 3300025949 | Bacteria | 4419 |
| 189 | Ga0207651_10003103 | 3300025960 | Bacteria | 8082 |
| 190 | Ga0207640_10001829 | 3300025981 | Bacteria | 11415 |
| 191 | Ga0207640_10268241 | 3300025981 | Bacteria | 1334 |
| 192 | Ga0207658_10092677 | 3300025986 | Bacteria | 2347 |
| 193 | Ga0207639_10138376 | 3300026041 | Bacteria | 2026 |
| 194 | Ga0207702_10001082 | 3300026078 | Bacteria | 27904 |
| 195 | Ga0207702_10220057 | 3300026078 | Bacteria | 1769 |
| 196 | Ga0207641_10144089 | 3300026088 | Bacteria | 2153 |
| 197 | Ga0207641_10369187 | 3300026088 | Bacteria | 1372 |
| 198 | Ga0207641_10402898 | 3300026088 | Bacteria | 1314 |
| 199 | Ga0207648_10044027 | 3300026089 | Bacteria | 3917 |
| 200 | Ga0207674_10021844 | 3300026116 | Bacteria | 6886 |
| 201 | Ga0207674_10174636 | 3300026116 | Bacteria | 2101 |
| 202 | Ga0207675_100043493 | 3300026118 | Bacteria | 4194 |
| 203 | Ga0207683_10007115 | 3300026121 | Bacteria | 9590 |
| 204 | Ga0207683_10361530 | 3300026121 | Bacteria | 1333 |
| 205 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 206 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 207 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 208 | Ga0209813_10000569 | 3300027866 | Bacteria | 8660 |
| 209 | Ga0268266_10087638 | 3300028379 | Bacteria | 2724 |
| 210 | Ga0268265_10082448 | 3300028380 | Bacteria | 2543 |
| 211 | Ga0265337_1002746 | 3300028556 | Bacteria | 7901 |
| 212 | Ga0265319_1011863 | 3300028563 | Bacteria | 3546 |
| 213 | Ga0265334_10001736 | 3300028573 | Bacteria | 10420 |
| 214 | Ga0265318_10007109 | 3300028577 | Bacteria | 5091 |
| 215 | Ga0265323_10000674 | 3300028653 | Bacteria | 18599 |
| 216 | Ga0265322_10008191 | 3300028654 | Bacteria | 3047 |
| 217 | Ga0265336_10000044 | 3300028666 | Bacteria | 131932 |
| 218 | Ga0265336_10000389 | 3300028666 | Bacteria | 27626 |
| 219 | Ga0265336_10022002 | 3300028666 | Bacteria | 2032 |
| 220 | Ga0307515_10000434 | 3300028794 | Bacteria | 100265 |
| 221 | Ga0307515_10015010 | 3300028794 | Bacteria | 14308 |
| 222 | Ga0265338_10000176 | 3300028800 | Bacteria | 118726 |
| 223 | Ga0265324_10001802 | 3300029957 | Bacteria | 11645 |
| 224 | Ga0307511_10042710 | 3300030521 | Bacteria | 3802 |
| 225 | Ga0265320_10079770 | 3300031240 | Bacteria | 1529 |
| 226 | Ga0307513_10122083 | 3300031456 | Bacteria | 2569 |
| 227 | Ga0265314_10218083 | 3300031711 | Bacteria | 1115 |
| 228 | Ga0307405_10000004 | 3300031731 | Bacteria | 444977 |
| 229 | Ga0307405_10037820 | 3300031731 | Bacteria | 2904 |
| 230 | Ga0307410_10020584 | 3300031852 | Bacteria | 4038 |
| 231 | Ga0307410_10124173 | 3300031852 | Bacteria | 1887 |
| 232 | Ga0307406_10007529 | 3300031901 | Bacteria | 6043 |
| 233 | Ga0307409_100000503 | 3300031995 | Bacteria | 16872 |
| 234 | Ga0307409_100010866 | 3300031995 | Bacteria | 5697 |
| 235 | Ga0307414_10003092 | 3300032004 | Bacteria | 8835 |
| 236 | Ga0307414_10160269 | 3300032004 | Bacteria | 1786 |
| 237 | Ga0307414_10199058 | 3300032004 | Bacteria | 1628 |
| 238 | Ga0307414_10289665 | 3300032004 | Bacteria | 1380 |
| 239 | Ga0307411_10001596 | 3300032005 | Bacteria | 9413 |
| 240 | Ga0307411_10071953 | 3300032005 | Bacteria | 2346 |
| 241 | Ga0307411_10161932 | 3300032005 | Bacteria | 1677 |
| 242 | Ga0307415_100081569 | 3300032126 | Bacteria | 2311 |
| 243 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 244 | Ga0373936_0022737 | 3300035113 | Bacteria | 2441 |
| 245 | Ga0373941_0066348 | 3300035115 | Bacteria | 1187 |
| 246 | Ga0373960_0019855 | 3300035121 | Bacteria | 1770 |
| 247 | Ga0373955_0108189 | 3300035172 | Bacteria | 1605 |
| 248 | Ga0373942_0059788 | 3300035207 | Bacteria | 1090 |
| 249 | Ga0373935_0005058 | 3300035692 | Bacteria | 7766 |
| 250 | Ga0373927_0006512 | 3300035695 | Bacteria | 7955 |
| 251 | Ga0373937_0536013 | 3300036401 | Bacteria | 1112 |
| 252 | Ga0373925_0019029 | 3300037068 | Bacteria | 4992 |
| 253 | Ga0395900_0008892 | 3300037418 | Bacteria | 10311 |
| 254 | Ga0395900_0283833 | 3300037418 | Bacteria | 1647 |
| 255 | Ga0395900_0323929 | 3300037418 | Bacteria | 1521 |
| 256 | Ga0395900_0345191 | 3300037418 | Bacteria | 1463 |
| 257 | Ga0395898_0012924 | 3300037466 | Bacteria | 8611 |
| 258 | Ga0395898_0016659 | 3300037466 | Bacteria | 7513 |
| 259 | Ga0395898_0118297 | 3300037466 | Bacteria | 2538 |
| 260 | Ga0395905_0146473 | 3300037471 | Bacteria | 2222 |
| 261 | Ga0395905_0164438 | 3300037471 | Bacteria | 2085 |
| 262 | Ga0395901_0001189 | 3300038443 | Bacteria | 27686 |
| 263 | Ga0436365_0873465 | 3300039437 | Bacteria | 246686 |
| 264 | Ga0436365_1378994 | 3300039437 | Bacteria | 6271 |
| 265 | Ga0436361_0459563 | 3300039447 | Bacteria | 4005 |
| 266 | Ga0439436_0000351 | 3300041404 | Bacteria | 11403 |
| 267 | Ga0450917_002238 | 3300042120 | Bacteria | 1382 |
| 268 | Ga0450890_001541 | 3300042127 | Bacteria | 3312 |
| 269 | Ga0450905_000403 | 3300042142 | Bacteria | 5251 |
| 270 | Ga0450889_000202 | 3300042144 | Bacteria | 6492 |
| 271 | Ga0466965_0017833 | 3300044683 | Bacteria | 3395 |
| 272 | Ga0466968_0000341 | 3300044735 | Bacteria | 15110 |
| 273 | Ga0466970_0082862 | 3300044765 | Bacteria | 1735 |
| 274 | Ga0466957_0070908 | 3300044842 | Bacteria | 2154 |
| 275 | Ga0466957_0088839 | 3300044842 | Bacteria | 1934 |
| 276 | Ga0466967_0017525 | 3300045976 | Bacteria | 5690 |
| 277 | Ga0495617_000393 | 3300046452 | Bacteria | 24194 |
| 278 | Ga0495627_002272 | 3300046453 | Bacteria | 9485 |
| 279 | Ga0495627_019566 | 3300046453 | Bacteria | 2268 |
| 280 | Ga0495592_0010630 | 3300046454 | Bacteria | 6941 |
| 281 | Ga0495590_0005374 | 3300046457 | Bacteria | 5084 |
| 282 | Ga0495590_0008412 | 3300046457 | Bacteria | 3940 |
| 283 | Ga0495638_0000141 | 3300046460 | Bacteria | 114543 |
| 284 | Ga0495638_0010662 | 3300046460 | Bacteria | 6365 |
| 285 | Ga0495638_0013056 | 3300046460 | Bacteria | 5670 |
| 286 | Ga0495651_0019137 | 3300046462 | Bacteria | 5305 |
| 287 | Ga0495653_0058987 | 3300046463 | Bacteria | 2915 |
| 288 | Ga0495650_0082532 | 3300046471 | Bacteria | 1237 |
| 289 | Ga0495580_0312275 | 3300046472 | Bacteria | 1069 |
| 290 | Ga0495605_0002939 | 3300046474 | Bacteria | 10314 |
| 291 | Ga0495605_0008068 | 3300046474 | Bacteria | 5959 |
| 292 | Ga0495605_0093180 | 3300046474 | Bacteria | 1394 |
| 293 | Ga0495664_0023979 | 3300046477 | Bacteria | 3543 |
| 294 | Ga0495584_0000372 | 3300046491 | Bacteria | 30962 |
| 295 | Ga0495584_0069245 | 3300046491 | Bacteria | 1773 |
| 296 | Ga0495585_0003542 | 3300046492 | Bacteria | 10492 |
| 297 | Ga0495607_0010733 | 3300046501 | Bacteria | 6136 |
| 298 | Ga0495607_0028247 | 3300046501 | Bacteria | 3462 |
| 299 | Ga0495607_0029382 | 3300046501 | Bacteria | 3383 |
| 300 | Ga0495607_0036543 | 3300046501 | Bacteria | 2957 |
| 301 | Ga0495607_0038622 | 3300046501 | Bacteria | 2858 |
| 302 | Ga0495607_0048006 | 3300046501 | Bacteria | 2497 |
| 303 | Ga0495607_0048941 | 3300046501 | Bacteria | 2468 |
| 304 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 305 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 306 | Ga0495583_0000887 | 3300046506 | Bacteria | 35851 |
| 307 | Ga0495583_0024579 | 3300046506 | Bacteria | 3024 |
| 308 | Ga0495606_0008048 | 3300046507 | Bacteria | 9254 |
| 309 | Ga0495606_0014145 | 3300046507 | Bacteria | 6247 |
| 310 | Ga0495606_0056062 | 3300046507 | Bacteria | 2545 |
| 311 | Ga0495608_0033123 | 3300046511 | Bacteria | 3495 |
| 312 | Ga0495610_0003603 | 3300046512 | Bacteria | 11962 |
| 313 | Ga0495610_0007883 | 3300046512 | Bacteria | 6999 |
| 314 | Ga0495610_0026908 | 3300046512 | Bacteria | 3065 |
| 315 | Ga0495616_0000548 | 3300046513 | Bacteria | 28338 |
| 316 | Ga0495616_0012393 | 3300046513 | Bacteria | 4842 |
| 317 | Ga0495616_0046416 | 3300046513 | Bacteria | 2192 |
| 318 | Ga0495620_0000188 | 3300046515 | Bacteria | 47539 |
| 319 | Ga0495620_0000209 | 3300046515 | Bacteria | 44042 |
| 320 | Ga0495620_0004156 | 3300046515 | Bacteria | 8208 |
| 321 | Ga0495628_0004111 | 3300046516 | Bacteria | 12948 |
| 322 | Ga0495628_0397844 | 3300046516 | Bacteria | 1007 |
| 323 | Ga0495630_0030875 | 3300046517 | Bacteria | 3988 |
| 324 | Ga0495630_0043912 | 3300046517 | Bacteria | 3340 |
| 325 | Ga0495631_0001903 | 3300046518 | Bacteria | 12300 |
| 326 | Ga0495632_0000658 | 3300046519 | Bacteria | 31732 |
| 327 | Ga0495632_0017430 | 3300046519 | Bacteria | 3964 |
| 328 | Ga0495632_0097757 | 3300046519 | Bacteria | 1385 |
| 329 | Ga0495637_0024351 | 3300046520 | Bacteria | 2739 |
| 330 | Ga0495643_0008378 | 3300046522 | Bacteria | 6552 |
| 331 | Ga0495644_0000665 | 3300046523 | Bacteria | 14332 |
| 332 | Ga0495644_0001597 | 3300046523 | Bacteria | 9234 |
| 333 | Ga0495648_0001624 | 3300046524 | Bacteria | 21826 |
| 334 | Ga0495652_0006323 | 3300046529 | Bacteria | 11033 |
| 335 | Ga0495654_0002031 | 3300046530 | Bacteria | 13308 |
| 336 | Ga0495586_0015412 | 3300046535 | Bacteria | 4067 |
| 337 | Ga0495587_0020341 | 3300046536 | Bacteria | 4098 |
| 338 | Ga0495609_0000091 | 3300046538 | Bacteria | 106458 |
| 339 | Ga0495609_0001693 | 3300046538 | Bacteria | 14307 |
| 340 | Ga0495597_0001265 | 3300046542 | Bacteria | 18633 |
| 341 | Ga0495597_0029566 | 3300046542 | Bacteria | 2501 |
| 342 | Ga0495645_0010602 | 3300046543 | Bacteria | 6470 |
| 343 | Ga0495633_0005466 | 3300046558 | Bacteria | 7749 |
| 344 | Ga0495633_0095951 | 3300046558 | Bacteria | 1377 |
| 345 | Ga0495667_0002970 | 3300046559 | Bacteria | 11368 |
| 346 | Ga0495668_0002848 | 3300046616 | Bacteria | 13732 |
| 347 | Ga0495668_0061132 | 3300046616 | Bacteria | 2078 |
| 348 | Ga0495668_0071924 | 3300046616 | Bacteria | 1900 |
| 349 | Ga0495611_0000489 | 3300046648 | Bacteria | 23665 |
| 350 | Ga0495611_0005515 | 3300046648 | Bacteria | 5404 |
| 351 | Ga0495611_0005646 | 3300046648 | Bacteria | 5335 |
| 352 | Ga0495611_0047805 | 3300046648 | Bacteria | 1921 |
| 353 | Ga0495625_0000364 | 3300046660 | Bacteria | 69279 |
| 354 | Ga0495625_0003025 | 3300046660 | Bacteria | 17248 |
| 355 | Ga0495625_0005074 | 3300046660 | Bacteria | 12187 |
| 356 | Ga0495625_0020123 | 3300046660 | Bacteria | 5158 |
| 357 | Ga0495625_0054900 | 3300046660 | Bacteria | 2843 |
| 358 | Ga0495625_0069477 | 3300046660 | Bacteria | 2474 |
| 359 | Ga0495625_0235756 | 3300046660 | Bacteria | 1193 |
| 360 | Ga0495659_0000886 | 3300046664 | Bacteria | 10645 |
| 361 | Ga0495661_0024536 | 3300046665 | Bacteria | 3903 |
| 362 | Ga0495588_0000677 | 3300046674 | Bacteria | 15710 |
| 363 | Ga0495588_0012096 | 3300046674 | Bacteria | 4069 |
| 364 | Ga0495657_0101846 | 3300046675 | Bacteria | 1829 |
| 365 | Ga0495599_0028023 | 3300046678 | Bacteria | 3529 |
| 366 | Ga0495670_0000087 | 3300046691 | Bacteria | 41042 |
| 367 | Ga0495670_0000186 | 3300046691 | Bacteria | 27523 |
| 368 | Ga0495670_0003206 | 3300046691 | Bacteria | 8051 |
| 369 | Ga0495670_0112832 | 3300046691 | Bacteria | 1408 |
| 370 | Ga0495671_0000081 | 3300046692 | Bacteria | 92311 |
| 371 | Ga0495671_0036236 | 3300046692 | Bacteria | 2499 |
| 372 | Ga0495649_0001134 | 3300046694 | Bacteria | 20734 |
| 373 | Ga0495649_0003333 | 3300046694 | Bacteria | 10905 |
| 374 | Ga0495649_0014199 | 3300046694 | Bacteria | 4573 |
| 375 | Ga0495600_0017993 | 3300046809 | Bacteria | 4499 |
| 376 | Ga0495581_0051428 | 3300047315 | Bacteria | 2379 |
| 377 | Ga0495604_0005582 | 3300047317 | Bacteria | 9975 |
| 378 | Ga0495604_0088276 | 3300047317 | Bacteria | 2307 |
| 379 | Ga0495636_0000298 | 3300047318 | Bacteria | 19496 |
| 380 | Ga0495636_0017663 | 3300047318 | Bacteria | 2857 |
| 381 | Ga0495674_0012640 | 3300047319 | Bacteria | 7955 |
| 382 | Ga0495683_0006980 | 3300047323 | Bacteria | 6132 |
| 383 | Ga0495683_0010586 | 3300047323 | Bacteria | 4866 |
| 384 | Ga0495683_0017554 | 3300047323 | Bacteria | 3708 |
| 385 | Ga0495683_0048445 | 3300047323 | Bacteria | 2131 |
| 386 | Ga0495687_000090 | 3300047443 | Bacteria | 141153 |
| 387 | Ga0495687_000487 | 3300047443 | Bacteria | 48069 |
| 388 | Ga0495687_004985 | 3300047443 | Bacteria | 8678 |
| 389 | Ga0495675_0000073 | 3300047444 | Bacteria | 69936 |
| 390 | Ga0495675_0042186 | 3300047444 | Bacteria | 2906 |
| 391 | Ga0495677_0019610 | 3300047445 | Bacteria | 2451 |
| 392 | Ga0495685_000003 | 3300047447 | Bacteria | 119490 |
| 393 | Ga0495681_0005808 | 3300047470 | Bacteria | 8199 |
| 394 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 395 | Ga0495686_0000157 | 3300047472 | Bacteria | 130757 |
| 396 | Ga0495686_0011755 | 3300047472 | Bacteria | 6162 |
| 397 | Ga0495686_0088834 | 3300047472 | Bacteria | 1878 |
| 398 | Ga0495602_0009567 | 3300048088 | Bacteria | 10074 |
| 399 | Ga0495626_0003776 | 3300048091 | Bacteria | 9530 |
| 400 | Ga0495626_0064283 | 3300048091 | Bacteria | 1662 |
| 401 | Ga0496100_0001386 | 3300048903 | Bacteria | 11878 |
| 402 | Ga0496100_0125346 | 3300048903 | Bacteria | 1802 |
| 403 | Ga0496101_0001729 | 3300048904 | Bacteria | 13091 |
| 404 | Ga0496102_0050693 | 3300048905 | Bacteria | 3781 |
| 405 | Ga0496102_0439844 | 3300048905 | Bacteria | 1224 |
| 406 | Ga0496104_0001052 | 3300048907 | Bacteria | 23550 |
| 407 | Ga0496104_0210382 | 3300048907 | Bacteria | 1856 |
| 408 | Ga0496105_0025138 | 3300048908 | Bacteria | 4844 |
| 409 | Ga0496105_0067534 | 3300048908 | Bacteria | 2952 |
| 410 | Ga0496106_0003482 | 3300048909 | Bacteria | 11725 |
| 411 | Ga0496106_0136799 | 3300048909 | Bacteria | 1925 |
| 412 | Ga0496107_0000052 | 3300048910 | Bacteria | 62300 |
| 413 | Ga0496107_0134857 | 3300048910 | Bacteria | 1824 |
| 414 | Ga0496108_0001335 | 3300048911 | Bacteria | 19389 |
| 415 | Ga0496109_0056066 | 3300048912 | Bacteria | 3596 |
| 416 | Ga0496109_0132968 | 3300048912 | Bacteria | 2323 |
| 417 | Ga0496110_0017016 | 3300048913 | Bacteria | 6078 |
| 418 | Ga0496110_0027115 | 3300048913 | Bacteria | 4908 |
| 419 | Ga0496110_0179253 | 3300048913 | Bacteria | 1924 |
| 420 | Ga0496111_0030709 | 3300048914 | Bacteria | 3822 |
| 421 | Ga0496112_0005318 | 3300048915 | Bacteria | 11111 |
| 422 | Ga0496112_0011892 | 3300048915 | Bacteria | 7972 |
| 423 | Ga0496112_0020375 | 3300048915 | Bacteria | 6286 |
| 424 | Ga0496113_0032720 | 3300048916 | Bacteria | 3780 |
| 425 | Ga0496117_0002935 | 3300048920 | Bacteria | 20638 |
| 426 | Ga0496121_0001500 | 3300048924 | Bacteria | 39239 |
| 427 | Ga0496121_0001744 | 3300048924 | Bacteria | 35548 |
| 428 | Ga0496121_0039119 | 3300048924 | Bacteria | 4187 |
| 429 | Ga0496121_0232251 | 3300048924 | Bacteria | 1291 |
| 430 | Ga0496122_0000018 | 3300048925 | Bacteria | 426350 |
| 431 | Ga0496122_0012600 | 3300048925 | Bacteria | 8393 |
| 432 | Ga0496122_0237464 | 3300048925 | Bacteria | 1031 |
| 433 | Ga0496123_0000015 | 3300048926 | Bacteria | 426088 |
| 434 | Ga0496123_0003606 | 3300048926 | Bacteria | 17151 |
| 435 | Ga0496124_0000245 | 3300048927 | Bacteria | 104910 |
| 436 | Ga0496124_0001259 | 3300048927 | Bacteria | 38660 |
| 437 | Ga0496125_0000189 | 3300048928 | Bacteria | 133541 |
| 438 | Ga0496126_0007571 | 3300048929 | Bacteria | 11868 |
| 439 | Ga0496126_0017349 | 3300048929 | Bacteria | 7175 |
| 440 | Ga0496126_0195854 | 3300048929 | Bacteria | 1709 |
| 441 | Ga0496126_0425831 | 3300048929 | Bacteria | 1072 |
| 442 | Ga0495678_000059 | 3300049459 | Bacteria | 143694 |
| 443 | Ga0495678_000861 | 3300049459 | Bacteria | 27005 |
| 444 | Ga0495678_010452 | 3300049459 | Bacteria | 4512 |
| 445 | Ga0495682_0000061 | 3300049460 | Bacteria | 101034 |
| 446 | Ga0495682_0000250 | 3300049460 | Bacteria | 42369 |
| 447 | Ga0495682_0001842 | 3300049460 | Bacteria | 10643 |
| 448 | Ga0501032_0029147 | 3300049569 | Bacteria | 3790 |
| 449 | Ga0501033_0134726 | 3300049570 | Bacteria | 1787 |
| 450 | Ga0501034_0058958 | 3300049571 | Bacteria | 3856 |
| 451 | Ga0501034_0432051 | 3300049571 | Bacteria | 1236 |
| 452 | Ga0501036_0006676 | 3300049572 | Bacteria | 9377 |
| 453 | Ga0501037_0015667 | 3300049573 | Bacteria | 5579 |
| 454 | Ga0501037_0178468 | 3300049573 | Bacteria | 1508 |
| 455 | Ga0501038_0005375 | 3300049574 | Bacteria | 11897 |
| 456 | Ga0501038_0020373 | 3300049574 | Bacteria | 5962 |
| 457 | Ga0501038_0078059 | 3300049574 | Bacteria | 2795 |
| 458 | Ga0501039_0047863 | 3300049575 | Bacteria | 3305 |
| 459 | Ga0501043_0149742 | 3300049579 | Bacteria | 1826 |
| 460 | Ga0501043_0332128 | 3300049579 | Bacteria | 1157 |
| 461 | Ga0501046_0025075 | 3300049580 | Bacteria | 4884 |
| 462 | Ga0501046_0086856 | 3300049580 | Bacteria | 2411 |
| 463 | Ga0501047_0217453 | 3300049581 | Bacteria | 1767 |
| 464 | Ga0501048_0043503 | 3300049582 | Bacteria | 3214 |
| 465 | Ga0501070_0041108 | 3300049586 | Bacteria | 3852 |
| 466 | Ga0501073_0011183 | 3300049589 | Bacteria | 6563 |
| 467 | Ga0501073_0018099 | 3300049589 | Bacteria | 5095 |
| 468 | Ga0501073_0324692 | 3300049589 | Bacteria | 1062 |
| 469 | Ga0501080_0005213 | 3300049742 | Bacteria | 11582 |
| 470 | Ga0501083_0032239 | 3300049744 | Bacteria | 3595 |
| 471 | Ga0501035_0065903 | 3300049822 | Bacteria | 3214 |
| 472 | Ga0501044_0000340 | 3300049823 | Bacteria | 59157 |
| 473 | Ga0501044_0036207 | 3300049823 | Bacteria | 5163 |
| 474 | Ga0501044_0097695 | 3300049823 | Bacteria | 2957 |
| 475 | Ga0501045_0312079 | 3300049824 | Bacteria | 1170 |
| 476 | nmdc:mga0k408_131232_c1 | 3300050493 | Bacteria | 1487 |
| 477 | nmdc:mga0k408_198273_c1 | 3300050493 | Bacteria | 1198 |
| 478 | nmdc:mga06z11_1708_c1 | 3300050494 | Bacteria | 8248 |
| 479 | nmdc:mga06z11_6147_c1 | 3300050494 | Bacteria | 4862 |
| 480 | nmdc:mga04h51_390_c1 | 3300050495 | Bacteria | 10679 |
| 481 | nmdc:mga07m45_13464_c1 | 3300050496 | Bacteria | 4341 |
| 482 | nmdc:mga05p37_389870_c1 | 3300050507 | Bacteria | 1629 |
| 483 | nmdc:mga0qj67_11364_c1 | 3300050509 | Bacteria | 6670 |
| 484 | nmdc:mga06r32_256880_c1 | 3300050510 | Bacteria | 1735 |
| 485 | nmdc:mga0rr50_288202_c1 | 3300050513 | Bacteria | 1371 |
| 486 | nmdc:mga0sz30_13910_c1 | 3300050516 | Bacteria | 3159 |
| 487 | Ga0500610_0016599 | 3300053079 | Bacteria | 3515 |
| 488 | Ga0500610_0057489 | 3300053079 | Bacteria | 2030 |
| 489 | Ga0495619_0101901 | 3300053085 | Bacteria | 1955 |
| 490 | Ga0500578_0001680 | 3300053086 | Bacteria | 21263 |
| 491 | Ga0500578_0056836 | 3300053086 | Bacteria | 2502 |
| 492 | Ga0500643_010904 | 3300053087 | Bacteria | 3353 |
| 493 | Ga0500646_0002568 | 3300053090 | Bacteria | 4710 |
| 494 | Ga0500583_0013830 | 3300053092 | Bacteria | 3137 |
| 495 | Ga0500583_0126654 | 3300053092 | Bacteria | 1265 |
| 496 | Ga0500641_0001269 | 3300053096 | Bacteria | 8966 |
| 497 | Ga0500555_000860 | 3300053103 | Bacteria | 10814 |
| 498 | Ga0500557_040138 | 3300053105 | Bacteria | 1464 |
| 499 | Ga0500562_013719 | 3300053108 | Bacteria | 2072 |
| 500 | Ga0500594_0001044 | 3300053118 | Bacteria | 5931 |
| 501 | Ga0500595_001037 | 3300053119 | Bacteria | 15477 |
| 502 | Ga0500595_006621 | 3300053119 | Bacteria | 4892 |
| 503 | Ga0500608_065445 | 3300053122 | Bacteria | 1734 |
| 504 | Ga0500618_000315 | 3300053125 | Bacteria | 35779 |
| 505 | Ga0500618_000372 | 3300053125 | Bacteria | 31040 |
| 506 | Ga0500652_004117 | 3300053131 | Bacteria | 4465 |
| 507 | Ga0500561_0005941 | 3300053137 | Bacteria | 2301 |
| 508 | Ga0500568_0000042 | 3300053139 | Bacteria | 127026 |
| 509 | Ga0500568_0001475 | 3300053139 | Bacteria | 15068 |
| 510 | Ga0500574_000078 | 3300053141 | Bacteria | 10976 |
| 511 | Ga0500616_0003001 | 3300053153 | Bacteria | 13320 |
| 512 | Ga0500619_010183 | 3300053154 | Bacteria | 2367 |
| 513 | Ga0500622_0066285 | 3300053156 | Bacteria | 1833 |
| 514 | Ga0500624_000360 | 3300053157 | Bacteria | 14769 |
| 515 | Ga0500627_0052626 | 3300053158 | Bacteria | 1778 |
| 516 | Ga0500634_0017114 | 3300053161 | Bacteria | 3878 |
| 517 | Ga0500634_0048246 | 3300053161 | Bacteria | 2298 |
| 518 | Ga0500634_0102784 | 3300053161 | Bacteria | 1427 |
| 519 | Ga0500638_000313 | 3300053162 | Bacteria | 10986 |
| 520 | Ga0500636_0019640 | 3300053177 | Bacteria | 3996 |
| 521 | Ga0500636_0022196 | 3300053177 | Bacteria | 3755 |
| 522 | Ga0500567_015383 | 3300053723 | Bacteria | 3687 |
| 523 | Ga0500609_001438 | 3300053731 | Bacteria | 3484 |
| 524 | Ga0501082_0149022 | 3300060353 | Bacteria | 2032 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0237464 | Ga0496122_0237464_210_1013 | 255 |
| 2 | 3300025981 | Ga0207640_10268241 | Ga0207640_102682412 | 256 |
| 3 | 3300049589 | Ga0501073_0324692 | Ga0501073_0324692_261_1034 | 256 |
| 4 | 3300025937 | Ga0207669_10311575 | Ga0207669_103115752 | 262 |
| 5 | 3300013307 | Ga0157372_10036839 | Ga0157372_100368391 | 264 |
| 6 | 3300037418 | Ga0395900_0323929 | Ga0395900_0323929_687_1508 | 264 |
| 7 | 3300047319 | Ga0495674_0012640 | Ga0495674_0012640_5774_6643 | 283 |
| 8 | 3300006942 | Ga0099824_1002075 | Ga0099824_10020754 | 286 |
| 9 | 3300006943 | Ga0099822_1002298 | Ga0099822_100229817 | 286 |
| 10 | 3300027357 | Ga0209589_1000002 | Ga0209589_100000218 | 286 |
| 11 | 3300027361 | Ga0209489_100002 | Ga0209489_10000218 | 286 |
| 12 | 3300027363 | Ga0209700_100002 | Ga0209700_10000218 | 286 |
| 13 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004340 | 289 |
| 14 | 3300048929 | Ga0496126_0425831 | Ga0496126_0425831_68_1018 | 291 |
| 15 | 3300026041 | Ga0207639_10138376 | Ga0207639_101383761 | 293 |
| 16 | 3300046691 | Ga0495670_0003206 | Ga0495670_0003206_3770_4729 | 293 |
| 17 | 3300049586 | Ga0501070_0041108 | Ga0501070_0041108_2884_3831 | 293 |
| 18 | 3300049589 | Ga0501073_0011183 | Ga0501073_0011183_5274_6221 | 293 |
| 19 | 3300053177 | Ga0500636_0019640 | Ga0500636_0019640_30_917 | 293 |
| 20 | 3300053096 | Ga0500641_0001269 | Ga0500641_0001269_2115_3065 | 294 |
| 21 | 3300013296 | Ga0157374_10074256 | Ga0157374_100742561 | 295 |
| 22 | 3300005343 | Ga0070687_100048167 | Ga0070687_1000481671 | 296 |
| 23 | 3300005549 | Ga0070704_100041136 | Ga0070704_1000411364 | 296 |
| 24 | 3300025229 | Ga0209147_105065 | Ga0209147_1050652 | 296 |
| 25 | 3300048920 | Ga0496117_0002935 | Ga0496117_0002935_17480_18838 | 296 |
| 26 | 3300048912 | Ga0496109_0132968 | Ga0496109_0132968_1403_2302 | 298 |
| 27 | 3300005438 | Ga0070701_10219930 | Ga0070701_102199301 | 299 |
| 28 | 3300005548 | Ga0070665_100141382 | Ga0070665_1001413823 | 299 |
| 29 | 3300005617 | Ga0068859_100353174 | Ga0068859_1003531742 | 299 |
| 30 | 3300005843 | Ga0068860_100067683 | Ga0068860_1000676833 | 299 |
| 31 | 3300006042 | Ga0075368_10000383 | Ga0075368_100003839 | 299 |
| 32 | 3300006178 | Ga0075367_10009877 | Ga0075367_100098774 | 299 |
| 33 | 3300006931 | Ga0097620_100353139 | Ga0097620_1003531392 | 299 |
| 34 | 3300013104 | Ga0157370_10102572 | Ga0157370_101025722 | 299 |
| 35 | 3300027866 | Ga0209813_10000569 | Ga0209813_100005699 | 299 |
| 36 | 3300028379 | Ga0268266_10087638 | Ga0268266_100876384 | 299 |
| 37 | 3300028380 | Ga0268265_10082448 | Ga0268265_100824483 | 299 |
| 38 | 3300046675 | Ga0495657_0101846 | Ga0495657_0101846_622_1524 | 299 |
| 39 | 3300050494 | nmdc:mga06z11_1708_c1 | nmdc:mga06z11_1708_c1_2300_3247 | 299 |
| 40 | 3300050495 | nmdc:mga04h51_390_c1 | nmdc:mga04h51_390_c1_2939_3886 | 299 |
| 41 | 3300005366 | Ga0070659_100288740 | Ga0070659_1002887402 | 300 |
| 42 | 3300009545 | Ga0105237_10333378 | Ga0105237_103333781 | 300 |
| 43 | 3300010375 | Ga0105239_10227061 | Ga0105239_102270612 | 300 |
| 44 | 3300013296 | Ga0157374_10176129 | Ga0157374_101761292 | 300 |
| 45 | 3300013306 | Ga0163162_10269201 | Ga0163162_102692013 | 300 |
| 46 | 3300026078 | Ga0207702_10220057 | Ga0207702_102200572 | 300 |
| 47 | 3300048903 | Ga0496100_0125346 | Ga0496100_0125346_694_1644 | 300 |
| 48 | 3300048905 | Ga0496102_0050693 | Ga0496102_0050693_2046_2996 | 300 |
| 49 | 3300048907 | Ga0496104_0210382 | Ga0496104_0210382_411_1361 | 300 |
| 50 | 3300048912 | Ga0496109_0056066 | Ga0496109_0056066_945_1895 | 300 |
| 51 | 3300048913 | Ga0496110_0017016 | Ga0496110_0017016_1132_2082 | 300 |
| 52 | 3300048915 | Ga0496112_0005318 | Ga0496112_0005318_474_1424 | 300 |
| 53 | 3300048916 | Ga0496113_0032720 | Ga0496113_0032720_2423_3373 | 300 |
| 54 | 3300025921 | Ga0207652_10138280 | Ga0207652_101382802 | 301 |
| 55 | 3300048908 | Ga0496105_0067534 | Ga0496105_0067534_1962_2912 | 301 |
| 56 | 3300006844 | Ga0075428_100031091 | Ga0075428_1000310912 | 302 |
| 57 | 3300009147 | Ga0114129_10455642 | Ga0114129_104556421 | 302 |
| 58 | 3300046535 | Ga0495586_0015412 | Ga0495586_0015412_446_1363 | 302 |
| 59 | 3300050507 | nmdc:mga05p37_389870_c1 | nmdc:mga05p37_389870_c1_88_1035 | 302 |
| 60 | iso_pu_bacteria | 2593339239 | 2595450237 | 302 |
| 61 | iso_pu_bacteria | 2842914999 | 2842917865 | 302 |
| 62 | iso_pu_bacteria | 2919085039 | 2919086079 | 302 |
| 63 | 3300046516 | Ga0495628_0397844 | Ga0495628_0397844_38_955 | 304 |
| 64 | iso_pu_bacteria | 2721755702 | 2723642646 | 304 |
| 65 | iso_pu_bacteria | 2935409751 | 2935413196 | 304 |
| 66 | 3300010375 | Ga0105239_10321088 | Ga0105239_103210882 | 306 |
| 67 | 3300013104 | Ga0157370_10000045 | Ga0157370_100000452 | 306 |
| 68 | 3300015265 | Ga0182005_1000036 | Ga0182005_100003647 | 306 |
| 69 | 3300017792 | Ga0163161_10008698 | Ga0163161_100086984 | 306 |
| 70 | 3300025299 | Ga0209256_1011806 | Ga0209256_10118063 | 306 |
| 71 | 3300025303 | Ga0209051_1016208 | Ga0209051_10162083 | 306 |
| 72 | 3300044735 | Ga0466968_0000341 | Ga0466968_0000341_4290_5267 | 306 |
| 73 | 3300046452 | Ga0495617_000393 | Ga0495617_000393_14360_15340 | 306 |
| 74 | 3300046457 | Ga0495590_0005374 | Ga0495590_0005374_305_1285 | 306 |
| 75 | 3300046460 | Ga0495638_0013056 | Ga0495638_0013056_3730_4710 | 306 |
| 76 | 3300046474 | Ga0495605_0008068 | Ga0495605_0008068_332_1312 | 306 |
| 77 | 3300046491 | Ga0495584_0000372 | Ga0495584_0000372_8029_9009 | 306 |
| 78 | 3300046501 | Ga0495607_0010733 | Ga0495607_0010733_490_1470 | 306 |
| 79 | 3300046501 | Ga0495607_0036543 | Ga0495607_0036543_1588_2568 | 306 |
| 80 | 3300046501 | Ga0495607_0048006 | Ga0495607_0048006_834_1814 | 306 |
| 81 | 3300046506 | Ga0495583_0000004 | Ga0495583_0000004_521852_522832 | 306 |
| 82 | 3300046512 | Ga0495610_0026908 | Ga0495610_0026908_1447_2427 | 306 |
| 83 | 3300046513 | Ga0495616_0012393 | Ga0495616_0012393_3209_4189 | 306 |
| 84 | 3300046513 | Ga0495616_0046416 | Ga0495616_0046416_927_1907 | 306 |
| 85 | 3300046523 | Ga0495644_0000665 | Ga0495644_0000665_4207_5187 | 306 |
| 86 | 3300046523 | Ga0495644_0001597 | Ga0495644_0001597_2600_3580 | 306 |
| 87 | 3300046524 | Ga0495648_0001624 | Ga0495648_0001624_15981_16961 | 306 |
| 88 | 3300046538 | Ga0495609_0001693 | Ga0495609_0001693_9516_10496 | 306 |
| 89 | 3300046558 | Ga0495633_0005466 | Ga0495633_0005466_2466_3446 | 306 |
| 90 | 3300046558 | Ga0495633_0095951 | Ga0495633_0095951_337_1317 | 306 |
| 91 | 3300046648 | Ga0495611_0005515 | Ga0495611_0005515_515_1495 | 306 |
| 92 | 3300046648 | Ga0495611_0005646 | Ga0495611_0005646_3840_4820 | 306 |
| 93 | 3300046660 | Ga0495625_0054900 | Ga0495625_0054900_903_1883 | 306 |
| 94 | 3300046660 | Ga0495625_0235756 | Ga0495625_0235756_103_1083 | 306 |
| 95 | 3300046664 | Ga0495659_0000886 | Ga0495659_0000886_5788_6768 | 306 |
| 96 | 3300046665 | Ga0495661_0024536 | Ga0495661_0024536_2859_3839 | 306 |
| 97 | 3300046691 | Ga0495670_0000186 | Ga0495670_0000186_23577_24557 | 306 |
| 98 | 3300046692 | Ga0495671_0036236 | Ga0495671_0036236_1408_2388 | 306 |
| 99 | 3300047318 | Ga0495636_0000298 | Ga0495636_0000298_16696_17676 | 306 |
| 100 | 3300047323 | Ga0495683_0006980 | Ga0495683_0006980_3804_4784 | 306 |
| 101 | 3300047443 | Ga0495687_000487 | Ga0495687_000487_16757_17737 | 306 |
| 102 | 3300047445 | Ga0495677_0019610 | Ga0495677_0019610_957_1937 | 306 |
| 103 | 3300047447 | Ga0495685_000003 | Ga0495685_000003_102616_103596 | 306 |
| 104 | 3300048903 | Ga0496100_0001386 | Ga0496100_0001386_5089_6069 | 306 |
| 105 | 3300048904 | Ga0496101_0001729 | Ga0496101_0001729_4654_5634 | 306 |
| 106 | 3300048910 | Ga0496107_0134857 | Ga0496107_0134857_254_1234 | 306 |
| 107 | 3300048924 | Ga0496121_0001500 | Ga0496121_0001500_3611_4591 | 306 |
| 108 | 3300048925 | Ga0496122_0012600 | Ga0496122_0012600_690_1670 | 306 |
| 109 | 3300048926 | Ga0496123_0003606 | Ga0496123_0003606_4564_5544 | 306 |
| 110 | 3300048927 | Ga0496124_0000245 | Ga0496124_0000245_69199_70194 | 306 |
| 111 | 3300048927 | Ga0496124_0001259 | Ga0496124_0001259_4495_5475 | 306 |
| 112 | 3300049459 | Ga0495678_000861 | Ga0495678_000861_12099_13079 | 306 |
| 113 | 3300049460 | Ga0495682_0000061 | Ga0495682_0000061_10626_11606 | 306 |
| 114 | 3300049460 | Ga0495682_0000250 | Ga0495682_0000250_23969_24949 | 306 |
| 115 | 3300014968 | Ga0157379_10452328 | Ga0157379_104523281 | 307 |
| 116 | 3300048909 | Ga0496106_0136799 | Ga0496106_0136799_466_1416 | 307 |
| 117 | 3300048924 | Ga0496121_0039119 | Ga0496121_0039119_2129_3079 | 307 |
| 118 | 3300048929 | Ga0496126_0195854 | Ga0496126_0195854_291_1241 | 307 |
| 119 | iso_pu_bacteria | 2582581280 | 2585154428 | 307 |
| 120 | iso_pu_bacteria | 2582581293 | 2585197909 | 307 |
| 121 | iso_pu_bacteria | 2643221552 | 2643779719 | 307 |
| 122 | iso_pu_bacteria | 2643221584 | 2643927712 | 307 |
| 123 | iso_pu_bacteria | 2818991435 | 2819535788 | 307 |
| 124 | iso_pu_bacteria | 2818991454 | 2819645102 | 307 |
| 125 | 3300049823 | Ga0501044_0000340 | Ga0501044_0000340_17052_17981 | 308 |
| 126 | iso_pu_bacteria | 2791355048 | 2792459420 | 308 |
| 127 | iso_pu_bacteria | 2843744320 | 2843744651 | 308 |
| 128 | iso_pu_bacteria | 2851153111 | 2851154386 | 308 |
| 129 | 3300005336 | Ga0070680_100379728 | Ga0070680_1003797281 | 309 |
| 130 | 3300005457 | Ga0070662_100065375 | Ga0070662_1000653752 | 309 |
| 131 | 3300005530 | Ga0070679_100111658 | Ga0070679_1001116582 | 309 |
| 132 | 3300005539 | Ga0068853_100030535 | Ga0068853_1000305353 | 309 |
| 133 | 3300005545 | Ga0070695_100031858 | Ga0070695_1000318584 | 309 |
| 134 | 3300005546 | Ga0070696_100005524 | Ga0070696_1000055245 | 309 |
| 135 | 3300005563 | Ga0068855_100343224 | Ga0068855_1003432242 | 309 |
| 136 | 3300009094 | Ga0111539_10014044 | Ga0111539_1001404410 | 309 |
| 137 | 3300013296 | Ga0157374_10294662 | Ga0157374_102946622 | 309 |
| 138 | 3300025912 | Ga0207707_10217124 | Ga0207707_102171242 | 309 |
| 139 | 3300025917 | Ga0207660_10324097 | Ga0207660_103240971 | 309 |
| 140 | 3300025921 | Ga0207652_10093510 | Ga0207652_100935102 | 309 |
| 141 | 3300025933 | Ga0207706_10029038 | Ga0207706_100290382 | 309 |
| 142 | 3300031852 | Ga0307410_10020584 | Ga0307410_100205843 | 309 |
| 143 | 3300031995 | Ga0307409_100000503 | Ga0307409_10000050310 | 309 |
| 144 | 3300032004 | Ga0307414_10003092 | Ga0307414_100030925 | 309 |
| 145 | 3300032005 | Ga0307411_10001596 | Ga0307411_1000159610 | 309 |
| 146 | 3300032126 | Ga0307415_100081569 | Ga0307415_1000815693 | 309 |
| 147 | 3300042120 | Ga0450917_002238 | Ga0450917_002238_149_1102 | 309 |
| 148 | 3300042127 | Ga0450890_001541 | Ga0450890_001541_1531_2484 | 309 |
| 149 | 3300042142 | Ga0450905_000403 | Ga0450905_000403_2693_3646 | 309 |
| 150 | 3300042144 | Ga0450889_000202 | Ga0450889_000202_4370_5323 | 309 |
| 151 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_389912_390844 | 309 |
| 152 | iso_pu_bacteria | 2643221614 | 2644088089 | 309 |
| 153 | iso_pu_bacteria | 2643221661 | 2644343327 | 309 |
| 154 | iso_pu_bacteria | 2643221666 | 2644369196 | 309 |
| 155 | iso_pu_bacteria | 2965320100 | 2965321353 | 309 |
| 156 | 3300049571 | Ga0501034_0058958 | Ga0501034_0058958_1323_2258 | 310 |
| 157 | 3300049573 | Ga0501037_0178468 | Ga0501037_0178468_15_950 | 310 |
| 158 | 3300049574 | Ga0501038_0020373 | Ga0501038_0020373_127_1062 | 310 |
| 159 | 3300049579 | Ga0501043_0149742 | Ga0501043_0149742_106_1041 | 310 |
| 160 | 3300049580 | Ga0501046_0086856 | Ga0501046_0086856_1018_1953 | 310 |
| 161 | 3300049589 | Ga0501073_0018099 | Ga0501073_0018099_2174_3109 | 310 |
| 162 | 3300049742 | Ga0501080_0005213 | Ga0501080_0005213_2275_3210 | 310 |
| 163 | 3300049744 | Ga0501083_0032239 | Ga0501083_0032239_1641_2576 | 310 |
| 164 | 3300053119 | Ga0500595_006621 | Ga0500595_006621_1944_2879 | 310 |
| 165 | 3300060353 | Ga0501082_0149022 | Ga0501082_0149022_994_1929 | 310 |
| 166 | iso_pu_bacteria | 2508501050 | 2508732706 | 310 |
| 167 | iso_pu_bacteria | 2508501114 | 2509078619 | 310 |
| 168 | iso_pu_bacteria | 2510461069 | 2510841469 | 310 |
| 169 | iso_pu_bacteria | 2510917022 | 2511133956 | 310 |
| 170 | iso_pu_bacteria | 2513237096 | 2513655794 | 310 |
| 171 | iso_pu_bacteria | 2513237137 | 2513856710 | 310 |
| 172 | iso_pu_bacteria | 2513237145 | 2513917293 | 310 |
| 173 | iso_pu_bacteria | 2517572143 | 2517895424 | 310 |
| 174 | iso_pu_bacteria | 2582581299 | 2585231640 | 310 |
| 175 | iso_pu_bacteria | 2582581307 | 2585273545 | 310 |
| 176 | iso_pu_bacteria | 2582581307 | 2585275949 | 310 |
| 177 | iso_pu_bacteria | 2582581308 | 2585282173 | 310 |
| 178 | iso_pu_bacteria | 2582581316 | 2585334666 | 310 |
| 179 | iso_pu_bacteria | 2582581867 | 2585399220 | 310 |
| 180 | iso_pu_bacteria | 2585427527 | 2585534475 | 310 |
| 181 | iso_pu_bacteria | 2585427528 | 2585542838 | 310 |
| 182 | iso_pu_bacteria | 2585427530 | 2585557904 | 310 |
| 183 | iso_pu_bacteria | 2585427531 | 2585559718 | 310 |
| 184 | iso_pu_bacteria | 2585427531 | 2585564225 | 310 |
| 185 | iso_pu_bacteria | 2585427593 | 2585841220 | 310 |
| 186 | iso_pu_bacteria | 2585427594 | 2585847048 | 310 |
| 187 | iso_pu_bacteria | 2585427608 | 2585900409 | 310 |
| 188 | iso_pu_bacteria | 2585427608 | 2585900987 | 310 |
| 189 | iso_pu_bacteria | 2585427609 | 2585906103 | 310 |
| 190 | iso_pu_bacteria | 2585427609 | 2585908877 | 310 |
| 191 | iso_pu_bacteria | 2585427633 | 2585998499 | 310 |
| 192 | iso_pu_bacteria | 2585428125 | 2587978782 | 310 |
| 193 | iso_pu_bacteria | 2585428125 | 2587984201 | 310 |
| 194 | iso_pu_bacteria | 2667528175 | 2671122100 | 310 |
| 195 | iso_pu_bacteria | 2687453129 | 2687580013 | 310 |
| 196 | iso_pu_bacteria | 2728368998 | 2728754422 | 310 |
| 197 | iso_pu_bacteria | 2775506901 | 2776259210 | 310 |
| 198 | iso_pu_bacteria | 2791355197 | 2793069399 | 310 |
| 199 | iso_pu_bacteria | 2835312727 | 2835313679 | 310 |
| 200 | iso_pu_bacteria | 2842509118 | 2842513080 | 310 |
| 201 | iso_pu_bacteria | 2894232714 | 2894232814 | 310 |
| 202 | iso_pu_bacteria | 2904690495 | 2904698768 | 310 |
| 203 | iso_pu_bacteria | 2906610324 | 2906615964 | 310 |
| 204 | iso_pu_bacteria | 2906635258 | 2906639054 | 310 |
| 205 | iso_pu_bacteria | 2906660503 | 2906662102 | 310 |
| 206 | iso_pu_bacteria | 2908739725 | 2908740973 | 310 |
| 207 | iso_pu_bacteria | 2908756301 | 2908759281 | 310 |
| 208 | iso_pu_bacteria | 2909042592 | 2909042612 | 310 |
| 209 | iso_pu_bacteria | 2919171160 | 2919172411 | 310 |
| 210 | iso_pu_bacteria | 2922425934 | 2922432070 | 310 |
| 211 | iso_pu_bacteria | 2935630451 | 2935631054 | 310 |
| 212 | iso_pu_bacteria | 2941507105 | 2941507706 | 310 |
| 213 | iso_pu_bacteria | 2941515067 | 2941516133 | 310 |
| 214 | iso_pu_bacteria | 2941523033 | 2941523159 | 310 |
| 215 | iso_pu_bacteria | 3005474847 | 3005476907 | 310 |
| 216 | iso_pu_bacteria | 8019555841 | 8019564170 | 310 |
| 217 | iso_pu_bacteria | 8046767195 | 8046769680 | 310 |
| 218 | iso_pu_bacteria | 8057575449 | 8057582350 | 310 |
| 219 | 3300003322 | rootL2_10261344 | rootL2_102613441 | 311 |
| 220 | 3300005336 | Ga0070680_100128625 | Ga0070680_1001286251 | 311 |
| 221 | 3300025297 | Ga0209758_1002558 | Ga0209758_10025589 | 311 |
| 222 | 3300025298 | Ga0209050_1018640 | Ga0209050_10186401 | 311 |
| 223 | 3300025304 | Ga0209257_1000074 | Ga0209257_1000074281 | 311 |
| 224 | 3300025912 | Ga0207707_10043786 | Ga0207707_100437862 | 311 |
| 225 | 3300025912 | Ga0207707_10064395 | Ga0207707_100643952 | 311 |
| 226 | 3300035115 | Ga0373941_0066348 | Ga0373941_0066348_228_1172 | 311 |
| 227 | 3300035121 | Ga0373960_0019855 | Ga0373960_0019855_692_1636 | 311 |
| 228 | 3300039437 | Ga0436365_1378994 | Ga0436365_1378994_897_1844 | 311 |
| 229 | 3300046460 | Ga0495638_0010662 | Ga0495638_0010662_1685_2623 | 311 |
| 230 | 3300046506 | Ga0495583_0000005 | Ga0495583_0000005_611819_612757 | 311 |
| 231 | 3300046513 | Ga0495616_0000548 | Ga0495616_0000548_2847_3785 | 311 |
| 232 | 3300046519 | Ga0495632_0000658 | Ga0495632_0000658_30124_31062 | 311 |
| 233 | 3300046616 | Ga0495668_0002848 | Ga0495668_0002848_6427_7365 | 311 |
| 234 | 3300047323 | Ga0495683_0010586 | Ga0495683_0010586_1595_2533 | 311 |
| 235 | 3300047472 | Ga0495686_0011755 | Ga0495686_0011755_5130_6068 | 311 |
| 236 | 3300053731 | Ga0500609_001438 | Ga0500609_001438_2421_3359 | 311 |
| 237 | 3300005330 | Ga0070690_100041586 | Ga0070690_1000415862 | 312 |
| 238 | 3300005336 | Ga0070680_100094661 | Ga0070680_1000946612 | 312 |
| 239 | 3300005337 | Ga0070682_100131430 | Ga0070682_1001314302 | 312 |
| 240 | 3300005347 | Ga0070668_100066896 | Ga0070668_1000668962 | 312 |
| 241 | 3300005353 | Ga0070669_100304505 | Ga0070669_1003045052 | 312 |
| 242 | 3300005364 | Ga0070673_100244950 | Ga0070673_1002449502 | 312 |
| 243 | 3300005367 | Ga0070667_100122220 | Ga0070667_1001222202 | 312 |
| 244 | 3300005456 | Ga0070678_100056996 | Ga0070678_1000569961 | 312 |
| 245 | 3300005459 | Ga0068867_100078952 | Ga0068867_1000789522 | 312 |
| 246 | 3300005544 | Ga0070686_100215106 | Ga0070686_1002151062 | 312 |
| 247 | 3300005547 | Ga0070693_100063193 | Ga0070693_1000631932 | 312 |
| 248 | 3300005563 | Ga0068855_100052341 | Ga0068855_1000523412 | 312 |
| 249 | 3300005614 | Ga0068856_100086516 | Ga0068856_1000865162 | 312 |
| 250 | 3300005618 | Ga0068864_100256794 | Ga0068864_1002567941 | 312 |
| 251 | 3300006237 | Ga0097621_100015498 | Ga0097621_1000154982 | 312 |
| 252 | 3300006358 | Ga0068871_100009488 | Ga0068871_1000094885 | 312 |
| 253 | 3300006358 | Ga0068871_100151094 | Ga0068871_1001510942 | 312 |
| 254 | 3300006881 | Ga0068865_100004472 | Ga0068865_1000044725 | 312 |
| 255 | 3300013296 | Ga0157374_10107146 | Ga0157374_101071463 | 312 |
| 256 | 3300013306 | Ga0163162_10008551 | Ga0163162_100085516 | 312 |
| 257 | 3300013306 | Ga0163162_10130206 | Ga0163162_101302062 | 312 |
| 258 | 3300013306 | Ga0163162_10454114 | Ga0163162_104541141 | 312 |
| 259 | 3300013307 | Ga0157372_10059461 | Ga0157372_100594614 | 312 |
| 260 | 3300013308 | Ga0157375_10007956 | Ga0157375_100079567 | 312 |
| 261 | 3300014969 | Ga0157376_10001442 | Ga0157376_1000144214 | 312 |
| 262 | 3300014969 | Ga0157376_10141768 | Ga0157376_101417682 | 312 |
| 263 | 3300017792 | Ga0163161_10203230 | Ga0163161_102032302 | 312 |
| 264 | 3300025921 | Ga0207652_10088129 | Ga0207652_100881292 | 312 |
| 265 | 3300025926 | Ga0207659_10284457 | Ga0207659_102844572 | 312 |
| 266 | 3300025933 | Ga0207706_10143857 | Ga0207706_101438572 | 312 |
| 267 | 3300025938 | Ga0207704_10062164 | Ga0207704_100621642 | 312 |
| 268 | 3300025986 | Ga0207658_10092677 | Ga0207658_100926772 | 312 |
| 269 | 3300026088 | Ga0207641_10144089 | Ga0207641_101440892 | 312 |
| 270 | 3300026088 | Ga0207641_10369187 | Ga0207641_103691871 | 312 |
| 271 | 3300026089 | Ga0207648_10044027 | Ga0207648_100440273 | 312 |
| 272 | 3300026121 | Ga0207683_10007115 | Ga0207683_100071157 | 312 |
| 273 | 3300026121 | Ga0207683_10361530 | Ga0207683_103615302 | 312 |
| 274 | 3300030521 | Ga0307511_10042710 | Ga0307511_100427103 | 312 |
| 275 | 3300035113 | Ga0373936_0022737 | Ga0373936_0022737_345_1292 | 312 |
| 276 | 3300035172 | Ga0373955_0108189 | Ga0373955_0108189_415_1365 | 312 |
| 277 | 3300035692 | Ga0373935_0005058 | Ga0373935_0005058_2920_3867 | 312 |
| 278 | 3300035695 | Ga0373927_0006512 | Ga0373927_0006512_3607_4554 | 312 |
| 279 | 3300036401 | Ga0373937_0536013 | Ga0373937_0536013_107_1051 | 312 |
| 280 | 3300037068 | Ga0373925_0019029 | Ga0373925_0019029_3538_4485 | 312 |
| 281 | 3300039447 | Ga0436361_0459563 | Ga0436361_0459563_289_1230 | 312 |
| 282 | 3300046472 | Ga0495580_0312275 | Ga0495580_0312275_105_1055 | 312 |
| 283 | 3300046474 | Ga0495605_0002939 | Ga0495605_0002939_4812_5756 | 312 |
| 284 | 3300046506 | Ga0495583_0024579 | Ga0495583_0024579_503_1447 | 312 |
| 285 | 3300046512 | Ga0495610_0003603 | Ga0495610_0003603_755_1699 | 312 |
| 286 | 3300046518 | Ga0495631_0001903 | Ga0495631_0001903_5257_6201 | 312 |
| 287 | 3300046519 | Ga0495632_0017430 | Ga0495632_0017430_584_1528 | 312 |
| 288 | 3300046616 | Ga0495668_0061132 | Ga0495668_0061132_473_1417 | 312 |
| 289 | 3300046660 | Ga0495625_0003025 | Ga0495625_0003025_4881_5825 | 312 |
| 290 | 3300046660 | Ga0495625_0005074 | Ga0495625_0005074_3207_4148 | 312 |
| 291 | 3300047315 | Ga0495581_0051428 | Ga0495581_0051428_1021_1971 | 312 |
| 292 | 3300047472 | Ga0495686_0088834 | Ga0495686_0088834_870_1814 | 312 |
| 293 | 3300048909 | Ga0496106_0003482 | Ga0496106_0003482_281_1222 | 312 |
| 294 | 3300048910 | Ga0496107_0000052 | Ga0496107_0000052_1568_2509 | 312 |
| 295 | 3300048913 | Ga0496110_0179253 | Ga0496110_0179253_628_1569 | 312 |
| 296 | 3300048924 | Ga0496121_0001744 | Ga0496121_0001744_11106_12047 | 312 |
| 297 | 3300049569 | Ga0501032_0029147 | Ga0501032_0029147_2237_3184 | 312 |
| 298 | 3300049570 | Ga0501033_0134726 | Ga0501033_0134726_607_1554 | 312 |
| 299 | 3300049571 | Ga0501034_0432051 | Ga0501034_0432051_211_1158 | 312 |
| 300 | 3300049572 | Ga0501036_0006676 | Ga0501036_0006676_7049_7996 | 312 |
| 301 | 3300049573 | Ga0501037_0015667 | Ga0501037_0015667_2346_3293 | 312 |
| 302 | 3300049574 | Ga0501038_0005375 | Ga0501038_0005375_9175_10122 | 312 |
| 303 | 3300049575 | Ga0501039_0047863 | Ga0501039_0047863_1233_2180 | 312 |
| 304 | 3300049579 | Ga0501043_0332128 | Ga0501043_0332128_33_980 | 312 |
| 305 | 3300049580 | Ga0501046_0025075 | Ga0501046_0025075_2143_3090 | 312 |
| 306 | 3300049581 | Ga0501047_0217453 | Ga0501047_0217453_466_1413 | 312 |
| 307 | 3300049582 | Ga0501048_0043503 | Ga0501048_0043503_1958_2905 | 312 |
| 308 | 3300049822 | Ga0501035_0065903 | Ga0501035_0065903_1132_2079 | 312 |
| 309 | 3300049823 | Ga0501044_0097695 | Ga0501044_0097695_1932_2879 | 312 |
| 310 | 3300049824 | Ga0501045_0312079 | Ga0501045_0312079_206_1153 | 312 |
| 311 | 3300050493 | nmdc:mga0k408_131232_c1 | nmdc:mga0k408_131232_c1_18_1016 | 312 |
| 312 | 3300050493 | nmdc:mga0k408_198273_c1 | nmdc:mga0k408_198273_c1_151_1110 | 312 |
| 313 | 3300053079 | Ga0500610_0016599 | Ga0500610_0016599_464_1408 | 312 |
| 314 | 3300053085 | Ga0495619_0101901 | Ga0495619_0101901_658_1608 | 312 |
| 315 | 3300053090 | Ga0500646_0002568 | Ga0500646_0002568_1797_2777 | 312 |
| 316 | 3300053092 | Ga0500583_0013830 | Ga0500583_0013830_73_1053 | 312 |
| 317 | 3300053092 | Ga0500583_0126654 | Ga0500583_0126654_101_1045 | 312 |
| 318 | 3300053118 | Ga0500594_0001044 | Ga0500594_0001044_4581_5525 | 312 |
| 319 | 3300053161 | Ga0500634_0102784 | Ga0500634_0102784_94_1038 | 312 |
| 320 | 3300003320 | rootH2_10005184 | rootH2_1000518414 | 313 |
| 321 | 3300005548 | Ga0070665_100362646 | Ga0070665_1003626462 | 313 |
| 322 | 3300005577 | Ga0068857_100123427 | Ga0068857_1001234272 | 313 |
| 323 | 3300009094 | Ga0111539_10476025 | Ga0111539_104760251 | 313 |
| 324 | 3300009174 | Ga0105241_10062972 | Ga0105241_100629723 | 313 |
| 325 | 3300013306 | Ga0163162_10350356 | Ga0163162_103503561 | 313 |
| 326 | 3300025913 | Ga0207695_10309529 | Ga0207695_103095292 | 313 |
| 327 | 3300046507 | Ga0495606_0008048 | Ga0495606_0008048_2878_3825 | 313 |
| 328 | 3300046512 | Ga0495610_0007883 | Ga0495610_0007883_3448_4452 | 313 |
| 329 | 3300049574 | Ga0501038_0078059 | Ga0501038_0078059_97_1041 | 313 |
| 330 | 2162886007 | SwRhRL2b_contig_1759361 | SwRhRL2b_0440.00008010 | 314 |
| 331 | 2162886007 | SwRhRL2b_contig_938321 | SwRhRL2b_0799.00009110 | 314 |
| 332 | 3300001979 | JGI24740J21852_10030582 | JGI24740J21852_100305822 | 314 |
| 333 | 3300002738 | JGI25154J39366_1000717 | JGI25154J39366_10007177 | 314 |
| 334 | 3300002741 | JGI25157J39369_1000235 | JGI25157J39369_100023521 | 314 |
| 335 | 3300002987 | JGI25159J45721_1000653 | JGI25159J45721_100065310 | 314 |
| 336 | 3300003316 | rootH1_10036229 | rootH1_100362292 | 314 |
| 337 | 3300003354 | JGI25160J50197_1000012 | JGI25160J50197_1000012232 | 314 |
| 338 | 3300003354 | JGI25160J50197_1000116 | JGI25160J50197_100011666 | 314 |
| 339 | 3300003374 | JGI25161J50226_1000002 | JGI25161J50226_1000002384 | 314 |
| 340 | 3300003752 | Ga0055539_1000558 | Ga0055539_10005583 | 314 |
| 341 | 3300003752 | Ga0055539_1006577 | Ga0055539_10065771 | 314 |
| 342 | 3300003756 | Ga0055533_1000221 | Ga0055533_100022121 | 314 |
| 343 | 3300003794 | Ga0055531_10002117 | Ga0055531_1000211713 | 314 |
| 344 | 3300004625 | Ga0055543_1000011 | Ga0055543_1000011137 | 314 |
| 345 | 3300005262 | Ga0065165_1000082 | Ga0065165_1000082101 | 314 |
| 346 | 3300005289 | Ga0065704_10070132 | Ga0065704_100701321538 | 314 |
| 347 | 3300005289 | Ga0065704_10072323 | Ga0065704_100723232 | 314 |
| 348 | 3300005327 | Ga0070658_10035828 | Ga0070658_100358282 | 314 |
| 349 | 3300005327 | Ga0070658_10208231 | Ga0070658_102082311 | 314 |
| 350 | 3300005327 | Ga0070658_10246362 | Ga0070658_102463622 | 314 |
| 351 | 3300005328 | Ga0070676_10009808 | Ga0070676_100098084 | 314 |
| 352 | 3300005334 | Ga0068869_100009844 | Ga0068869_1000098443 | 314 |
| 353 | 3300005339 | Ga0070660_100004122 | Ga0070660_1000041229 | 314 |
| 354 | 3300005347 | Ga0070668_100093620 | Ga0070668_1000936202 | 314 |
| 355 | 3300005364 | Ga0070673_100046996 | Ga0070673_1000469963 | 314 |
| 356 | 3300005366 | Ga0070659_100015584 | Ga0070659_1000155842 | 314 |
| 357 | 3300005406 | Ga0070703_10091846 | Ga0070703_100918461 | 314 |
| 358 | 3300005444 | Ga0070694_100223060 | Ga0070694_1002230601 | 314 |
| 359 | 3300005518 | Ga0070699_100100239 | Ga0070699_1001002392 | 314 |
| 360 | 3300005530 | Ga0070679_100318694 | Ga0070679_1003186942 | 314 |
| 361 | 3300005535 | Ga0070684_100051008 | Ga0070684_1000510083 | 314 |
| 362 | 3300005535 | Ga0070684_100567753 | Ga0070684_1005677531 | 314 |
| 363 | 3300005536 | Ga0070697_100116966 | Ga0070697_1001169662 | 314 |
| 364 | 3300005545 | Ga0070695_100010938 | Ga0070695_1000109386 | 314 |
| 365 | 3300005545 | Ga0070695_100157465 | Ga0070695_1001574651 | 314 |
| 366 | 3300005563 | Ga0068855_100022308 | Ga0068855_1000223086 | 314 |
| 367 | 3300005563 | Ga0068855_100061156 | Ga0068855_1000611563 | 314 |
| 368 | 3300005563 | Ga0068855_100648873 | Ga0068855_1006488731 | 314 |
| 369 | 3300005577 | Ga0068857_100008138 | Ga0068857_1000081385 | 314 |
| 370 | 3300005578 | Ga0068854_100009624 | Ga0068854_1000096245 | 314 |
| 371 | 3300005614 | Ga0068856_100008119 | Ga0068856_1000081192 | 314 |
| 372 | 3300005618 | Ga0068864_100172371 | Ga0068864_1001723713 | 314 |
| 373 | 3300005841 | Ga0068863_100043421 | Ga0068863_1000434213 | 314 |
| 374 | 3300005842 | Ga0068858_100179574 | Ga0068858_1001795741 | 314 |
| 375 | 3300005985 | Ga0081539_10051365 | Ga0081539_100513652 | 314 |
| 376 | 3300006038 | Ga0075365_10004322 | Ga0075365_100043224 | 314 |
| 377 | 3300006844 | Ga0075428_100053461 | Ga0075428_1000534612 | 314 |
| 378 | 3300006847 | Ga0075431_100267959 | Ga0075431_1002679591 | 314 |
| 379 | 3300006914 | Ga0075436_100013171 | Ga0075436_1000131711 | 314 |
| 380 | 3300007076 | Ga0075435_100448309 | Ga0075435_1004483091 | 314 |
| 381 | 3300009093 | Ga0105240_10024980 | Ga0105240_100249801 | 314 |
| 382 | 3300009098 | Ga0105245_10127336 | Ga0105245_101273363 | 314 |
| 383 | 3300009101 | Ga0105247_10013502 | Ga0105247_100135022 | 314 |
| 384 | 3300009148 | Ga0105243_10068107 | Ga0105243_100681072 | 314 |
| 385 | 3300009176 | Ga0105242_10207713 | Ga0105242_102077132 | 314 |
| 386 | 3300010375 | Ga0105239_10064136 | Ga0105239_100641363 | 314 |
| 387 | 3300013105 | Ga0157369_10164783 | Ga0157369_101647833 | 314 |
| 388 | 3300013296 | Ga0157374_10141839 | Ga0157374_101418391 | 314 |
| 389 | 3300013297 | Ga0157378_10053983 | Ga0157378_100539834 | 314 |
| 390 | 3300014325 | Ga0163163_10014280 | Ga0163163_100142807 | 314 |
| 391 | 3300014326 | Ga0157380_10015078 | Ga0157380_100150784 | 314 |
| 392 | 3300021384 | Ga0213876_10000053 | Ga0213876_1000005347 | 314 |
| 393 | 3300025226 | Ga0209674_100270 | Ga0209674_10027021 | 314 |
| 394 | 3300025230 | Ga0209563_100178 | Ga0209563_10017821 | 314 |
| 395 | 3300025231 | Ga0207427_100650 | Ga0207427_10065012 | 314 |
| 396 | 3300025242 | Ga0209258_100714 | Ga0209258_10071415 | 314 |
| 397 | 3300025246 | Ga0209646_1000157 | Ga0209646_100015789 | 314 |
| 398 | 3300025250 | Ga0209026_1000328 | Ga0209026_100032812 | 314 |
| 399 | 3300025253 | Ga0209677_100405 | Ga0209677_10040519 | 314 |
| 400 | 3300025253 | Ga0209677_101568 | Ga0209677_1015684 | 314 |
| 401 | 3300025256 | Ga0209759_1000448 | Ga0209759_100044821 | 314 |
| 402 | 3300025256 | Ga0209759_1001026 | Ga0209759_10010264 | 314 |
| 403 | 3300025256 | Ga0209759_1005335 | Ga0209759_10053354 | 314 |
| 404 | 3300025256 | Ga0209759_1009355 | Ga0209759_10093552 | 314 |
| 405 | 3300025261 | Ga0209233_1004855 | Ga0209233_10048552 | 314 |
| 406 | 3300025272 | Ga0209455_1011301 | Ga0209455_10113011 | 314 |
| 407 | 3300025284 | Ga0209130_1000028 | Ga0209130_100002867 | 314 |
| 408 | 3300025292 | Ga0209676_1003188 | Ga0209676_10031885 | 314 |
| 409 | 3300025297 | Ga0209758_1000383 | Ga0209758_10003832 | 314 |
| 410 | 3300025302 | Ga0207426_1000012 | Ga0207426_1000012514 | 314 |
| 411 | 3300025303 | Ga0209051_1002507 | Ga0209051_10025074 | 314 |
| 412 | 3300025304 | Ga0209257_1004287 | Ga0209257_10042873 | 314 |
| 413 | 3300025900 | Ga0207710_10061166 | Ga0207710_100611662 | 314 |
| 414 | 3300025907 | Ga0207645_10024130 | Ga0207645_100241304 | 314 |
| 415 | 3300025909 | Ga0207705_10186222 | Ga0207705_101862222 | 314 |
| 416 | 3300025912 | Ga0207707_10302894 | Ga0207707_103028942 | 314 |
| 417 | 3300025913 | Ga0207695_10038504 | Ga0207695_100385043 | 314 |
| 418 | 3300025919 | Ga0207657_10009860 | Ga0207657_100098608 | 314 |
| 419 | 3300025919 | Ga0207657_10070586 | Ga0207657_100705863 | 314 |
| 420 | 3300025921 | Ga0207652_10325031 | Ga0207652_103250311 | 314 |
| 421 | 3300025922 | Ga0207646_10041621 | Ga0207646_100416213 | 314 |
| 422 | 3300025923 | Ga0207681_10098788 | Ga0207681_100987882 | 314 |
| 423 | 3300025924 | Ga0207694_10074201 | Ga0207694_100742014 | 314 |
| 424 | 3300025927 | Ga0207687_10128752 | Ga0207687_101287521 | 314 |
| 425 | 3300025935 | Ga0207709_10290635 | Ga0207709_102906351 | 314 |
| 426 | 3300025942 | Ga0207689_10085674 | Ga0207689_100856743 | 314 |
| 427 | 3300025949 | Ga0207667_10036269 | Ga0207667_100362694 | 314 |
| 428 | 3300025949 | Ga0207667_10049853 | Ga0207667_100498535 | 314 |
| 429 | 3300025960 | Ga0207651_10003103 | Ga0207651_100031038 | 314 |
| 430 | 3300025981 | Ga0207640_10001829 | Ga0207640_100018299 | 314 |
| 431 | 3300026078 | Ga0207702_10001082 | Ga0207702_1000108221 | 314 |
| 432 | 3300026088 | Ga0207641_10402898 | Ga0207641_104028981 | 314 |
| 433 | 3300026116 | Ga0207674_10021844 | Ga0207674_100218441 | 314 |
| 434 | 3300026116 | Ga0207674_10174636 | Ga0207674_101746363 | 314 |
| 435 | 3300026118 | Ga0207675_100043493 | Ga0207675_1000434934 | 314 |
| 436 | 3300028556 | Ga0265337_1002746 | Ga0265337_10027464 | 314 |
| 437 | 3300028563 | Ga0265319_1011863 | Ga0265319_10118632 | 314 |
| 438 | 3300028573 | Ga0265334_10001736 | Ga0265334_100017367 | 314 |
| 439 | 3300028577 | Ga0265318_10007109 | Ga0265318_100071094 | 314 |
| 440 | 3300028653 | Ga0265323_10000674 | Ga0265323_100006742 | 314 |
| 441 | 3300028654 | Ga0265322_10008191 | Ga0265322_100081911 | 314 |
| 442 | 3300028666 | Ga0265336_10000044 | Ga0265336_10000044100 | 314 |
| 443 | 3300028666 | Ga0265336_10000389 | Ga0265336_100003895 | 314 |
| 444 | 3300028666 | Ga0265336_10022002 | Ga0265336_100220022 | 314 |
| 445 | 3300028794 | Ga0307515_10000434 | Ga0307515_1000043415 | 314 |
| 446 | 3300028794 | Ga0307515_10015010 | Ga0307515_100150103 | 314 |
| 447 | 3300028800 | Ga0265338_10000176 | Ga0265338_1000017624 | 314 |
| 448 | 3300029957 | Ga0265324_10001802 | Ga0265324_100018023 | 314 |
| 449 | 3300031240 | Ga0265320_10079770 | Ga0265320_100797701 | 314 |
| 450 | 3300031456 | Ga0307513_10122083 | Ga0307513_101220832 | 314 |
| 451 | 3300031711 | Ga0265314_10218083 | Ga0265314_102180831 | 314 |
| 452 | 3300031731 | Ga0307405_10000004 | Ga0307405_10000004354 | 314 |
| 453 | 3300031731 | Ga0307405_10037820 | Ga0307405_100378202 | 314 |
| 454 | 3300031852 | Ga0307410_10124173 | Ga0307410_101241732 | 314 |
| 455 | 3300031901 | Ga0307406_10007529 | Ga0307406_100075293 | 314 |
| 456 | 3300031995 | Ga0307409_100010866 | Ga0307409_1000108664 | 314 |
| 457 | 3300032004 | Ga0307414_10160269 | Ga0307414_101602691 | 314 |
| 458 | 3300032004 | Ga0307414_10199058 | Ga0307414_101990582 | 314 |
| 459 | 3300032004 | Ga0307414_10289665 | Ga0307414_102896652 | 314 |
| 460 | 3300032005 | Ga0307411_10071953 | Ga0307411_100719532 | 314 |
| 461 | 3300032005 | Ga0307411_10161932 | Ga0307411_101619323 | 314 |
| 462 | 3300035207 | Ga0373942_0059788 | Ga0373942_0059788_59_1006 | 314 |
| 463 | 3300037418 | Ga0395900_0008892 | Ga0395900_0008892_2093_3043 | 314 |
| 464 | 3300037418 | Ga0395900_0283833 | Ga0395900_0283833_75_1046 | 314 |
| 465 | 3300037418 | Ga0395900_0345191 | Ga0395900_0345191_333_1283 | 314 |
| 466 | 3300037466 | Ga0395898_0012924 | Ga0395898_0012924_121_1071 | 314 |
| 467 | 3300037466 | Ga0395898_0016659 | Ga0395898_0016659_4581_5543 | 314 |
| 468 | 3300037466 | Ga0395898_0118297 | Ga0395898_0118297_178_1128 | 314 |
| 469 | 3300037471 | Ga0395905_0146473 | Ga0395905_0146473_54_1016 | 314 |
| 470 | 3300037471 | Ga0395905_0164438 | Ga0395905_0164438_112_1065 | 314 |
| 471 | 3300038443 | Ga0395901_0001189 | Ga0395901_0001189_15286_16248 | 314 |
| 472 | 3300039437 | Ga0436365_0873465 | Ga0436365_0873465_59313_60260 | 314 |
| 473 | 3300041404 | Ga0439436_0000351 | Ga0439436_0000351_3599_4573 | 314 |
| 474 | 3300044683 | Ga0466965_0017833 | Ga0466965_0017833_2119_3090 | 314 |
| 475 | 3300044765 | Ga0466970_0082862 | Ga0466970_0082862_480_1430 | 314 |
| 476 | 3300044842 | Ga0466957_0070908 | Ga0466957_0070908_1001_1963 | 314 |
| 477 | 3300044842 | Ga0466957_0088839 | Ga0466957_0088839_459_1409 | 314 |
| 478 | 3300045976 | Ga0466967_0017525 | Ga0466967_0017525_3702_4679 | 314 |
| 479 | 3300046453 | Ga0495627_002272 | Ga0495627_002272_2800_3750 | 314 |
| 480 | 3300046453 | Ga0495627_019566 | Ga0495627_019566_897_1847 | 314 |
| 481 | 3300046454 | Ga0495592_0010630 | Ga0495592_0010630_4829_5776 | 314 |
| 482 | 3300046457 | Ga0495590_0008412 | Ga0495590_0008412_2556_3506 | 314 |
| 483 | 3300046460 | Ga0495638_0000141 | Ga0495638_0000141_74302_75252 | 314 |
| 484 | 3300046462 | Ga0495651_0019137 | Ga0495651_0019137_2735_3682 | 314 |
| 485 | 3300046463 | Ga0495653_0058987 | Ga0495653_0058987_1553_2500 | 314 |
| 486 | 3300046471 | Ga0495650_0082532 | Ga0495650_0082532_258_1208 | 314 |
| 487 | 3300046474 | Ga0495605_0093180 | Ga0495605_0093180_188_1138 | 314 |
| 488 | 3300046477 | Ga0495664_0023979 | Ga0495664_0023979_24_971 | 314 |
| 489 | 3300046491 | Ga0495584_0069245 | Ga0495584_0069245_801_1751 | 314 |
| 490 | 3300046492 | Ga0495585_0003542 | Ga0495585_0003542_8590_9540 | 314 |
| 491 | 3300046501 | Ga0495607_0028247 | Ga0495607_0028247_786_1736 | 314 |
| 492 | 3300046501 | Ga0495607_0029382 | Ga0495607_0029382_2038_2988 | 314 |
| 493 | 3300046501 | Ga0495607_0038622 | Ga0495607_0038622_218_1168 | 314 |
| 494 | 3300046501 | Ga0495607_0048941 | Ga0495607_0048941_13_963 | 314 |
| 495 | 3300046506 | Ga0495583_0000887 | Ga0495583_0000887_25945_26907 | 314 |
| 496 | 3300046507 | Ga0495606_0014145 | Ga0495606_0014145_5053_6015 | 314 |
| 497 | 3300046507 | Ga0495606_0056062 | Ga0495606_0056062_368_1318 | 314 |
| 498 | 3300046511 | Ga0495608_0033123 | Ga0495608_0033123_505_1452 | 314 |
| 499 | 3300046515 | Ga0495620_0000188 | Ga0495620_0000188_15826_16776 | 314 |
| 500 | 3300046515 | Ga0495620_0000209 | Ga0495620_0000209_7046_7996 | 314 |
| 501 | 3300046515 | Ga0495620_0004156 | Ga0495620_0004156_2702_3652 | 314 |
| 502 | 3300046516 | Ga0495628_0004111 | Ga0495628_0004111_8392_9339 | 314 |
| 503 | 3300046517 | Ga0495630_0030875 | Ga0495630_0030875_998_1945 | 314 |
| 504 | 3300046517 | Ga0495630_0043912 | Ga0495630_0043912_2314_3309 | 314 |
| 505 | 3300046519 | Ga0495632_0097757 | Ga0495632_0097757_51_1001 | 314 |
| 506 | 3300046520 | Ga0495637_0024351 | Ga0495637_0024351_1081_2031 | 314 |
| 507 | 3300046522 | Ga0495643_0008378 | Ga0495643_0008378_5216_6166 | 314 |
| 508 | 3300046529 | Ga0495652_0006323 | Ga0495652_0006323_5900_6847 | 314 |
| 509 | 3300046530 | Ga0495654_0002031 | Ga0495654_0002031_52_1002 | 314 |
| 510 | 3300046536 | Ga0495587_0020341 | Ga0495587_0020341_1806_2753 | 314 |
| 511 | 3300046538 | Ga0495609_0000091 | Ga0495609_0000091_100948_101898 | 314 |
| 512 | 3300046542 | Ga0495597_0001265 | Ga0495597_0001265_10092_11075 | 314 |
| 513 | 3300046542 | Ga0495597_0029566 | Ga0495597_0029566_1482_2444 | 314 |
| 514 | 3300046543 | Ga0495645_0010602 | Ga0495645_0010602_203_1150 | 314 |
| 515 | 3300046559 | Ga0495667_0002970 | Ga0495667_0002970_1849_2796 | 314 |
| 516 | 3300046616 | Ga0495668_0071924 | Ga0495668_0071924_536_1498 | 314 |
| 517 | 3300046648 | Ga0495611_0000489 | Ga0495611_0000489_10171_11121 | 314 |
| 518 | 3300046648 | Ga0495611_0047805 | Ga0495611_0047805_137_1087 | 314 |
| 519 | 3300046660 | Ga0495625_0000364 | Ga0495625_0000364_4515_5465 | 314 |
| 520 | 3300046660 | Ga0495625_0020123 | Ga0495625_0020123_4099_5061 | 314 |
| 521 | 3300046660 | Ga0495625_0069477 | Ga0495625_0069477_564_1526 | 314 |
| 522 | 3300046674 | Ga0495588_0000677 | Ga0495588_0000677_1888_2838 | 314 |
| 523 | 3300046674 | Ga0495588_0012096 | Ga0495588_0012096_2706_3656 | 314 |
| 524 | 3300046678 | Ga0495599_0028023 | Ga0495599_0028023_2488_3435 | 314 |
| 525 | 3300046691 | Ga0495670_0000087 | Ga0495670_0000087_12599_13549 | 314 |
| 526 | 3300046691 | Ga0495670_0112832 | Ga0495670_0112832_47_997 | 314 |
| 527 | 3300046692 | Ga0495671_0000081 | Ga0495671_0000081_16181_17131 | 314 |
| 528 | 3300046694 | Ga0495649_0001134 | Ga0495649_0001134_10930_11880 | 314 |
| 529 | 3300046694 | Ga0495649_0003333 | Ga0495649_0003333_8006_8968 | 314 |
| 530 | 3300046694 | Ga0495649_0014199 | Ga0495649_0014199_338_1288 | 314 |
| 531 | 3300046809 | Ga0495600_0017993 | Ga0495600_0017993_602_1549 | 314 |
| 532 | 3300047317 | Ga0495604_0005582 | Ga0495604_0005582_6489_7436 | 314 |
| 533 | 3300047317 | Ga0495604_0088276 | Ga0495604_0088276_628_1575 | 314 |
| 534 | 3300047318 | Ga0495636_0017663 | Ga0495636_0017663_1082_2185 | 314 |
| 535 | 3300047323 | Ga0495683_0017554 | Ga0495683_0017554_1918_2868 | 314 |
| 536 | 3300047323 | Ga0495683_0048445 | Ga0495683_0048445_1013_1963 | 314 |
| 537 | 3300047443 | Ga0495687_000090 | Ga0495687_000090_78887_79837 | 314 |
| 538 | 3300047443 | Ga0495687_004985 | Ga0495687_004985_5555_6505 | 314 |
| 539 | 3300047444 | Ga0495675_0000073 | Ga0495675_0000073_19245_20192 | 314 |
| 540 | 3300047444 | Ga0495675_0042186 | Ga0495675_0042186_1671_2648 | 314 |
| 541 | 3300047470 | Ga0495681_0005808 | Ga0495681_0005808_2563_3513 | 314 |
| 542 | 3300047472 | Ga0495686_0000157 | Ga0495686_0000157_42679_43629 | 314 |
| 543 | 3300048088 | Ga0495602_0009567 | Ga0495602_0009567_5591_6538 | 314 |
| 544 | 3300048091 | Ga0495626_0003776 | Ga0495626_0003776_7808_8767 | 314 |
| 545 | 3300048091 | Ga0495626_0064283 | Ga0495626_0064283_78_1028 | 314 |
| 546 | 3300048905 | Ga0496102_0439844 | Ga0496102_0439844_236_1186 | 314 |
| 547 | 3300048907 | Ga0496104_0001052 | Ga0496104_0001052_9584_10531 | 314 |
| 548 | 3300048908 | Ga0496105_0025138 | Ga0496105_0025138_2710_3657 | 314 |
| 549 | 3300048911 | Ga0496108_0001335 | Ga0496108_0001335_11298_12245 | 314 |
| 550 | 3300048913 | Ga0496110_0027115 | Ga0496110_0027115_1547_2494 | 314 |
| 551 | 3300048914 | Ga0496111_0030709 | Ga0496111_0030709_172_1119 | 314 |
| 552 | 3300048915 | Ga0496112_0011892 | Ga0496112_0011892_61_1008 | 314 |
| 553 | 3300048915 | Ga0496112_0020375 | Ga0496112_0020375_4077_5030 | 314 |
| 554 | 3300048924 | Ga0496121_0232251 | Ga0496121_0232251_193_1143 | 314 |
| 555 | 3300048925 | Ga0496122_0000018 | Ga0496122_0000018_224169_225119 | 314 |
| 556 | 3300048926 | Ga0496123_0000015 | Ga0496123_0000015_224169_225119 | 314 |
| 557 | 3300048928 | Ga0496125_0000189 | Ga0496125_0000189_53898_54848 | 314 |
| 558 | 3300048929 | Ga0496126_0007571 | Ga0496126_0007571_2727_3677 | 314 |
| 559 | 3300048929 | Ga0496126_0017349 | Ga0496126_0017349_1655_2605 | 314 |
| 560 | 3300049459 | Ga0495678_000059 | Ga0495678_000059_81474_82424 | 314 |
| 561 | 3300049459 | Ga0495678_010452 | Ga0495678_010452_3474_4424 | 314 |
| 562 | 3300049460 | Ga0495682_0001842 | Ga0495682_0001842_671_1621 | 314 |
| 563 | 3300049823 | Ga0501044_0036207 | Ga0501044_0036207_597_1568 | 314 |
| 564 | 3300050494 | nmdc:mga06z11_6147_c1 | nmdc:mga06z11_6147_c1_3834_4781 | 314 |
| 565 | 3300050496 | nmdc:mga07m45_13464_c1 | nmdc:mga07m45_13464_c1_251_1213 | 314 |
| 566 | 3300050509 | nmdc:mga0qj67_11364_c1 | nmdc:mga0qj67_11364_c1_4039_4989 | 314 |
| 567 | 3300050510 | nmdc:mga06r32_256880_c1 | nmdc:mga06r32_256880_c1_203_1153 | 314 |
| 568 | 3300050513 | nmdc:mga0rr50_288202_c1 | nmdc:mga0rr50_288202_c1_34_1002 | 314 |
| 569 | 3300050516 | nmdc:mga0sz30_13910_c1 | nmdc:mga0sz30_13910_c1_401_1351 | 314 |
| 570 | 3300053079 | Ga0500610_0057489 | Ga0500610_0057489_816_1766 | 314 |
| 571 | 3300053086 | Ga0500578_0001680 | Ga0500578_0001680_11291_12241 | 314 |
| 572 | 3300053086 | Ga0500578_0056836 | Ga0500578_0056836_74_1024 | 314 |
| 573 | 3300053087 | Ga0500643_010904 | Ga0500643_010904_2029_3132 | 314 |
| 574 | 3300053103 | Ga0500555_000860 | Ga0500555_000860_7740_8690 | 314 |
| 575 | 3300053105 | Ga0500557_040138 | Ga0500557_040138_406_1356 | 314 |
| 576 | 3300053108 | Ga0500562_013719 | Ga0500562_013719_74_1024 | 314 |
| 577 | 3300053119 | Ga0500595_001037 | Ga0500595_001037_3368_4318 | 314 |
| 578 | 3300053122 | Ga0500608_065445 | Ga0500608_065445_223_1185 | 314 |
| 579 | 3300053125 | Ga0500618_000315 | Ga0500618_000315_32158_33111 | 314 |
| 580 | 3300053125 | Ga0500618_000372 | Ga0500618_000372_20808_21758 | 314 |
| 581 | 3300053131 | Ga0500652_004117 | Ga0500652_004117_530_1480 | 314 |
| 582 | 3300053137 | Ga0500561_0005941 | Ga0500561_0005941_435_1385 | 314 |
| 583 | 3300053139 | Ga0500568_0000042 | Ga0500568_0000042_96850_97800 | 314 |
| 584 | 3300053139 | Ga0500568_0001475 | Ga0500568_0001475_4568_5518 | 314 |
| 585 | 3300053141 | Ga0500574_000078 | Ga0500574_000078_9024_9974 | 314 |
| 586 | 3300053153 | Ga0500616_0003001 | Ga0500616_0003001_10066_11016 | 314 |
| 587 | 3300053154 | Ga0500619_010183 | Ga0500619_010183_1136_2086 | 314 |
| 588 | 3300053156 | Ga0500622_0066285 | Ga0500622_0066285_232_1182 | 314 |
| 589 | 3300053157 | Ga0500624_000360 | Ga0500624_000360_957_1907 | 314 |
| 590 | 3300053158 | Ga0500627_0052626 | Ga0500627_0052626_506_1456 | 314 |
| 591 | 3300053161 | Ga0500634_0017114 | Ga0500634_0017114_2101_3051 | 314 |
| 592 | 3300053161 | Ga0500634_0048246 | Ga0500634_0048246_1078_2028 | 314 |
| 593 | 3300053162 | Ga0500638_000313 | Ga0500638_000313_1054_2004 | 314 |
| 594 | 3300053177 | Ga0500636_0022196 | Ga0500636_0022196_2551_3501 | 314 |
| 595 | 3300053723 | Ga0500567_015383 | Ga0500567_015383_966_1916 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7utf-assembly1.cif.gz_C | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9741 | 1 | 313 |
| 7utf-assembly2.cif.gz_D | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9729 | 1 | 313 |
| 7utf-assembly2.cif.gz_B | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9622 | 1 | 313 |
| 7utf-assembly1.cif.gz_A | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9616 | 1 | 313 |
| 4xk2-assembly2.cif.gz_B | crystal structure of aldo-keto reductase from polaromonas sp. js666 | 0.9521 | 1 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xk2A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9383 | 1 | 314 | 3.20.20.100 |
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9185 | 1 | 314 | 3.20.20.100 |
| af_Q8VZ23_56_411_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9166 | 1 | 312 | 3.20.20.100 |
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9156 | 1 | 314 | 3.20.20.100 |
| 3n6qB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9118 | 4 | 312 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A379AEG0-F1-model_v4 | General stress protein 69 (EC 1.1.1.-) | 0.9933 | 2 | 181 |
GO:0005829
GO:0016491 |
| AF-A0A519MZM9-F1-model_v4 | Aldo/keto reductase | 0.9901 | 1 | 262 |
GO:0005829
|
| AF-A0A4U9WIE7-F1-model_v4 | Putative aldo-keto reductase | 0.99 | 1 | 231 |
GO:0005829
GO:0016491 |
| AF-A0A436BZK1-F1-model_v4 | Aldo/keto reductase | 0.987 | 1 | 211 |
GO:0005829
GO:0016491 |
| AF-A0A3S2CD63-F1-model_v4 | Aldo/keto reductase | 0.9867 | 1 | 227 |
GO:0005829
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar