F467480

General Info

Members Datasets Scaffolds Average Seq Length
595 398 524 316

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0017663|Ga0495636_0017663_1082_2185
Length 367
Sequence MRLVTRGVFPRRGQFALPLFRLPALSGVKPLYLAESDRARNSRSLIHMEISMQKRRLGRTGLEVSPVILGGNVFGWTADEATSFSVLDAAFDAGLNTIDTADVYSSWVPGNVGGESEVIIGKWLKRGKISRDQVVLITKVGSEMGEGKKGLTAAYIAEAVEASLNRLQTDYIDVYLSHWHDPETPYEETLGAYEKLKTQGKIRAFGCSNLDAEQLQASIDTATVNGVPRYDVLQPEYNLYDRAGFEGPLADLCAKEEIAVITYYSLASGFLSGKYKSKADVQGRPRGDGLLKYFDDKGLRILSALNQVAEEVGAKPAEVALAWLLRKNAVTAPIASATSIPQVAGLANAAQLSLSDRLIAKLDEAGV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
11 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
12 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
13 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
14 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
17 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
18 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
19 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
20 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
21 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
22 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
23 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
24 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
25 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
26 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
27 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
28 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
29 2643221584 Caulobacter sp. Root656 Isolate Unclassified
30 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
31 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
32 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
33 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
34 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
35 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
36 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
37 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
38 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
39 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
40 2818991435 Caulobacter henricii 536 Isolate Unclassified
41 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
42 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
43 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
44 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
45 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
46 2851153111 Caulobacter radicis 736 Isolate Unclassified
47 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
48 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
49 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
50 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
51 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
52 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
53 2909042592 Labrys sp. LIt4 Isolate Nodule
54 2919085039 Luteibacter sp. 1214 Isolate Unclassified
55 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
56 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
57 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
58 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
59 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
60 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
61 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
62 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
63 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
66 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
72 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
73 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
80 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
92 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
129 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
161 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
162 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
210 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
214 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
215 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
219 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
247 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
248 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
249 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
250 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
273 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
274 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
275 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
289 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
314 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
370 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
371 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
372 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
375 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
378 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
379 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
380 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
381 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
382 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
387 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
388 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
391 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
394 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
397 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
398 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.36
Metatranscriptomes 0
Isolates 11.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.94
Nodule 4.87
Rhizoplane 4.2
Rhizosphere 68.91
Stem 0
Stem Tuber 0
Unclassified 9.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
2 SwRhRL2b_contig_938321 2162886007 Bacteria 1842
3 JGI24740J21852_10030582 3300001979 Bacteria 1749
4 JGI25154J39366_1000717 3300002738 Bacteria 15031
5 JGI25157J39369_1000235 3300002741 Bacteria 42844
6 JGI25159J45721_1000653 3300002987 Bacteria 15377
7 rootH1_10036229 3300003316 Bacteria 2127
8 rootH2_10005184 3300003320 Bacteria 18219
9 rootL2_10261344 3300003322 Bacteria 1233
10 JGI25160J50197_1000012 3300003354 Bacteria 267582
11 JGI25160J50197_1000116 3300003354 Bacteria 72316
12 JGI25161J50226_1000002 3300003374 Bacteria 420324
13 Ga0055539_1000558 3300003752 Bacteria 10776
14 Ga0055539_1006577 3300003752 Bacteria 1485
15 Ga0055533_1000221 3300003756 Bacteria 40020
16 Ga0055531_10002117 3300003794 Bacteria 13614
17 Ga0055543_1000011 3300004625 Bacteria 196089
18 Ga0065165_1000082 3300005262 Bacteria 158536
19 Ga0065704_10070132 3300005289 Bacteria 1955461
20 Ga0065704_10072323 3300005289 Bacteria 8740
21 Ga0070658_10035828 3300005327 Bacteria 3997
22 Ga0070658_10208231 3300005327 Bacteria 1651
23 Ga0070658_10246362 3300005327 Bacteria 1515
24 Ga0070676_10009808 3300005328 Bacteria 5179
25 Ga0070690_100041586 3300005330 Bacteria 2910
26 Ga0068869_100009844 3300005334 Bacteria 6208
27 Ga0070680_100094661 3300005336 Bacteria 2476
28 Ga0070680_100128625 3300005336 Bacteria 2117
29 Ga0070680_100379728 3300005336 Bacteria 1203
30 Ga0070682_100131430 3300005337 Bacteria 1695
31 Ga0070660_100004122 3300005339 Bacteria 10029
32 Ga0070687_100048167 3300005343 Bacteria 2190
33 Ga0070668_100066896 3300005347 Bacteria 2790
34 Ga0070668_100093620 3300005347 Bacteria 2371
35 Ga0070669_100304505 3300005353 Bacteria 1283
36 Ga0070673_100046996 3300005364 Bacteria 3356
37 Ga0070673_100244950 3300005364 Bacteria 1560
38 Ga0070659_100015584 3300005366 Bacteria 5693
39 Ga0070659_100288740 3300005366 Bacteria 1366
40 Ga0070667_100122220 3300005367 Bacteria 2266
41 Ga0070703_10091846 3300005406 Bacteria 1054
42 Ga0070701_10219930 3300005438 Bacteria 1132
43 Ga0070694_100223060 3300005444 Bacteria 1415
44 Ga0070678_100056996 3300005456 Bacteria 2860
45 Ga0070662_100065375 3300005457 Bacteria 2666
46 Ga0068867_100078952 3300005459 Bacteria 2476
47 Ga0070699_100100239 3300005518 Bacteria 2538
48 Ga0070679_100111658 3300005530 Bacteria 2720
49 Ga0070679_100318694 3300005530 Bacteria 1504
50 Ga0070684_100051008 3300005535 Bacteria 3594
51 Ga0070684_100567753 3300005535 Bacteria 1054
52 Ga0070697_100116966 3300005536 Bacteria 2227
53 Ga0068853_100030535 3300005539 Bacteria 4553
54 Ga0070686_100215106 3300005544 Bacteria 1386
55 Ga0070695_100010938 3300005545 Bacteria 5423
56 Ga0070695_100031858 3300005545 Bacteria 3292
57 Ga0070695_100157465 3300005545 Bacteria 1591
58 Ga0070696_100005524 3300005546 Bacteria 8438
59 Ga0070693_100063193 3300005547 Bacteria 2157
60 Ga0070665_100141382 3300005548 Bacteria 2410
61 Ga0070665_100362646 3300005548 Bacteria 1455
62 Ga0070704_100041136 3300005549 Bacteria 3187
63 Ga0068855_100022308 3300005563 Bacteria 7586
64 Ga0068855_100052341 3300005563 Bacteria 4807
65 Ga0068855_100061156 3300005563 Bacteria 4401
66 Ga0068855_100343224 3300005563 Bacteria 1646
67 Ga0068855_100648873 3300005563 Bacteria 1134
68 Ga0068857_100008138 3300005577 Bacteria 9052
69 Ga0068857_100123427 3300005577 Bacteria 2333
70 Ga0068854_100009624 3300005578 Bacteria 6241
71 Ga0068856_100008119 3300005614 Bacteria 10244
72 Ga0068856_100086516 3300005614 Bacteria 3114
73 Ga0068859_100353174 3300005617 Bacteria 1565
74 Ga0068864_100172371 3300005618 Bacteria 1973
75 Ga0068864_100256794 3300005618 Bacteria 1624
76 Ga0068863_100043421 3300005841 Bacteria 4268
77 Ga0068858_100179574 3300005842 Bacteria 1998
78 Ga0068860_100067683 3300005843 Bacteria 3393
79 Ga0081539_10051365 3300005985 Bacteria 2324
80 Ga0075365_10004322 3300006038 Bacteria 7502
81 Ga0075368_10000383 3300006042 Bacteria 13025
82 Ga0075367_10009877 3300006178 Bacteria 4999
83 Ga0097621_100015498 3300006237 Bacteria 5737
84 Ga0068871_100009488 3300006358 Bacteria 7055
85 Ga0068871_100151094 3300006358 Bacteria 1980
86 Ga0075428_100031091 3300006844 Bacteria 5903
87 Ga0075428_100053461 3300006844 Bacteria 4425
88 Ga0075431_100267959 3300006847 Bacteria 1732
89 Ga0068865_100004472 3300006881 Bacteria 8433
90 Ga0075436_100013171 3300006914 Bacteria 5670
91 Ga0097620_100353139 3300006931 Bacteria 1565
92 Ga0099824_1002075 3300006942 Bacteria 29088
93 Ga0099822_1002298 3300006943 Bacteria 23651
94 Ga0075435_100448309 3300007076 Bacteria 1113
95 Ga0105240_10024980 3300009093 Bacteria 7864
96 Ga0111539_10014044 3300009094 Bacteria 10007
97 Ga0111539_10476025 3300009094 Bacteria 1454
98 Ga0105245_10127336 3300009098 Bacteria 2385
99 Ga0105247_10013502 3300009101 Bacteria 4898
100 Ga0114129_10455642 3300009147 Bacteria 1677
101 Ga0105243_10068107 3300009148 Bacteria 2868
102 Ga0105241_10062972 3300009174 Bacteria 2860
103 Ga0105242_10207713 3300009176 Bacteria 1743
104 Ga0105237_10333378 3300009545 Bacteria 1521
105 Ga0105239_10064136 3300010375 Bacteria 4033
106 Ga0105239_10227061 3300010375 Bacteria 2095
107 Ga0105239_10321088 3300010375 Bacteria 1746
108 Ga0157370_10000045 3300013104 Bacteria 127627
109 Ga0157370_10102572 3300013104 Bacteria 2678
110 Ga0157369_10164783 3300013105 Bacteria 2338
111 Ga0157374_10074256 3300013296 Bacteria 3211
112 Ga0157374_10107146 3300013296 Bacteria 2686
113 Ga0157374_10141839 3300013296 Bacteria 2333
114 Ga0157374_10176129 3300013296 Bacteria 2088
115 Ga0157374_10294662 3300013296 Bacteria 1604
116 Ga0157378_10053983 3300013297 Bacteria 3578
117 Ga0163162_10008551 3300013306 Bacteria 9979
118 Ga0163162_10130206 3300013306 Bacteria 2624
119 Ga0163162_10269201 3300013306 Bacteria 1835
120 Ga0163162_10350356 3300013306 Bacteria 1609
121 Ga0163162_10454114 3300013306 Bacteria 1413
122 Ga0157372_10036839 3300013307 Bacteria 5394
123 Ga0157372_10059461 3300013307 Bacteria 4275
124 Ga0157375_10007956 3300013308 Bacteria 9281
125 Ga0163163_10014280 3300014325 Bacteria 7299
126 Ga0157380_10015078 3300014326 Bacteria 5671
127 Ga0157379_10452328 3300014968 Unclassified 1186
128 Ga0157376_10001442 3300014969 Bacteria 15638
129 Ga0157376_10141768 3300014969 Bacteria 2157
130 Ga0182005_1000036 3300015265 Bacteria 166586
131 Ga0163161_10008698 3300017792 Bacteria 7021
132 Ga0163161_10203230 3300017792 Bacteria 1527
133 Ga0213876_10000053 3300021384 Bacteria 142404
134 Ga0209674_100270 3300025226 Bacteria 39854
135 Ga0209147_105065 3300025229 Bacteria 2044
136 Ga0209563_100178 3300025230 Bacteria 41597
137 Ga0207427_100650 3300025231 Bacteria 16837
138 Ga0209258_100714 3300025242 Bacteria 22241
139 Ga0209646_1000157 3300025246 Bacteria 94054
140 Ga0209026_1000328 3300025250 Bacteria 47719
141 Ga0209677_100405 3300025253 Bacteria 25877
142 Ga0209677_101568 3300025253 Bacteria 9707
143 Ga0209759_1000448 3300025256 Bacteria 47719
144 Ga0209759_1001026 3300025256 Bacteria 18741
145 Ga0209759_1005335 3300025256 Bacteria 4529
146 Ga0209759_1009355 3300025256 Bacteria 2966
147 Ga0209233_1004855 3300025261 Bacteria 4527
148 Ga0209455_1011301 3300025272 Bacteria 2207
149 Ga0209130_1000028 3300025284 Bacteria 325668
150 Ga0209676_1003188 3300025292 Bacteria 10410
151 Ga0209758_1000383 3300025297 Bacteria 76487
152 Ga0209758_1002558 3300025297 Bacteria 18310
153 Ga0209050_1018640 3300025298 Bacteria 2683
154 Ga0209256_1011806 3300025299 Bacteria 3439
155 Ga0207426_1000012 3300025302 Bacteria 730942
156 Ga0209051_1002507 3300025303 Bacteria 13042
157 Ga0209051_1016208 3300025303 Bacteria 3387
158 Ga0209257_1000074 3300025304 Bacteria 325641
159 Ga0209257_1004287 3300025304 Bacteria 11238
160 Ga0207710_10061166 3300025900 Bacteria 1708
161 Ga0207645_10024130 3300025907 Bacteria 3946
162 Ga0207705_10186222 3300025909 Bacteria 1568
163 Ga0207707_10043786 3300025912 Bacteria 3903
164 Ga0207707_10064395 3300025912 Bacteria 3191
165 Ga0207707_10217124 3300025912 Bacteria 1665
166 Ga0207707_10302894 3300025912 Bacteria 1382
167 Ga0207695_10038504 3300025913 Bacteria 5147
168 Ga0207695_10309529 3300025913 Bacteria 1470
169 Ga0207660_10324097 3300025917 Bacteria 1231
170 Ga0207657_10009860 3300025919 Bacteria 9566
171 Ga0207657_10070586 3300025919 Bacteria 2960
172 Ga0207652_10088129 3300025921 Bacteria 2722
173 Ga0207652_10093510 3300025921 Bacteria 2646
174 Ga0207652_10138280 3300025921 Bacteria 2176
175 Ga0207652_10325031 3300025921 Bacteria 1389
176 Ga0207646_10041621 3300025922 Bacteria 4129
177 Ga0207681_10098788 3300025923 Bacteria 2101
178 Ga0207694_10074201 3300025924 Bacteria 2663
179 Ga0207659_10284457 3300025926 Bacteria 1353
180 Ga0207687_10128752 3300025927 Bacteria 1905
181 Ga0207706_10029038 3300025933 Bacteria 4938
182 Ga0207706_10143857 3300025933 Bacteria 2098
183 Ga0207709_10290635 3300025935 Bacteria 1211
184 Ga0207669_10311575 3300025937 Bacteria 1201
185 Ga0207704_10062164 3300025938 Bacteria 2320
186 Ga0207689_10085674 3300025942 Bacteria 2590
187 Ga0207667_10036269 3300025949 Bacteria 5286
188 Ga0207667_10049853 3300025949 Bacteria 4419
189 Ga0207651_10003103 3300025960 Bacteria 8082
190 Ga0207640_10001829 3300025981 Bacteria 11415
191 Ga0207640_10268241 3300025981 Bacteria 1334
192 Ga0207658_10092677 3300025986 Bacteria 2347
193 Ga0207639_10138376 3300026041 Bacteria 2026
194 Ga0207702_10001082 3300026078 Bacteria 27904
195 Ga0207702_10220057 3300026078 Bacteria 1769
196 Ga0207641_10144089 3300026088 Bacteria 2153
197 Ga0207641_10369187 3300026088 Bacteria 1372
198 Ga0207641_10402898 3300026088 Bacteria 1314
199 Ga0207648_10044027 3300026089 Bacteria 3917
200 Ga0207674_10021844 3300026116 Bacteria 6886
201 Ga0207674_10174636 3300026116 Bacteria 2101
202 Ga0207675_100043493 3300026118 Bacteria 4194
203 Ga0207683_10007115 3300026121 Bacteria 9590
204 Ga0207683_10361530 3300026121 Bacteria 1333
205 Ga0209589_1000002 3300027357 Bacteria 708598
206 Ga0209489_100002 3300027361 Bacteria 708609
207 Ga0209700_100002 3300027363 Bacteria 708598
208 Ga0209813_10000569 3300027866 Bacteria 8660
209 Ga0268266_10087638 3300028379 Bacteria 2724
210 Ga0268265_10082448 3300028380 Bacteria 2543
211 Ga0265337_1002746 3300028556 Bacteria 7901
212 Ga0265319_1011863 3300028563 Bacteria 3546
213 Ga0265334_10001736 3300028573 Bacteria 10420
214 Ga0265318_10007109 3300028577 Bacteria 5091
215 Ga0265323_10000674 3300028653 Bacteria 18599
216 Ga0265322_10008191 3300028654 Bacteria 3047
217 Ga0265336_10000044 3300028666 Bacteria 131932
218 Ga0265336_10000389 3300028666 Bacteria 27626
219 Ga0265336_10022002 3300028666 Bacteria 2032
220 Ga0307515_10000434 3300028794 Bacteria 100265
221 Ga0307515_10015010 3300028794 Bacteria 14308
222 Ga0265338_10000176 3300028800 Bacteria 118726
223 Ga0265324_10001802 3300029957 Bacteria 11645
224 Ga0307511_10042710 3300030521 Bacteria 3802
225 Ga0265320_10079770 3300031240 Bacteria 1529
226 Ga0307513_10122083 3300031456 Bacteria 2569
227 Ga0265314_10218083 3300031711 Bacteria 1115
228 Ga0307405_10000004 3300031731 Bacteria 444977
229 Ga0307405_10037820 3300031731 Bacteria 2904
230 Ga0307410_10020584 3300031852 Bacteria 4038
231 Ga0307410_10124173 3300031852 Bacteria 1887
232 Ga0307406_10007529 3300031901 Bacteria 6043
233 Ga0307409_100000503 3300031995 Bacteria 16872
234 Ga0307409_100010866 3300031995 Bacteria 5697
235 Ga0307414_10003092 3300032004 Bacteria 8835
236 Ga0307414_10160269 3300032004 Bacteria 1786
237 Ga0307414_10199058 3300032004 Bacteria 1628
238 Ga0307414_10289665 3300032004 Bacteria 1380
239 Ga0307411_10001596 3300032005 Bacteria 9413
240 Ga0307411_10071953 3300032005 Bacteria 2346
241 Ga0307411_10161932 3300032005 Bacteria 1677
242 Ga0307415_100081569 3300032126 Bacteria 2311
243 Ga0315911_1000004 3300033442 Bacteria 472637
244 Ga0373936_0022737 3300035113 Bacteria 2441
245 Ga0373941_0066348 3300035115 Bacteria 1187
246 Ga0373960_0019855 3300035121 Bacteria 1770
247 Ga0373955_0108189 3300035172 Bacteria 1605
248 Ga0373942_0059788 3300035207 Bacteria 1090
249 Ga0373935_0005058 3300035692 Bacteria 7766
250 Ga0373927_0006512 3300035695 Bacteria 7955
251 Ga0373937_0536013 3300036401 Bacteria 1112
252 Ga0373925_0019029 3300037068 Bacteria 4992
253 Ga0395900_0008892 3300037418 Bacteria 10311
254 Ga0395900_0283833 3300037418 Bacteria 1647
255 Ga0395900_0323929 3300037418 Bacteria 1521
256 Ga0395900_0345191 3300037418 Bacteria 1463
257 Ga0395898_0012924 3300037466 Bacteria 8611
258 Ga0395898_0016659 3300037466 Bacteria 7513
259 Ga0395898_0118297 3300037466 Bacteria 2538
260 Ga0395905_0146473 3300037471 Bacteria 2222
261 Ga0395905_0164438 3300037471 Bacteria 2085
262 Ga0395901_0001189 3300038443 Bacteria 27686
263 Ga0436365_0873465 3300039437 Bacteria 246686
264 Ga0436365_1378994 3300039437 Bacteria 6271
265 Ga0436361_0459563 3300039447 Bacteria 4005
266 Ga0439436_0000351 3300041404 Bacteria 11403
267 Ga0450917_002238 3300042120 Bacteria 1382
268 Ga0450890_001541 3300042127 Bacteria 3312
269 Ga0450905_000403 3300042142 Bacteria 5251
270 Ga0450889_000202 3300042144 Bacteria 6492
271 Ga0466965_0017833 3300044683 Bacteria 3395
272 Ga0466968_0000341 3300044735 Bacteria 15110
273 Ga0466970_0082862 3300044765 Bacteria 1735
274 Ga0466957_0070908 3300044842 Bacteria 2154
275 Ga0466957_0088839 3300044842 Bacteria 1934
276 Ga0466967_0017525 3300045976 Bacteria 5690
277 Ga0495617_000393 3300046452 Bacteria 24194
278 Ga0495627_002272 3300046453 Bacteria 9485
279 Ga0495627_019566 3300046453 Bacteria 2268
280 Ga0495592_0010630 3300046454 Bacteria 6941
281 Ga0495590_0005374 3300046457 Bacteria 5084
282 Ga0495590_0008412 3300046457 Bacteria 3940
283 Ga0495638_0000141 3300046460 Bacteria 114543
284 Ga0495638_0010662 3300046460 Bacteria 6365
285 Ga0495638_0013056 3300046460 Bacteria 5670
286 Ga0495651_0019137 3300046462 Bacteria 5305
287 Ga0495653_0058987 3300046463 Bacteria 2915
288 Ga0495650_0082532 3300046471 Bacteria 1237
289 Ga0495580_0312275 3300046472 Bacteria 1069
290 Ga0495605_0002939 3300046474 Bacteria 10314
291 Ga0495605_0008068 3300046474 Bacteria 5959
292 Ga0495605_0093180 3300046474 Bacteria 1394
293 Ga0495664_0023979 3300046477 Bacteria 3543
294 Ga0495584_0000372 3300046491 Bacteria 30962
295 Ga0495584_0069245 3300046491 Bacteria 1773
296 Ga0495585_0003542 3300046492 Bacteria 10492
297 Ga0495607_0010733 3300046501 Bacteria 6136
298 Ga0495607_0028247 3300046501 Bacteria 3462
299 Ga0495607_0029382 3300046501 Bacteria 3383
300 Ga0495607_0036543 3300046501 Bacteria 2957
301 Ga0495607_0038622 3300046501 Bacteria 2858
302 Ga0495607_0048006 3300046501 Bacteria 2497
303 Ga0495607_0048941 3300046501 Bacteria 2468
304 Ga0495583_0000004 3300046506 Bacteria 655287
305 Ga0495583_0000005 3300046506 Bacteria 636894
306 Ga0495583_0000887 3300046506 Bacteria 35851
307 Ga0495583_0024579 3300046506 Bacteria 3024
308 Ga0495606_0008048 3300046507 Bacteria 9254
309 Ga0495606_0014145 3300046507 Bacteria 6247
310 Ga0495606_0056062 3300046507 Bacteria 2545
311 Ga0495608_0033123 3300046511 Bacteria 3495
312 Ga0495610_0003603 3300046512 Bacteria 11962
313 Ga0495610_0007883 3300046512 Bacteria 6999
314 Ga0495610_0026908 3300046512 Bacteria 3065
315 Ga0495616_0000548 3300046513 Bacteria 28338
316 Ga0495616_0012393 3300046513 Bacteria 4842
317 Ga0495616_0046416 3300046513 Bacteria 2192
318 Ga0495620_0000188 3300046515 Bacteria 47539
319 Ga0495620_0000209 3300046515 Bacteria 44042
320 Ga0495620_0004156 3300046515 Bacteria 8208
321 Ga0495628_0004111 3300046516 Bacteria 12948
322 Ga0495628_0397844 3300046516 Bacteria 1007
323 Ga0495630_0030875 3300046517 Bacteria 3988
324 Ga0495630_0043912 3300046517 Bacteria 3340
325 Ga0495631_0001903 3300046518 Bacteria 12300
326 Ga0495632_0000658 3300046519 Bacteria 31732
327 Ga0495632_0017430 3300046519 Bacteria 3964
328 Ga0495632_0097757 3300046519 Bacteria 1385
329 Ga0495637_0024351 3300046520 Bacteria 2739
330 Ga0495643_0008378 3300046522 Bacteria 6552
331 Ga0495644_0000665 3300046523 Bacteria 14332
332 Ga0495644_0001597 3300046523 Bacteria 9234
333 Ga0495648_0001624 3300046524 Bacteria 21826
334 Ga0495652_0006323 3300046529 Bacteria 11033
335 Ga0495654_0002031 3300046530 Bacteria 13308
336 Ga0495586_0015412 3300046535 Bacteria 4067
337 Ga0495587_0020341 3300046536 Bacteria 4098
338 Ga0495609_0000091 3300046538 Bacteria 106458
339 Ga0495609_0001693 3300046538 Bacteria 14307
340 Ga0495597_0001265 3300046542 Bacteria 18633
341 Ga0495597_0029566 3300046542 Bacteria 2501
342 Ga0495645_0010602 3300046543 Bacteria 6470
343 Ga0495633_0005466 3300046558 Bacteria 7749
344 Ga0495633_0095951 3300046558 Bacteria 1377
345 Ga0495667_0002970 3300046559 Bacteria 11368
346 Ga0495668_0002848 3300046616 Bacteria 13732
347 Ga0495668_0061132 3300046616 Bacteria 2078
348 Ga0495668_0071924 3300046616 Bacteria 1900
349 Ga0495611_0000489 3300046648 Bacteria 23665
350 Ga0495611_0005515 3300046648 Bacteria 5404
351 Ga0495611_0005646 3300046648 Bacteria 5335
352 Ga0495611_0047805 3300046648 Bacteria 1921
353 Ga0495625_0000364 3300046660 Bacteria 69279
354 Ga0495625_0003025 3300046660 Bacteria 17248
355 Ga0495625_0005074 3300046660 Bacteria 12187
356 Ga0495625_0020123 3300046660 Bacteria 5158
357 Ga0495625_0054900 3300046660 Bacteria 2843
358 Ga0495625_0069477 3300046660 Bacteria 2474
359 Ga0495625_0235756 3300046660 Bacteria 1193
360 Ga0495659_0000886 3300046664 Bacteria 10645
361 Ga0495661_0024536 3300046665 Bacteria 3903
362 Ga0495588_0000677 3300046674 Bacteria 15710
363 Ga0495588_0012096 3300046674 Bacteria 4069
364 Ga0495657_0101846 3300046675 Bacteria 1829
365 Ga0495599_0028023 3300046678 Bacteria 3529
366 Ga0495670_0000087 3300046691 Bacteria 41042
367 Ga0495670_0000186 3300046691 Bacteria 27523
368 Ga0495670_0003206 3300046691 Bacteria 8051
369 Ga0495670_0112832 3300046691 Bacteria 1408
370 Ga0495671_0000081 3300046692 Bacteria 92311
371 Ga0495671_0036236 3300046692 Bacteria 2499
372 Ga0495649_0001134 3300046694 Bacteria 20734
373 Ga0495649_0003333 3300046694 Bacteria 10905
374 Ga0495649_0014199 3300046694 Bacteria 4573
375 Ga0495600_0017993 3300046809 Bacteria 4499
376 Ga0495581_0051428 3300047315 Bacteria 2379
377 Ga0495604_0005582 3300047317 Bacteria 9975
378 Ga0495604_0088276 3300047317 Bacteria 2307
379 Ga0495636_0000298 3300047318 Bacteria 19496
380 Ga0495636_0017663 3300047318 Bacteria 2857
381 Ga0495674_0012640 3300047319 Bacteria 7955
382 Ga0495683_0006980 3300047323 Bacteria 6132
383 Ga0495683_0010586 3300047323 Bacteria 4866
384 Ga0495683_0017554 3300047323 Bacteria 3708
385 Ga0495683_0048445 3300047323 Bacteria 2131
386 Ga0495687_000090 3300047443 Bacteria 141153
387 Ga0495687_000487 3300047443 Bacteria 48069
388 Ga0495687_004985 3300047443 Bacteria 8678
389 Ga0495675_0000073 3300047444 Bacteria 69936
390 Ga0495675_0042186 3300047444 Bacteria 2906
391 Ga0495677_0019610 3300047445 Bacteria 2451
392 Ga0495685_000003 3300047447 Bacteria 119490
393 Ga0495681_0005808 3300047470 Bacteria 8199
394 Ga0495686_0000007 3300047472 Bacteria 732622
395 Ga0495686_0000157 3300047472 Bacteria 130757
396 Ga0495686_0011755 3300047472 Bacteria 6162
397 Ga0495686_0088834 3300047472 Bacteria 1878
398 Ga0495602_0009567 3300048088 Bacteria 10074
399 Ga0495626_0003776 3300048091 Bacteria 9530
400 Ga0495626_0064283 3300048091 Bacteria 1662
401 Ga0496100_0001386 3300048903 Bacteria 11878
402 Ga0496100_0125346 3300048903 Bacteria 1802
403 Ga0496101_0001729 3300048904 Bacteria 13091
404 Ga0496102_0050693 3300048905 Bacteria 3781
405 Ga0496102_0439844 3300048905 Bacteria 1224
406 Ga0496104_0001052 3300048907 Bacteria 23550
407 Ga0496104_0210382 3300048907 Bacteria 1856
408 Ga0496105_0025138 3300048908 Bacteria 4844
409 Ga0496105_0067534 3300048908 Bacteria 2952
410 Ga0496106_0003482 3300048909 Bacteria 11725
411 Ga0496106_0136799 3300048909 Bacteria 1925
412 Ga0496107_0000052 3300048910 Bacteria 62300
413 Ga0496107_0134857 3300048910 Bacteria 1824
414 Ga0496108_0001335 3300048911 Bacteria 19389
415 Ga0496109_0056066 3300048912 Bacteria 3596
416 Ga0496109_0132968 3300048912 Bacteria 2323
417 Ga0496110_0017016 3300048913 Bacteria 6078
418 Ga0496110_0027115 3300048913 Bacteria 4908
419 Ga0496110_0179253 3300048913 Bacteria 1924
420 Ga0496111_0030709 3300048914 Bacteria 3822
421 Ga0496112_0005318 3300048915 Bacteria 11111
422 Ga0496112_0011892 3300048915 Bacteria 7972
423 Ga0496112_0020375 3300048915 Bacteria 6286
424 Ga0496113_0032720 3300048916 Bacteria 3780
425 Ga0496117_0002935 3300048920 Bacteria 20638
426 Ga0496121_0001500 3300048924 Bacteria 39239
427 Ga0496121_0001744 3300048924 Bacteria 35548
428 Ga0496121_0039119 3300048924 Bacteria 4187
429 Ga0496121_0232251 3300048924 Bacteria 1291
430 Ga0496122_0000018 3300048925 Bacteria 426350
431 Ga0496122_0012600 3300048925 Bacteria 8393
432 Ga0496122_0237464 3300048925 Bacteria 1031
433 Ga0496123_0000015 3300048926 Bacteria 426088
434 Ga0496123_0003606 3300048926 Bacteria 17151
435 Ga0496124_0000245 3300048927 Bacteria 104910
436 Ga0496124_0001259 3300048927 Bacteria 38660
437 Ga0496125_0000189 3300048928 Bacteria 133541
438 Ga0496126_0007571 3300048929 Bacteria 11868
439 Ga0496126_0017349 3300048929 Bacteria 7175
440 Ga0496126_0195854 3300048929 Bacteria 1709
441 Ga0496126_0425831 3300048929 Bacteria 1072
442 Ga0495678_000059 3300049459 Bacteria 143694
443 Ga0495678_000861 3300049459 Bacteria 27005
444 Ga0495678_010452 3300049459 Bacteria 4512
445 Ga0495682_0000061 3300049460 Bacteria 101034
446 Ga0495682_0000250 3300049460 Bacteria 42369
447 Ga0495682_0001842 3300049460 Bacteria 10643
448 Ga0501032_0029147 3300049569 Bacteria 3790
449 Ga0501033_0134726 3300049570 Bacteria 1787
450 Ga0501034_0058958 3300049571 Bacteria 3856
451 Ga0501034_0432051 3300049571 Bacteria 1236
452 Ga0501036_0006676 3300049572 Bacteria 9377
453 Ga0501037_0015667 3300049573 Bacteria 5579
454 Ga0501037_0178468 3300049573 Bacteria 1508
455 Ga0501038_0005375 3300049574 Bacteria 11897
456 Ga0501038_0020373 3300049574 Bacteria 5962
457 Ga0501038_0078059 3300049574 Bacteria 2795
458 Ga0501039_0047863 3300049575 Bacteria 3305
459 Ga0501043_0149742 3300049579 Bacteria 1826
460 Ga0501043_0332128 3300049579 Bacteria 1157
461 Ga0501046_0025075 3300049580 Bacteria 4884
462 Ga0501046_0086856 3300049580 Bacteria 2411
463 Ga0501047_0217453 3300049581 Bacteria 1767
464 Ga0501048_0043503 3300049582 Bacteria 3214
465 Ga0501070_0041108 3300049586 Bacteria 3852
466 Ga0501073_0011183 3300049589 Bacteria 6563
467 Ga0501073_0018099 3300049589 Bacteria 5095
468 Ga0501073_0324692 3300049589 Bacteria 1062
469 Ga0501080_0005213 3300049742 Bacteria 11582
470 Ga0501083_0032239 3300049744 Bacteria 3595
471 Ga0501035_0065903 3300049822 Bacteria 3214
472 Ga0501044_0000340 3300049823 Bacteria 59157
473 Ga0501044_0036207 3300049823 Bacteria 5163
474 Ga0501044_0097695 3300049823 Bacteria 2957
475 Ga0501045_0312079 3300049824 Bacteria 1170
476 nmdc:mga0k408_131232_c1 3300050493 Bacteria 1487
477 nmdc:mga0k408_198273_c1 3300050493 Bacteria 1198
478 nmdc:mga06z11_1708_c1 3300050494 Bacteria 8248
479 nmdc:mga06z11_6147_c1 3300050494 Bacteria 4862
480 nmdc:mga04h51_390_c1 3300050495 Bacteria 10679
481 nmdc:mga07m45_13464_c1 3300050496 Bacteria 4341
482 nmdc:mga05p37_389870_c1 3300050507 Bacteria 1629
483 nmdc:mga0qj67_11364_c1 3300050509 Bacteria 6670
484 nmdc:mga06r32_256880_c1 3300050510 Bacteria 1735
485 nmdc:mga0rr50_288202_c1 3300050513 Bacteria 1371
486 nmdc:mga0sz30_13910_c1 3300050516 Bacteria 3159
487 Ga0500610_0016599 3300053079 Bacteria 3515
488 Ga0500610_0057489 3300053079 Bacteria 2030
489 Ga0495619_0101901 3300053085 Bacteria 1955
490 Ga0500578_0001680 3300053086 Bacteria 21263
491 Ga0500578_0056836 3300053086 Bacteria 2502
492 Ga0500643_010904 3300053087 Bacteria 3353
493 Ga0500646_0002568 3300053090 Bacteria 4710
494 Ga0500583_0013830 3300053092 Bacteria 3137
495 Ga0500583_0126654 3300053092 Bacteria 1265
496 Ga0500641_0001269 3300053096 Bacteria 8966
497 Ga0500555_000860 3300053103 Bacteria 10814
498 Ga0500557_040138 3300053105 Bacteria 1464
499 Ga0500562_013719 3300053108 Bacteria 2072
500 Ga0500594_0001044 3300053118 Bacteria 5931
501 Ga0500595_001037 3300053119 Bacteria 15477
502 Ga0500595_006621 3300053119 Bacteria 4892
503 Ga0500608_065445 3300053122 Bacteria 1734
504 Ga0500618_000315 3300053125 Bacteria 35779
505 Ga0500618_000372 3300053125 Bacteria 31040
506 Ga0500652_004117 3300053131 Bacteria 4465
507 Ga0500561_0005941 3300053137 Bacteria 2301
508 Ga0500568_0000042 3300053139 Bacteria 127026
509 Ga0500568_0001475 3300053139 Bacteria 15068
510 Ga0500574_000078 3300053141 Bacteria 10976
511 Ga0500616_0003001 3300053153 Bacteria 13320
512 Ga0500619_010183 3300053154 Bacteria 2367
513 Ga0500622_0066285 3300053156 Bacteria 1833
514 Ga0500624_000360 3300053157 Bacteria 14769
515 Ga0500627_0052626 3300053158 Bacteria 1778
516 Ga0500634_0017114 3300053161 Bacteria 3878
517 Ga0500634_0048246 3300053161 Bacteria 2298
518 Ga0500634_0102784 3300053161 Bacteria 1427
519 Ga0500638_000313 3300053162 Bacteria 10986
520 Ga0500636_0019640 3300053177 Bacteria 3996
521 Ga0500636_0022196 3300053177 Bacteria 3755
522 Ga0500567_015383 3300053723 Bacteria 3687
523 Ga0500609_001438 3300053731 Bacteria 3484
524 Ga0501082_0149022 3300060353 Bacteria 2032

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0237464 Ga0496122_0237464_210_1013 255
2 3300025981 Ga0207640_10268241 Ga0207640_102682412 256
3 3300049589 Ga0501073_0324692 Ga0501073_0324692_261_1034 256
4 3300025937 Ga0207669_10311575 Ga0207669_103115752 262
5 3300013307 Ga0157372_10036839 Ga0157372_100368391 264
6 3300037418 Ga0395900_0323929 Ga0395900_0323929_687_1508 264
7 3300047319 Ga0495674_0012640 Ga0495674_0012640_5774_6643 283
8 3300006942 Ga0099824_1002075 Ga0099824_10020754 286
9 3300006943 Ga0099822_1002298 Ga0099822_100229817 286
10 3300027357 Ga0209589_1000002 Ga0209589_100000218 286
11 3300027361 Ga0209489_100002 Ga0209489_10000218 286
12 3300027363 Ga0209700_100002 Ga0209700_10000218 286
13 3300033442 Ga0315911_1000004 Ga0315911_1000004340 289
14 3300048929 Ga0496126_0425831 Ga0496126_0425831_68_1018 291
15 3300026041 Ga0207639_10138376 Ga0207639_101383761 293
16 3300046691 Ga0495670_0003206 Ga0495670_0003206_3770_4729 293
17 3300049586 Ga0501070_0041108 Ga0501070_0041108_2884_3831 293
18 3300049589 Ga0501073_0011183 Ga0501073_0011183_5274_6221 293
19 3300053177 Ga0500636_0019640 Ga0500636_0019640_30_917 293
20 3300053096 Ga0500641_0001269 Ga0500641_0001269_2115_3065 294
21 3300013296 Ga0157374_10074256 Ga0157374_100742561 295
22 3300005343 Ga0070687_100048167 Ga0070687_1000481671 296
23 3300005549 Ga0070704_100041136 Ga0070704_1000411364 296
24 3300025229 Ga0209147_105065 Ga0209147_1050652 296
25 3300048920 Ga0496117_0002935 Ga0496117_0002935_17480_18838 296
26 3300048912 Ga0496109_0132968 Ga0496109_0132968_1403_2302 298
27 3300005438 Ga0070701_10219930 Ga0070701_102199301 299
28 3300005548 Ga0070665_100141382 Ga0070665_1001413823 299
29 3300005617 Ga0068859_100353174 Ga0068859_1003531742 299
30 3300005843 Ga0068860_100067683 Ga0068860_1000676833 299
31 3300006042 Ga0075368_10000383 Ga0075368_100003839 299
32 3300006178 Ga0075367_10009877 Ga0075367_100098774 299
33 3300006931 Ga0097620_100353139 Ga0097620_1003531392 299
34 3300013104 Ga0157370_10102572 Ga0157370_101025722 299
35 3300027866 Ga0209813_10000569 Ga0209813_100005699 299
36 3300028379 Ga0268266_10087638 Ga0268266_100876384 299
37 3300028380 Ga0268265_10082448 Ga0268265_100824483 299
38 3300046675 Ga0495657_0101846 Ga0495657_0101846_622_1524 299
39 3300050494 nmdc:mga06z11_1708_c1 nmdc:mga06z11_1708_c1_2300_3247 299
40 3300050495 nmdc:mga04h51_390_c1 nmdc:mga04h51_390_c1_2939_3886 299
41 3300005366 Ga0070659_100288740 Ga0070659_1002887402 300
42 3300009545 Ga0105237_10333378 Ga0105237_103333781 300
43 3300010375 Ga0105239_10227061 Ga0105239_102270612 300
44 3300013296 Ga0157374_10176129 Ga0157374_101761292 300
45 3300013306 Ga0163162_10269201 Ga0163162_102692013 300
46 3300026078 Ga0207702_10220057 Ga0207702_102200572 300
47 3300048903 Ga0496100_0125346 Ga0496100_0125346_694_1644 300
48 3300048905 Ga0496102_0050693 Ga0496102_0050693_2046_2996 300
49 3300048907 Ga0496104_0210382 Ga0496104_0210382_411_1361 300
50 3300048912 Ga0496109_0056066 Ga0496109_0056066_945_1895 300
51 3300048913 Ga0496110_0017016 Ga0496110_0017016_1132_2082 300
52 3300048915 Ga0496112_0005318 Ga0496112_0005318_474_1424 300
53 3300048916 Ga0496113_0032720 Ga0496113_0032720_2423_3373 300
54 3300025921 Ga0207652_10138280 Ga0207652_101382802 301
55 3300048908 Ga0496105_0067534 Ga0496105_0067534_1962_2912 301
56 3300006844 Ga0075428_100031091 Ga0075428_1000310912 302
57 3300009147 Ga0114129_10455642 Ga0114129_104556421 302
58 3300046535 Ga0495586_0015412 Ga0495586_0015412_446_1363 302
59 3300050507 nmdc:mga05p37_389870_c1 nmdc:mga05p37_389870_c1_88_1035 302
60 iso_pu_bacteria 2593339239 2595450237 302
61 iso_pu_bacteria 2842914999 2842917865 302
62 iso_pu_bacteria 2919085039 2919086079 302
63 3300046516 Ga0495628_0397844 Ga0495628_0397844_38_955 304
64 iso_pu_bacteria 2721755702 2723642646 304
65 iso_pu_bacteria 2935409751 2935413196 304
66 3300010375 Ga0105239_10321088 Ga0105239_103210882 306
67 3300013104 Ga0157370_10000045 Ga0157370_100000452 306
68 3300015265 Ga0182005_1000036 Ga0182005_100003647 306
69 3300017792 Ga0163161_10008698 Ga0163161_100086984 306
70 3300025299 Ga0209256_1011806 Ga0209256_10118063 306
71 3300025303 Ga0209051_1016208 Ga0209051_10162083 306
72 3300044735 Ga0466968_0000341 Ga0466968_0000341_4290_5267 306
73 3300046452 Ga0495617_000393 Ga0495617_000393_14360_15340 306
74 3300046457 Ga0495590_0005374 Ga0495590_0005374_305_1285 306
75 3300046460 Ga0495638_0013056 Ga0495638_0013056_3730_4710 306
76 3300046474 Ga0495605_0008068 Ga0495605_0008068_332_1312 306
77 3300046491 Ga0495584_0000372 Ga0495584_0000372_8029_9009 306
78 3300046501 Ga0495607_0010733 Ga0495607_0010733_490_1470 306
79 3300046501 Ga0495607_0036543 Ga0495607_0036543_1588_2568 306
80 3300046501 Ga0495607_0048006 Ga0495607_0048006_834_1814 306
81 3300046506 Ga0495583_0000004 Ga0495583_0000004_521852_522832 306
82 3300046512 Ga0495610_0026908 Ga0495610_0026908_1447_2427 306
83 3300046513 Ga0495616_0012393 Ga0495616_0012393_3209_4189 306
84 3300046513 Ga0495616_0046416 Ga0495616_0046416_927_1907 306
85 3300046523 Ga0495644_0000665 Ga0495644_0000665_4207_5187 306
86 3300046523 Ga0495644_0001597 Ga0495644_0001597_2600_3580 306
87 3300046524 Ga0495648_0001624 Ga0495648_0001624_15981_16961 306
88 3300046538 Ga0495609_0001693 Ga0495609_0001693_9516_10496 306
89 3300046558 Ga0495633_0005466 Ga0495633_0005466_2466_3446 306
90 3300046558 Ga0495633_0095951 Ga0495633_0095951_337_1317 306
91 3300046648 Ga0495611_0005515 Ga0495611_0005515_515_1495 306
92 3300046648 Ga0495611_0005646 Ga0495611_0005646_3840_4820 306
93 3300046660 Ga0495625_0054900 Ga0495625_0054900_903_1883 306
94 3300046660 Ga0495625_0235756 Ga0495625_0235756_103_1083 306
95 3300046664 Ga0495659_0000886 Ga0495659_0000886_5788_6768 306
96 3300046665 Ga0495661_0024536 Ga0495661_0024536_2859_3839 306
97 3300046691 Ga0495670_0000186 Ga0495670_0000186_23577_24557 306
98 3300046692 Ga0495671_0036236 Ga0495671_0036236_1408_2388 306
99 3300047318 Ga0495636_0000298 Ga0495636_0000298_16696_17676 306
100 3300047323 Ga0495683_0006980 Ga0495683_0006980_3804_4784 306
101 3300047443 Ga0495687_000487 Ga0495687_000487_16757_17737 306
102 3300047445 Ga0495677_0019610 Ga0495677_0019610_957_1937 306
103 3300047447 Ga0495685_000003 Ga0495685_000003_102616_103596 306
104 3300048903 Ga0496100_0001386 Ga0496100_0001386_5089_6069 306
105 3300048904 Ga0496101_0001729 Ga0496101_0001729_4654_5634 306
106 3300048910 Ga0496107_0134857 Ga0496107_0134857_254_1234 306
107 3300048924 Ga0496121_0001500 Ga0496121_0001500_3611_4591 306
108 3300048925 Ga0496122_0012600 Ga0496122_0012600_690_1670 306
109 3300048926 Ga0496123_0003606 Ga0496123_0003606_4564_5544 306
110 3300048927 Ga0496124_0000245 Ga0496124_0000245_69199_70194 306
111 3300048927 Ga0496124_0001259 Ga0496124_0001259_4495_5475 306
112 3300049459 Ga0495678_000861 Ga0495678_000861_12099_13079 306
113 3300049460 Ga0495682_0000061 Ga0495682_0000061_10626_11606 306
114 3300049460 Ga0495682_0000250 Ga0495682_0000250_23969_24949 306
115 3300014968 Ga0157379_10452328 Ga0157379_104523281 307
116 3300048909 Ga0496106_0136799 Ga0496106_0136799_466_1416 307
117 3300048924 Ga0496121_0039119 Ga0496121_0039119_2129_3079 307
118 3300048929 Ga0496126_0195854 Ga0496126_0195854_291_1241 307
119 iso_pu_bacteria 2582581280 2585154428 307
120 iso_pu_bacteria 2582581293 2585197909 307
121 iso_pu_bacteria 2643221552 2643779719 307
122 iso_pu_bacteria 2643221584 2643927712 307
123 iso_pu_bacteria 2818991435 2819535788 307
124 iso_pu_bacteria 2818991454 2819645102 307
125 3300049823 Ga0501044_0000340 Ga0501044_0000340_17052_17981 308
126 iso_pu_bacteria 2791355048 2792459420 308
127 iso_pu_bacteria 2843744320 2843744651 308
128 iso_pu_bacteria 2851153111 2851154386 308
129 3300005336 Ga0070680_100379728 Ga0070680_1003797281 309
130 3300005457 Ga0070662_100065375 Ga0070662_1000653752 309
131 3300005530 Ga0070679_100111658 Ga0070679_1001116582 309
132 3300005539 Ga0068853_100030535 Ga0068853_1000305353 309
133 3300005545 Ga0070695_100031858 Ga0070695_1000318584 309
134 3300005546 Ga0070696_100005524 Ga0070696_1000055245 309
135 3300005563 Ga0068855_100343224 Ga0068855_1003432242 309
136 3300009094 Ga0111539_10014044 Ga0111539_1001404410 309
137 3300013296 Ga0157374_10294662 Ga0157374_102946622 309
138 3300025912 Ga0207707_10217124 Ga0207707_102171242 309
139 3300025917 Ga0207660_10324097 Ga0207660_103240971 309
140 3300025921 Ga0207652_10093510 Ga0207652_100935102 309
141 3300025933 Ga0207706_10029038 Ga0207706_100290382 309
142 3300031852 Ga0307410_10020584 Ga0307410_100205843 309
143 3300031995 Ga0307409_100000503 Ga0307409_10000050310 309
144 3300032004 Ga0307414_10003092 Ga0307414_100030925 309
145 3300032005 Ga0307411_10001596 Ga0307411_1000159610 309
146 3300032126 Ga0307415_100081569 Ga0307415_1000815693 309
147 3300042120 Ga0450917_002238 Ga0450917_002238_149_1102 309
148 3300042127 Ga0450890_001541 Ga0450890_001541_1531_2484 309
149 3300042142 Ga0450905_000403 Ga0450905_000403_2693_3646 309
150 3300042144 Ga0450889_000202 Ga0450889_000202_4370_5323 309
151 3300047472 Ga0495686_0000007 Ga0495686_0000007_389912_390844 309
152 iso_pu_bacteria 2643221614 2644088089 309
153 iso_pu_bacteria 2643221661 2644343327 309
154 iso_pu_bacteria 2643221666 2644369196 309
155 iso_pu_bacteria 2965320100 2965321353 309
156 3300049571 Ga0501034_0058958 Ga0501034_0058958_1323_2258 310
157 3300049573 Ga0501037_0178468 Ga0501037_0178468_15_950 310
158 3300049574 Ga0501038_0020373 Ga0501038_0020373_127_1062 310
159 3300049579 Ga0501043_0149742 Ga0501043_0149742_106_1041 310
160 3300049580 Ga0501046_0086856 Ga0501046_0086856_1018_1953 310
161 3300049589 Ga0501073_0018099 Ga0501073_0018099_2174_3109 310
162 3300049742 Ga0501080_0005213 Ga0501080_0005213_2275_3210 310
163 3300049744 Ga0501083_0032239 Ga0501083_0032239_1641_2576 310
164 3300053119 Ga0500595_006621 Ga0500595_006621_1944_2879 310
165 3300060353 Ga0501082_0149022 Ga0501082_0149022_994_1929 310
166 iso_pu_bacteria 2508501050 2508732706 310
167 iso_pu_bacteria 2508501114 2509078619 310
168 iso_pu_bacteria 2510461069 2510841469 310
169 iso_pu_bacteria 2510917022 2511133956 310
170 iso_pu_bacteria 2513237096 2513655794 310
171 iso_pu_bacteria 2513237137 2513856710 310
172 iso_pu_bacteria 2513237145 2513917293 310
173 iso_pu_bacteria 2517572143 2517895424 310
174 iso_pu_bacteria 2582581299 2585231640 310
175 iso_pu_bacteria 2582581307 2585273545 310
176 iso_pu_bacteria 2582581307 2585275949 310
177 iso_pu_bacteria 2582581308 2585282173 310
178 iso_pu_bacteria 2582581316 2585334666 310
179 iso_pu_bacteria 2582581867 2585399220 310
180 iso_pu_bacteria 2585427527 2585534475 310
181 iso_pu_bacteria 2585427528 2585542838 310
182 iso_pu_bacteria 2585427530 2585557904 310
183 iso_pu_bacteria 2585427531 2585559718 310
184 iso_pu_bacteria 2585427531 2585564225 310
185 iso_pu_bacteria 2585427593 2585841220 310
186 iso_pu_bacteria 2585427594 2585847048 310
187 iso_pu_bacteria 2585427608 2585900409 310
188 iso_pu_bacteria 2585427608 2585900987 310
189 iso_pu_bacteria 2585427609 2585906103 310
190 iso_pu_bacteria 2585427609 2585908877 310
191 iso_pu_bacteria 2585427633 2585998499 310
192 iso_pu_bacteria 2585428125 2587978782 310
193 iso_pu_bacteria 2585428125 2587984201 310
194 iso_pu_bacteria 2667528175 2671122100 310
195 iso_pu_bacteria 2687453129 2687580013 310
196 iso_pu_bacteria 2728368998 2728754422 310
197 iso_pu_bacteria 2775506901 2776259210 310
198 iso_pu_bacteria 2791355197 2793069399 310
199 iso_pu_bacteria 2835312727 2835313679 310
200 iso_pu_bacteria 2842509118 2842513080 310
201 iso_pu_bacteria 2894232714 2894232814 310
202 iso_pu_bacteria 2904690495 2904698768 310
203 iso_pu_bacteria 2906610324 2906615964 310
204 iso_pu_bacteria 2906635258 2906639054 310
205 iso_pu_bacteria 2906660503 2906662102 310
206 iso_pu_bacteria 2908739725 2908740973 310
207 iso_pu_bacteria 2908756301 2908759281 310
208 iso_pu_bacteria 2909042592 2909042612 310
209 iso_pu_bacteria 2919171160 2919172411 310
210 iso_pu_bacteria 2922425934 2922432070 310
211 iso_pu_bacteria 2935630451 2935631054 310
212 iso_pu_bacteria 2941507105 2941507706 310
213 iso_pu_bacteria 2941515067 2941516133 310
214 iso_pu_bacteria 2941523033 2941523159 310
215 iso_pu_bacteria 3005474847 3005476907 310
216 iso_pu_bacteria 8019555841 8019564170 310
217 iso_pu_bacteria 8046767195 8046769680 310
218 iso_pu_bacteria 8057575449 8057582350 310
219 3300003322 rootL2_10261344 rootL2_102613441 311
220 3300005336 Ga0070680_100128625 Ga0070680_1001286251 311
221 3300025297 Ga0209758_1002558 Ga0209758_10025589 311
222 3300025298 Ga0209050_1018640 Ga0209050_10186401 311
223 3300025304 Ga0209257_1000074 Ga0209257_1000074281 311
224 3300025912 Ga0207707_10043786 Ga0207707_100437862 311
225 3300025912 Ga0207707_10064395 Ga0207707_100643952 311
226 3300035115 Ga0373941_0066348 Ga0373941_0066348_228_1172 311
227 3300035121 Ga0373960_0019855 Ga0373960_0019855_692_1636 311
228 3300039437 Ga0436365_1378994 Ga0436365_1378994_897_1844 311
229 3300046460 Ga0495638_0010662 Ga0495638_0010662_1685_2623 311
230 3300046506 Ga0495583_0000005 Ga0495583_0000005_611819_612757 311
231 3300046513 Ga0495616_0000548 Ga0495616_0000548_2847_3785 311
232 3300046519 Ga0495632_0000658 Ga0495632_0000658_30124_31062 311
233 3300046616 Ga0495668_0002848 Ga0495668_0002848_6427_7365 311
234 3300047323 Ga0495683_0010586 Ga0495683_0010586_1595_2533 311
235 3300047472 Ga0495686_0011755 Ga0495686_0011755_5130_6068 311
236 3300053731 Ga0500609_001438 Ga0500609_001438_2421_3359 311
237 3300005330 Ga0070690_100041586 Ga0070690_1000415862 312
238 3300005336 Ga0070680_100094661 Ga0070680_1000946612 312
239 3300005337 Ga0070682_100131430 Ga0070682_1001314302 312
240 3300005347 Ga0070668_100066896 Ga0070668_1000668962 312
241 3300005353 Ga0070669_100304505 Ga0070669_1003045052 312
242 3300005364 Ga0070673_100244950 Ga0070673_1002449502 312
243 3300005367 Ga0070667_100122220 Ga0070667_1001222202 312
244 3300005456 Ga0070678_100056996 Ga0070678_1000569961 312
245 3300005459 Ga0068867_100078952 Ga0068867_1000789522 312
246 3300005544 Ga0070686_100215106 Ga0070686_1002151062 312
247 3300005547 Ga0070693_100063193 Ga0070693_1000631932 312
248 3300005563 Ga0068855_100052341 Ga0068855_1000523412 312
249 3300005614 Ga0068856_100086516 Ga0068856_1000865162 312
250 3300005618 Ga0068864_100256794 Ga0068864_1002567941 312
251 3300006237 Ga0097621_100015498 Ga0097621_1000154982 312
252 3300006358 Ga0068871_100009488 Ga0068871_1000094885 312
253 3300006358 Ga0068871_100151094 Ga0068871_1001510942 312
254 3300006881 Ga0068865_100004472 Ga0068865_1000044725 312
255 3300013296 Ga0157374_10107146 Ga0157374_101071463 312
256 3300013306 Ga0163162_10008551 Ga0163162_100085516 312
257 3300013306 Ga0163162_10130206 Ga0163162_101302062 312
258 3300013306 Ga0163162_10454114 Ga0163162_104541141 312
259 3300013307 Ga0157372_10059461 Ga0157372_100594614 312
260 3300013308 Ga0157375_10007956 Ga0157375_100079567 312
261 3300014969 Ga0157376_10001442 Ga0157376_1000144214 312
262 3300014969 Ga0157376_10141768 Ga0157376_101417682 312
263 3300017792 Ga0163161_10203230 Ga0163161_102032302 312
264 3300025921 Ga0207652_10088129 Ga0207652_100881292 312
265 3300025926 Ga0207659_10284457 Ga0207659_102844572 312
266 3300025933 Ga0207706_10143857 Ga0207706_101438572 312
267 3300025938 Ga0207704_10062164 Ga0207704_100621642 312
268 3300025986 Ga0207658_10092677 Ga0207658_100926772 312
269 3300026088 Ga0207641_10144089 Ga0207641_101440892 312
270 3300026088 Ga0207641_10369187 Ga0207641_103691871 312
271 3300026089 Ga0207648_10044027 Ga0207648_100440273 312
272 3300026121 Ga0207683_10007115 Ga0207683_100071157 312
273 3300026121 Ga0207683_10361530 Ga0207683_103615302 312
274 3300030521 Ga0307511_10042710 Ga0307511_100427103 312
275 3300035113 Ga0373936_0022737 Ga0373936_0022737_345_1292 312
276 3300035172 Ga0373955_0108189 Ga0373955_0108189_415_1365 312
277 3300035692 Ga0373935_0005058 Ga0373935_0005058_2920_3867 312
278 3300035695 Ga0373927_0006512 Ga0373927_0006512_3607_4554 312
279 3300036401 Ga0373937_0536013 Ga0373937_0536013_107_1051 312
280 3300037068 Ga0373925_0019029 Ga0373925_0019029_3538_4485 312
281 3300039447 Ga0436361_0459563 Ga0436361_0459563_289_1230 312
282 3300046472 Ga0495580_0312275 Ga0495580_0312275_105_1055 312
283 3300046474 Ga0495605_0002939 Ga0495605_0002939_4812_5756 312
284 3300046506 Ga0495583_0024579 Ga0495583_0024579_503_1447 312
285 3300046512 Ga0495610_0003603 Ga0495610_0003603_755_1699 312
286 3300046518 Ga0495631_0001903 Ga0495631_0001903_5257_6201 312
287 3300046519 Ga0495632_0017430 Ga0495632_0017430_584_1528 312
288 3300046616 Ga0495668_0061132 Ga0495668_0061132_473_1417 312
289 3300046660 Ga0495625_0003025 Ga0495625_0003025_4881_5825 312
290 3300046660 Ga0495625_0005074 Ga0495625_0005074_3207_4148 312
291 3300047315 Ga0495581_0051428 Ga0495581_0051428_1021_1971 312
292 3300047472 Ga0495686_0088834 Ga0495686_0088834_870_1814 312
293 3300048909 Ga0496106_0003482 Ga0496106_0003482_281_1222 312
294 3300048910 Ga0496107_0000052 Ga0496107_0000052_1568_2509 312
295 3300048913 Ga0496110_0179253 Ga0496110_0179253_628_1569 312
296 3300048924 Ga0496121_0001744 Ga0496121_0001744_11106_12047 312
297 3300049569 Ga0501032_0029147 Ga0501032_0029147_2237_3184 312
298 3300049570 Ga0501033_0134726 Ga0501033_0134726_607_1554 312
299 3300049571 Ga0501034_0432051 Ga0501034_0432051_211_1158 312
300 3300049572 Ga0501036_0006676 Ga0501036_0006676_7049_7996 312
301 3300049573 Ga0501037_0015667 Ga0501037_0015667_2346_3293 312
302 3300049574 Ga0501038_0005375 Ga0501038_0005375_9175_10122 312
303 3300049575 Ga0501039_0047863 Ga0501039_0047863_1233_2180 312
304 3300049579 Ga0501043_0332128 Ga0501043_0332128_33_980 312
305 3300049580 Ga0501046_0025075 Ga0501046_0025075_2143_3090 312
306 3300049581 Ga0501047_0217453 Ga0501047_0217453_466_1413 312
307 3300049582 Ga0501048_0043503 Ga0501048_0043503_1958_2905 312
308 3300049822 Ga0501035_0065903 Ga0501035_0065903_1132_2079 312
309 3300049823 Ga0501044_0097695 Ga0501044_0097695_1932_2879 312
310 3300049824 Ga0501045_0312079 Ga0501045_0312079_206_1153 312
311 3300050493 nmdc:mga0k408_131232_c1 nmdc:mga0k408_131232_c1_18_1016 312
312 3300050493 nmdc:mga0k408_198273_c1 nmdc:mga0k408_198273_c1_151_1110 312
313 3300053079 Ga0500610_0016599 Ga0500610_0016599_464_1408 312
314 3300053085 Ga0495619_0101901 Ga0495619_0101901_658_1608 312
315 3300053090 Ga0500646_0002568 Ga0500646_0002568_1797_2777 312
316 3300053092 Ga0500583_0013830 Ga0500583_0013830_73_1053 312
317 3300053092 Ga0500583_0126654 Ga0500583_0126654_101_1045 312
318 3300053118 Ga0500594_0001044 Ga0500594_0001044_4581_5525 312
319 3300053161 Ga0500634_0102784 Ga0500634_0102784_94_1038 312
320 3300003320 rootH2_10005184 rootH2_1000518414 313
321 3300005548 Ga0070665_100362646 Ga0070665_1003626462 313
322 3300005577 Ga0068857_100123427 Ga0068857_1001234272 313
323 3300009094 Ga0111539_10476025 Ga0111539_104760251 313
324 3300009174 Ga0105241_10062972 Ga0105241_100629723 313
325 3300013306 Ga0163162_10350356 Ga0163162_103503561 313
326 3300025913 Ga0207695_10309529 Ga0207695_103095292 313
327 3300046507 Ga0495606_0008048 Ga0495606_0008048_2878_3825 313
328 3300046512 Ga0495610_0007883 Ga0495610_0007883_3448_4452 313
329 3300049574 Ga0501038_0078059 Ga0501038_0078059_97_1041 313
330 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00008010 314
331 2162886007 SwRhRL2b_contig_938321 SwRhRL2b_0799.00009110 314
332 3300001979 JGI24740J21852_10030582 JGI24740J21852_100305822 314
333 3300002738 JGI25154J39366_1000717 JGI25154J39366_10007177 314
334 3300002741 JGI25157J39369_1000235 JGI25157J39369_100023521 314
335 3300002987 JGI25159J45721_1000653 JGI25159J45721_100065310 314
336 3300003316 rootH1_10036229 rootH1_100362292 314
337 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012232 314
338 3300003354 JGI25160J50197_1000116 JGI25160J50197_100011666 314
339 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002384 314
340 3300003752 Ga0055539_1000558 Ga0055539_10005583 314
341 3300003752 Ga0055539_1006577 Ga0055539_10065771 314
342 3300003756 Ga0055533_1000221 Ga0055533_100022121 314
343 3300003794 Ga0055531_10002117 Ga0055531_1000211713 314
344 3300004625 Ga0055543_1000011 Ga0055543_1000011137 314
345 3300005262 Ga0065165_1000082 Ga0065165_1000082101 314
346 3300005289 Ga0065704_10070132 Ga0065704_100701321538 314
347 3300005289 Ga0065704_10072323 Ga0065704_100723232 314
348 3300005327 Ga0070658_10035828 Ga0070658_100358282 314
349 3300005327 Ga0070658_10208231 Ga0070658_102082311 314
350 3300005327 Ga0070658_10246362 Ga0070658_102463622 314
351 3300005328 Ga0070676_10009808 Ga0070676_100098084 314
352 3300005334 Ga0068869_100009844 Ga0068869_1000098443 314
353 3300005339 Ga0070660_100004122 Ga0070660_1000041229 314
354 3300005347 Ga0070668_100093620 Ga0070668_1000936202 314
355 3300005364 Ga0070673_100046996 Ga0070673_1000469963 314
356 3300005366 Ga0070659_100015584 Ga0070659_1000155842 314
357 3300005406 Ga0070703_10091846 Ga0070703_100918461 314
358 3300005444 Ga0070694_100223060 Ga0070694_1002230601 314
359 3300005518 Ga0070699_100100239 Ga0070699_1001002392 314
360 3300005530 Ga0070679_100318694 Ga0070679_1003186942 314
361 3300005535 Ga0070684_100051008 Ga0070684_1000510083 314
362 3300005535 Ga0070684_100567753 Ga0070684_1005677531 314
363 3300005536 Ga0070697_100116966 Ga0070697_1001169662 314
364 3300005545 Ga0070695_100010938 Ga0070695_1000109386 314
365 3300005545 Ga0070695_100157465 Ga0070695_1001574651 314
366 3300005563 Ga0068855_100022308 Ga0068855_1000223086 314
367 3300005563 Ga0068855_100061156 Ga0068855_1000611563 314
368 3300005563 Ga0068855_100648873 Ga0068855_1006488731 314
369 3300005577 Ga0068857_100008138 Ga0068857_1000081385 314
370 3300005578 Ga0068854_100009624 Ga0068854_1000096245 314
371 3300005614 Ga0068856_100008119 Ga0068856_1000081192 314
372 3300005618 Ga0068864_100172371 Ga0068864_1001723713 314
373 3300005841 Ga0068863_100043421 Ga0068863_1000434213 314
374 3300005842 Ga0068858_100179574 Ga0068858_1001795741 314
375 3300005985 Ga0081539_10051365 Ga0081539_100513652 314
376 3300006038 Ga0075365_10004322 Ga0075365_100043224 314
377 3300006844 Ga0075428_100053461 Ga0075428_1000534612 314
378 3300006847 Ga0075431_100267959 Ga0075431_1002679591 314
379 3300006914 Ga0075436_100013171 Ga0075436_1000131711 314
380 3300007076 Ga0075435_100448309 Ga0075435_1004483091 314
381 3300009093 Ga0105240_10024980 Ga0105240_100249801 314
382 3300009098 Ga0105245_10127336 Ga0105245_101273363 314
383 3300009101 Ga0105247_10013502 Ga0105247_100135022 314
384 3300009148 Ga0105243_10068107 Ga0105243_100681072 314
385 3300009176 Ga0105242_10207713 Ga0105242_102077132 314
386 3300010375 Ga0105239_10064136 Ga0105239_100641363 314
387 3300013105 Ga0157369_10164783 Ga0157369_101647833 314
388 3300013296 Ga0157374_10141839 Ga0157374_101418391 314
389 3300013297 Ga0157378_10053983 Ga0157378_100539834 314
390 3300014325 Ga0163163_10014280 Ga0163163_100142807 314
391 3300014326 Ga0157380_10015078 Ga0157380_100150784 314
392 3300021384 Ga0213876_10000053 Ga0213876_1000005347 314
393 3300025226 Ga0209674_100270 Ga0209674_10027021 314
394 3300025230 Ga0209563_100178 Ga0209563_10017821 314
395 3300025231 Ga0207427_100650 Ga0207427_10065012 314
396 3300025242 Ga0209258_100714 Ga0209258_10071415 314
397 3300025246 Ga0209646_1000157 Ga0209646_100015789 314
398 3300025250 Ga0209026_1000328 Ga0209026_100032812 314
399 3300025253 Ga0209677_100405 Ga0209677_10040519 314
400 3300025253 Ga0209677_101568 Ga0209677_1015684 314
401 3300025256 Ga0209759_1000448 Ga0209759_100044821 314
402 3300025256 Ga0209759_1001026 Ga0209759_10010264 314
403 3300025256 Ga0209759_1005335 Ga0209759_10053354 314
404 3300025256 Ga0209759_1009355 Ga0209759_10093552 314
405 3300025261 Ga0209233_1004855 Ga0209233_10048552 314
406 3300025272 Ga0209455_1011301 Ga0209455_10113011 314
407 3300025284 Ga0209130_1000028 Ga0209130_100002867 314
408 3300025292 Ga0209676_1003188 Ga0209676_10031885 314
409 3300025297 Ga0209758_1000383 Ga0209758_10003832 314
410 3300025302 Ga0207426_1000012 Ga0207426_1000012514 314
411 3300025303 Ga0209051_1002507 Ga0209051_10025074 314
412 3300025304 Ga0209257_1004287 Ga0209257_10042873 314
413 3300025900 Ga0207710_10061166 Ga0207710_100611662 314
414 3300025907 Ga0207645_10024130 Ga0207645_100241304 314
415 3300025909 Ga0207705_10186222 Ga0207705_101862222 314
416 3300025912 Ga0207707_10302894 Ga0207707_103028942 314
417 3300025913 Ga0207695_10038504 Ga0207695_100385043 314
418 3300025919 Ga0207657_10009860 Ga0207657_100098608 314
419 3300025919 Ga0207657_10070586 Ga0207657_100705863 314
420 3300025921 Ga0207652_10325031 Ga0207652_103250311 314
421 3300025922 Ga0207646_10041621 Ga0207646_100416213 314
422 3300025923 Ga0207681_10098788 Ga0207681_100987882 314
423 3300025924 Ga0207694_10074201 Ga0207694_100742014 314
424 3300025927 Ga0207687_10128752 Ga0207687_101287521 314
425 3300025935 Ga0207709_10290635 Ga0207709_102906351 314
426 3300025942 Ga0207689_10085674 Ga0207689_100856743 314
427 3300025949 Ga0207667_10036269 Ga0207667_100362694 314
428 3300025949 Ga0207667_10049853 Ga0207667_100498535 314
429 3300025960 Ga0207651_10003103 Ga0207651_100031038 314
430 3300025981 Ga0207640_10001829 Ga0207640_100018299 314
431 3300026078 Ga0207702_10001082 Ga0207702_1000108221 314
432 3300026088 Ga0207641_10402898 Ga0207641_104028981 314
433 3300026116 Ga0207674_10021844 Ga0207674_100218441 314
434 3300026116 Ga0207674_10174636 Ga0207674_101746363 314
435 3300026118 Ga0207675_100043493 Ga0207675_1000434934 314
436 3300028556 Ga0265337_1002746 Ga0265337_10027464 314
437 3300028563 Ga0265319_1011863 Ga0265319_10118632 314
438 3300028573 Ga0265334_10001736 Ga0265334_100017367 314
439 3300028577 Ga0265318_10007109 Ga0265318_100071094 314
440 3300028653 Ga0265323_10000674 Ga0265323_100006742 314
441 3300028654 Ga0265322_10008191 Ga0265322_100081911 314
442 3300028666 Ga0265336_10000044 Ga0265336_10000044100 314
443 3300028666 Ga0265336_10000389 Ga0265336_100003895 314
444 3300028666 Ga0265336_10022002 Ga0265336_100220022 314
445 3300028794 Ga0307515_10000434 Ga0307515_1000043415 314
446 3300028794 Ga0307515_10015010 Ga0307515_100150103 314
447 3300028800 Ga0265338_10000176 Ga0265338_1000017624 314
448 3300029957 Ga0265324_10001802 Ga0265324_100018023 314
449 3300031240 Ga0265320_10079770 Ga0265320_100797701 314
450 3300031456 Ga0307513_10122083 Ga0307513_101220832 314
451 3300031711 Ga0265314_10218083 Ga0265314_102180831 314
452 3300031731 Ga0307405_10000004 Ga0307405_10000004354 314
453 3300031731 Ga0307405_10037820 Ga0307405_100378202 314
454 3300031852 Ga0307410_10124173 Ga0307410_101241732 314
455 3300031901 Ga0307406_10007529 Ga0307406_100075293 314
456 3300031995 Ga0307409_100010866 Ga0307409_1000108664 314
457 3300032004 Ga0307414_10160269 Ga0307414_101602691 314
458 3300032004 Ga0307414_10199058 Ga0307414_101990582 314
459 3300032004 Ga0307414_10289665 Ga0307414_102896652 314
460 3300032005 Ga0307411_10071953 Ga0307411_100719532 314
461 3300032005 Ga0307411_10161932 Ga0307411_101619323 314
462 3300035207 Ga0373942_0059788 Ga0373942_0059788_59_1006 314
463 3300037418 Ga0395900_0008892 Ga0395900_0008892_2093_3043 314
464 3300037418 Ga0395900_0283833 Ga0395900_0283833_75_1046 314
465 3300037418 Ga0395900_0345191 Ga0395900_0345191_333_1283 314
466 3300037466 Ga0395898_0012924 Ga0395898_0012924_121_1071 314
467 3300037466 Ga0395898_0016659 Ga0395898_0016659_4581_5543 314
468 3300037466 Ga0395898_0118297 Ga0395898_0118297_178_1128 314
469 3300037471 Ga0395905_0146473 Ga0395905_0146473_54_1016 314
470 3300037471 Ga0395905_0164438 Ga0395905_0164438_112_1065 314
471 3300038443 Ga0395901_0001189 Ga0395901_0001189_15286_16248 314
472 3300039437 Ga0436365_0873465 Ga0436365_0873465_59313_60260 314
473 3300041404 Ga0439436_0000351 Ga0439436_0000351_3599_4573 314
474 3300044683 Ga0466965_0017833 Ga0466965_0017833_2119_3090 314
475 3300044765 Ga0466970_0082862 Ga0466970_0082862_480_1430 314
476 3300044842 Ga0466957_0070908 Ga0466957_0070908_1001_1963 314
477 3300044842 Ga0466957_0088839 Ga0466957_0088839_459_1409 314
478 3300045976 Ga0466967_0017525 Ga0466967_0017525_3702_4679 314
479 3300046453 Ga0495627_002272 Ga0495627_002272_2800_3750 314
480 3300046453 Ga0495627_019566 Ga0495627_019566_897_1847 314
481 3300046454 Ga0495592_0010630 Ga0495592_0010630_4829_5776 314
482 3300046457 Ga0495590_0008412 Ga0495590_0008412_2556_3506 314
483 3300046460 Ga0495638_0000141 Ga0495638_0000141_74302_75252 314
484 3300046462 Ga0495651_0019137 Ga0495651_0019137_2735_3682 314
485 3300046463 Ga0495653_0058987 Ga0495653_0058987_1553_2500 314
486 3300046471 Ga0495650_0082532 Ga0495650_0082532_258_1208 314
487 3300046474 Ga0495605_0093180 Ga0495605_0093180_188_1138 314
488 3300046477 Ga0495664_0023979 Ga0495664_0023979_24_971 314
489 3300046491 Ga0495584_0069245 Ga0495584_0069245_801_1751 314
490 3300046492 Ga0495585_0003542 Ga0495585_0003542_8590_9540 314
491 3300046501 Ga0495607_0028247 Ga0495607_0028247_786_1736 314
492 3300046501 Ga0495607_0029382 Ga0495607_0029382_2038_2988 314
493 3300046501 Ga0495607_0038622 Ga0495607_0038622_218_1168 314
494 3300046501 Ga0495607_0048941 Ga0495607_0048941_13_963 314
495 3300046506 Ga0495583_0000887 Ga0495583_0000887_25945_26907 314
496 3300046507 Ga0495606_0014145 Ga0495606_0014145_5053_6015 314
497 3300046507 Ga0495606_0056062 Ga0495606_0056062_368_1318 314
498 3300046511 Ga0495608_0033123 Ga0495608_0033123_505_1452 314
499 3300046515 Ga0495620_0000188 Ga0495620_0000188_15826_16776 314
500 3300046515 Ga0495620_0000209 Ga0495620_0000209_7046_7996 314
501 3300046515 Ga0495620_0004156 Ga0495620_0004156_2702_3652 314
502 3300046516 Ga0495628_0004111 Ga0495628_0004111_8392_9339 314
503 3300046517 Ga0495630_0030875 Ga0495630_0030875_998_1945 314
504 3300046517 Ga0495630_0043912 Ga0495630_0043912_2314_3309 314
505 3300046519 Ga0495632_0097757 Ga0495632_0097757_51_1001 314
506 3300046520 Ga0495637_0024351 Ga0495637_0024351_1081_2031 314
507 3300046522 Ga0495643_0008378 Ga0495643_0008378_5216_6166 314
508 3300046529 Ga0495652_0006323 Ga0495652_0006323_5900_6847 314
509 3300046530 Ga0495654_0002031 Ga0495654_0002031_52_1002 314
510 3300046536 Ga0495587_0020341 Ga0495587_0020341_1806_2753 314
511 3300046538 Ga0495609_0000091 Ga0495609_0000091_100948_101898 314
512 3300046542 Ga0495597_0001265 Ga0495597_0001265_10092_11075 314
513 3300046542 Ga0495597_0029566 Ga0495597_0029566_1482_2444 314
514 3300046543 Ga0495645_0010602 Ga0495645_0010602_203_1150 314
515 3300046559 Ga0495667_0002970 Ga0495667_0002970_1849_2796 314
516 3300046616 Ga0495668_0071924 Ga0495668_0071924_536_1498 314
517 3300046648 Ga0495611_0000489 Ga0495611_0000489_10171_11121 314
518 3300046648 Ga0495611_0047805 Ga0495611_0047805_137_1087 314
519 3300046660 Ga0495625_0000364 Ga0495625_0000364_4515_5465 314
520 3300046660 Ga0495625_0020123 Ga0495625_0020123_4099_5061 314
521 3300046660 Ga0495625_0069477 Ga0495625_0069477_564_1526 314
522 3300046674 Ga0495588_0000677 Ga0495588_0000677_1888_2838 314
523 3300046674 Ga0495588_0012096 Ga0495588_0012096_2706_3656 314
524 3300046678 Ga0495599_0028023 Ga0495599_0028023_2488_3435 314
525 3300046691 Ga0495670_0000087 Ga0495670_0000087_12599_13549 314
526 3300046691 Ga0495670_0112832 Ga0495670_0112832_47_997 314
527 3300046692 Ga0495671_0000081 Ga0495671_0000081_16181_17131 314
528 3300046694 Ga0495649_0001134 Ga0495649_0001134_10930_11880 314
529 3300046694 Ga0495649_0003333 Ga0495649_0003333_8006_8968 314
530 3300046694 Ga0495649_0014199 Ga0495649_0014199_338_1288 314
531 3300046809 Ga0495600_0017993 Ga0495600_0017993_602_1549 314
532 3300047317 Ga0495604_0005582 Ga0495604_0005582_6489_7436 314
533 3300047317 Ga0495604_0088276 Ga0495604_0088276_628_1575 314
534 3300047318 Ga0495636_0017663 Ga0495636_0017663_1082_2185 314
535 3300047323 Ga0495683_0017554 Ga0495683_0017554_1918_2868 314
536 3300047323 Ga0495683_0048445 Ga0495683_0048445_1013_1963 314
537 3300047443 Ga0495687_000090 Ga0495687_000090_78887_79837 314
538 3300047443 Ga0495687_004985 Ga0495687_004985_5555_6505 314
539 3300047444 Ga0495675_0000073 Ga0495675_0000073_19245_20192 314
540 3300047444 Ga0495675_0042186 Ga0495675_0042186_1671_2648 314
541 3300047470 Ga0495681_0005808 Ga0495681_0005808_2563_3513 314
542 3300047472 Ga0495686_0000157 Ga0495686_0000157_42679_43629 314
543 3300048088 Ga0495602_0009567 Ga0495602_0009567_5591_6538 314
544 3300048091 Ga0495626_0003776 Ga0495626_0003776_7808_8767 314
545 3300048091 Ga0495626_0064283 Ga0495626_0064283_78_1028 314
546 3300048905 Ga0496102_0439844 Ga0496102_0439844_236_1186 314
547 3300048907 Ga0496104_0001052 Ga0496104_0001052_9584_10531 314
548 3300048908 Ga0496105_0025138 Ga0496105_0025138_2710_3657 314
549 3300048911 Ga0496108_0001335 Ga0496108_0001335_11298_12245 314
550 3300048913 Ga0496110_0027115 Ga0496110_0027115_1547_2494 314
551 3300048914 Ga0496111_0030709 Ga0496111_0030709_172_1119 314
552 3300048915 Ga0496112_0011892 Ga0496112_0011892_61_1008 314
553 3300048915 Ga0496112_0020375 Ga0496112_0020375_4077_5030 314
554 3300048924 Ga0496121_0232251 Ga0496121_0232251_193_1143 314
555 3300048925 Ga0496122_0000018 Ga0496122_0000018_224169_225119 314
556 3300048926 Ga0496123_0000015 Ga0496123_0000015_224169_225119 314
557 3300048928 Ga0496125_0000189 Ga0496125_0000189_53898_54848 314
558 3300048929 Ga0496126_0007571 Ga0496126_0007571_2727_3677 314
559 3300048929 Ga0496126_0017349 Ga0496126_0017349_1655_2605 314
560 3300049459 Ga0495678_000059 Ga0495678_000059_81474_82424 314
561 3300049459 Ga0495678_010452 Ga0495678_010452_3474_4424 314
562 3300049460 Ga0495682_0001842 Ga0495682_0001842_671_1621 314
563 3300049823 Ga0501044_0036207 Ga0501044_0036207_597_1568 314
564 3300050494 nmdc:mga06z11_6147_c1 nmdc:mga06z11_6147_c1_3834_4781 314
565 3300050496 nmdc:mga07m45_13464_c1 nmdc:mga07m45_13464_c1_251_1213 314
566 3300050509 nmdc:mga0qj67_11364_c1 nmdc:mga0qj67_11364_c1_4039_4989 314
567 3300050510 nmdc:mga06r32_256880_c1 nmdc:mga06r32_256880_c1_203_1153 314
568 3300050513 nmdc:mga0rr50_288202_c1 nmdc:mga0rr50_288202_c1_34_1002 314
569 3300050516 nmdc:mga0sz30_13910_c1 nmdc:mga0sz30_13910_c1_401_1351 314
570 3300053079 Ga0500610_0057489 Ga0500610_0057489_816_1766 314
571 3300053086 Ga0500578_0001680 Ga0500578_0001680_11291_12241 314
572 3300053086 Ga0500578_0056836 Ga0500578_0056836_74_1024 314
573 3300053087 Ga0500643_010904 Ga0500643_010904_2029_3132 314
574 3300053103 Ga0500555_000860 Ga0500555_000860_7740_8690 314
575 3300053105 Ga0500557_040138 Ga0500557_040138_406_1356 314
576 3300053108 Ga0500562_013719 Ga0500562_013719_74_1024 314
577 3300053119 Ga0500595_001037 Ga0500595_001037_3368_4318 314
578 3300053122 Ga0500608_065445 Ga0500608_065445_223_1185 314
579 3300053125 Ga0500618_000315 Ga0500618_000315_32158_33111 314
580 3300053125 Ga0500618_000372 Ga0500618_000372_20808_21758 314
581 3300053131 Ga0500652_004117 Ga0500652_004117_530_1480 314
582 3300053137 Ga0500561_0005941 Ga0500561_0005941_435_1385 314
583 3300053139 Ga0500568_0000042 Ga0500568_0000042_96850_97800 314
584 3300053139 Ga0500568_0001475 Ga0500568_0001475_4568_5518 314
585 3300053141 Ga0500574_000078 Ga0500574_000078_9024_9974 314
586 3300053153 Ga0500616_0003001 Ga0500616_0003001_10066_11016 314
587 3300053154 Ga0500619_010183 Ga0500619_010183_1136_2086 314
588 3300053156 Ga0500622_0066285 Ga0500622_0066285_232_1182 314
589 3300053157 Ga0500624_000360 Ga0500624_000360_957_1907 314
590 3300053158 Ga0500627_0052626 Ga0500627_0052626_506_1456 314
591 3300053161 Ga0500634_0017114 Ga0500634_0017114_2101_3051 314
592 3300053161 Ga0500634_0048246 Ga0500634_0048246_1078_2028 314
593 3300053162 Ga0500638_000313 Ga0500638_000313_1054_2004 314
594 3300053177 Ga0500636_0022196 Ga0500636_0022196_2551_3501 314
595 3300053723 Ga0500567_015383 Ga0500567_015383_966_1916 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

66

366

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9741 1 313
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9729 1 313
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9622 1 313
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9616 1 313
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9521 1 314
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9383 1 314 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9185 1 314 3.20.20.100
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9166 1 312 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9156 1 314 3.20.20.100
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9118 4 312 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A379AEG0-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9933 2 181 GO:0005829
GO:0016491
AF-A0A519MZM9-F1-model_v4 Aldo/keto reductase 0.9901 1 262 GO:0005829
AF-A0A4U9WIE7-F1-model_v4 Putative aldo-keto reductase 0.99 1 231 GO:0005829
GO:0016491
AF-A0A436BZK1-F1-model_v4 Aldo/keto reductase 0.987 1 211 GO:0005829
GO:0016491
AF-A0A3S2CD63-F1-model_v4 Aldo/keto reductase 0.9867 1 227 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.84 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map