metagRoot

F467466

General Info

Members	Datasets	Scaffolds	Average Seq Length
595	299	591	152

Family's Representative Sequence

Representative Sequence	3300044684\|Ga0466966_0076800\|Ga0466966_0076800_729_1181
Length	150
Sequence	MREGELVPDFELPDQTGTKRSLSELLANGPVVLFFYPAAMTPGCTREACHFRDIGAEYASAGVQRVGISRDSVERQKQFADKHDFDYPLLSDEDGRVAGLFGVSRSGLLGKLGPVKRWTFAIDVDSRVAKIIHSETNMNVHADEALAAFR

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
3	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
4	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
5	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
6	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
7	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
8	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
9	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
10	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
11	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
12	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
13	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
14	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
15	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
18	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
23	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
26	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
27	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
28	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
34	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
35	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
36	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
37	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
38	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
39	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
40	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
41	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
42	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
43	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
44	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
45	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
46	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
47	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
48	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
49	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
50	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
51	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
52	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
53	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
54	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
55	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
56	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
57	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
58	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
59	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
60	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
61	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
62	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
63	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
64	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
68	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
69	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
70	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
71	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
72	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
73	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
74	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
75	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
76	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
77	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
78	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
79	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
80	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
82	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
83	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
84	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
85	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
86	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
88	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
89	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
90	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
91	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
92	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
94	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
95	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
96	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
97	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
98	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
99	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
100	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
101	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
102	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
103	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
104	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
105	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
106	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
107	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
108	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
109	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
110	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
111	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
112	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
113	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
114	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
115	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
116	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
117	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
118	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
119	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
120	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
121	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
184	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
185	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
186	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
187	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
188	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
189	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
190	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
191	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
192	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
193	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
194	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
195	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
196	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
197	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
198	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
199	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
200	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
201	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
202	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
203	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
204	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
205	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
206	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
207	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
208	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
209	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
210	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
211	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
212	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
213	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
214	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
215	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
216	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
217	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
218	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
219	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
220	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
221	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
222	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
223	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
224	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
225	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
226	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
227	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
228	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
229	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
230	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
231	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
232	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
233	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
234	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
235	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
236	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
237	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
238	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
239	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
240	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
241	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
242	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
243	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
244	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
245	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
246	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
247	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
248	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
249	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
250	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
251	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
252	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
253	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
254	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
255	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
256	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
257	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
258	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
259	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
260	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
261	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
262	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
263	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
264	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
265	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
266	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
267	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
268	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
269	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
270	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
271	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
272	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
273	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
274	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
275	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
276	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
277	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
278	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
279	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
280	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
281	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
283	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
284	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
285	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
286	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
287	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
288	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
289	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
290	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
291	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
292	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
293	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
294	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
295	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
296	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
297	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
298	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
299	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.32
Metatranscriptomes	1.01
Isolates	0.67

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.46
Nodule	0
Rhizoplane	6.55
Rhizosphere	73.28
Stem	0
Stem Tuber	0
Unclassified	4.71

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1010685	3300001977	Bacteria	1355
2	JGI24743J22301_10001010	3300001991	Bacteria	3688
3	JGI24745J21846_1002134	3300002073	Bacteria	1991
4	JGI24745J21846_1009568	3300002073	Bacteria	1099
5	JGI24738J21930_10044404	3300002075	Bacteria	904
6	JGI24749J21850_1013602	3300002076	Bacteria	1142
7	JGI24744J21845_10004784	3300002077	Bacteria	2798
8	JGI24034J26672_10006040	3300002239	Bacteria	1744
9	JGI24034J26672_10050509	3300002239	Bacteria	714
10	JGI24742J22300_10004082	3300002244	Bacteria	2377
11	JGI24742J22300_10042744	3300002244	Bacteria	810
12	JGI24751J29686_10030077	3300002459	Bacteria	1127
13	Ga0055540_1001022	3300003792	Bacteria	17952
14	Ga0055540_1001973	3300003792	Bacteria	11467
15	Ga0070676_10121352	3300005328	Bacteria	1641
16	Ga0070683_100128902	3300005329	Bacteria	2393
17	Ga0070683_101541795	3300005329	Bacteria	639
18	Ga0068869_100012198	3300005334	Bacteria	5670
19	Ga0068869_100030341	3300005334	Bacteria	3795
20	Ga0070666_10066183	3300005335	Bacteria	2452
21	Ga0068868_100005636	3300005338	Bacteria	8812
22	Ga0068868_100030793	3300005338	Bacteria	4115
23	Ga0070689_100023752	3300005340	Bacteria	4595
24	Ga0070691_10032357	3300005341	Bacteria	2457
25	Ga0070687_100145201	3300005343	Bacteria	1386
26	Ga0070692_10229860	3300005345	Bacteria	1101
27	Ga0070668_100006698	3300005347	Bacteria	8538
28	Ga0070668_100007651	3300005347	Bacteria	8018
29	Ga0070668_100198004	3300005347	Bacteria	1648
30	Ga0070668_101191579	3300005347	Bacteria	690
31	Ga0070669_100004702	3300005353	Bacteria	9851
32	Ga0070669_100266423	3300005353	Bacteria	1368
33	Ga0070669_100431467	3300005353	Bacteria	1083
34	Ga0070675_100496840	3300005354	Bacteria	1099
35	Ga0070671_100002887	3300005355	Bacteria	13377
36	Ga0070671_100101984	3300005355	Bacteria	2408
37	Ga0070671_100182112	3300005355	Bacteria	1779
38	Ga0070674_100001170	3300005356	Bacteria	13811
39	Ga0070673_100344145	3300005364	Bacteria	1322
40	Ga0070673_100687313	3300005364	Bacteria	939
41	Ga0070688_100004109	3300005365	Bacteria	7555
42	Ga0070688_100049112	3300005365	Bacteria	2624
43	Ga0070659_100100615	3300005366	Bacteria	2326
44	Ga0070667_100000082	3300005367	Bacteria	118320
45	Ga0070667_100007328	3300005367	Bacteria	9169
46	Ga0070667_100009513	3300005367	Bacteria	8060
47	Ga0070667_100011197	3300005367	Bacteria	7421
48	Ga0070667_100510227	3300005367	Bacteria	1103
49	Ga0070709_10141227	3300005434	Bacteria	1655
50	Ga0070714_101905978	3300005435	Bacteria	580
51	Ga0070710_10002128	3300005437	Bacteria	9386
52	Ga0070701_10011263	3300005438	Bacteria	3991
53	Ga0070711_100015221	3300005439	Bacteria	4866
54	Ga0070705_100010220	3300005440	Bacteria	4691
55	Ga0070700_100003549	3300005441	Bacteria	8053
56	Ga0070700_100101358	3300005441	Bacteria	1897
57	Ga0070694_100016227	3300005444	Bacteria	4687
58	Ga0070663_100028853	3300005455	Bacteria	3783
59	Ga0070663_100112993	3300005455	Bacteria	2043
60	Ga0070663_100171600	3300005455	Bacteria	1677
61	Ga0070678_100000177	3300005456	Bacteria	27552
62	Ga0070678_101783543	3300005456	Bacteria	580
63	Ga0070662_100616477	3300005457	Bacteria	913
64	Ga0068867_100003680	3300005459	Bacteria	10788
65	Ga0070685_10108827	3300005466	Bacteria	1704
66	Ga0070685_10314838	3300005466	Bacteria	1059
67	Ga0070707_100568817	3300005468	Bacteria	1095
68	Ga0070699_100031654	3300005518	Bacteria	4567
69	Ga0068853_100001131	3300005539	Bacteria	18889
70	Ga0068853_100066305	3300005539	Bacteria	3135
71	Ga0070672_100059223	3300005543	Bacteria	3013
72	Ga0070695_100008719	3300005545	Bacteria	6026
73	Ga0070696_100002227	3300005546	Bacteria	12782
74	Ga0070693_100069140	3300005547	Bacteria	2074
75	Ga0070693_100091935	3300005547	Bacteria	1831
76	Ga0070665_100004757	3300005548	Bacteria	14139
77	Ga0070665_100009147	3300005548	Bacteria	10036
78	Ga0070665_100048189	3300005548	Bacteria	4278
79	Ga0070704_100002312	3300005549	Bacteria	10663
80	Ga0068855_100018184	3300005563	Bacteria	8443
81	Ga0068855_100050060	3300005563	Bacteria	4924
82	Ga0068854_100011754	3300005578	Bacteria	5714
83	Ga0068854_100122727	3300005578	Bacteria	1974
84	Ga0068854_100318040	3300005578	Bacteria	1264
85	Ga0068856_100060318	3300005614	Bacteria	3748
86	Ga0070702_100002356	3300005615	Bacteria	8125
87	Ga0070702_100075687	3300005615	Bacteria	2001
88	Ga0068852_100030421	3300005616	Bacteria	4444
89	Ga0068852_100067819	3300005616	Bacteria	3120
90	Ga0068859_100000129	3300005617	Bacteria	71802
91	Ga0068859_100018045	3300005617	Bacteria	7089
92	Ga0068859_100299832	3300005617	Bacteria	1700
93	Ga0068864_100433839	3300005618	Bacteria	1254
94	Ga0068866_10000949	3300005718	Bacteria	12756
95	Ga0068861_100000376	3300005719	Bacteria	25730
96	Ga0068861_101138100	3300005719	Bacteria	752
97	Ga0068863_100000886	3300005841	Bacteria	30122
98	Ga0068863_100009169	3300005841	Bacteria	9653
99	Ga0068863_100628974	3300005841	Bacteria	1064
100	Ga0068858_100002114	3300005842	Bacteria	20165
101	Ga0068858_100041609	3300005842	Bacteria	4260
102	Ga0068858_100650566	3300005842	Bacteria	1024
103	Ga0068858_100919631	3300005842	Bacteria	856
104	Ga0068858_101210593	3300005842	Bacteria	743
105	Ga0068860_100000011	3300005843	Bacteria	328172
106	Ga0068860_100005391	3300005843	Bacteria	12980
107	Ga0068862_100000012	3300005844	Bacteria	267598
108	Ga0068862_100019264	3300005844	Bacteria	5692
109	Ga0068862_100898680	3300005844	Bacteria	870
110	Ga0081455_10165828	3300005937	Bacteria	1688
111	Ga0081540_1075792	3300005983	Bacteria	1536
112	Ga0075365_10008135	3300006038	Bacteria	5926
113	Ga0075365_10159823	3300006038	Bacteria	1570
114	Ga0075365_10204735	3300006038	Bacteria	1383
115	Ga0075368_10020658	3300006042	Bacteria	2495
116	Ga0075368_10240378	3300006042	Bacteria	772
117	Ga0075363_100000429	3300006048	Bacteria	13100
118	Ga0075363_100000510	3300006048	Bacteria	12454
119	Ga0075363_100020975	3300006048	Bacteria	3283
120	Ga0075363_100025153	3300006048	Bacteria	3033
121	Ga0075363_100046685	3300006048	Bacteria	2299
122	Ga0075363_100047278	3300006048	Bacteria	2285
123	Ga0075363_100156404	3300006048	Bacteria	1289
124	Ga0075364_10000434	3300006051	Bacteria	20896
125	Ga0075364_10004810	3300006051	Bacteria	7816
126	Ga0075364_10015550	3300006051	Bacteria	4721
127	Ga0075364_10034751	3300006051	Bacteria	3255
128	Ga0075364_10054131	3300006051	Bacteria	2624
129	Ga0075364_10084010	3300006051	Bacteria	2108
130	Ga0075364_10129702	3300006051	Bacteria	1691
131	Ga0070716_100004213	3300006173	Bacteria	6845
132	Ga0070712_100004584	3300006175	Bacteria	8533
133	Ga0075362_10028146	3300006177	Bacteria	2412
134	Ga0075362_10069815	3300006177	Bacteria	1603
135	Ga0075362_10201883	3300006177	Bacteria	968
136	Ga0075367_10009678	3300006178	Bacteria	5047
137	Ga0075367_10033374	3300006178	Bacteria	2966
138	Ga0075367_10113806	3300006178	Bacteria	1663
139	Ga0075369_10000371	3300006186	Bacteria	13447
140	Ga0075369_10000654	3300006186	Bacteria	11026
141	Ga0075369_10015506	3300006186	Bacteria	3060
142	Ga0075369_10024123	3300006186	Bacteria	2519
143	Ga0075369_10070978	3300006186	Bacteria	1533
144	Ga0075369_10173120	3300006186	Bacteria	992
145	Ga0075366_10069579	3300006195	Bacteria	2095
146	Ga0097621_100073962	3300006237	Bacteria	2822
147	Ga0075370_10000676	3300006353	Bacteria	13334
148	Ga0075370_10003971	3300006353	Bacteria	7108
149	Ga0075370_10021143	3300006353	Bacteria	3565
150	Ga0075370_10055037	3300006353	Bacteria	2260
151	Ga0075370_10229681	3300006353	Bacteria	1098
152	Ga0075370_10436094	3300006353	Bacteria	788
153	Ga0068871_100254374	3300006358	Bacteria	1531
154	Ga0075428_100003620	3300006844	Bacteria	16936
155	Ga0075428_101502188	3300006844	Bacteria	706
156	Ga0075430_100020465	3300006846	Bacteria	5629
157	Ga0075430_100115188	3300006846	Bacteria	2240
158	Ga0068865_100002733	3300006881	Bacteria	10480
159	Ga0097620_100000129	3300006931	Bacteria	71802
160	Ga0097620_100018045	3300006931	Bacteria	7089
161	Ga0097620_100299849	3300006931	Bacteria	1700
162	Ga0097620_100601049	3300006931	Bacteria	1193
163	Ga0097620_101631607	3300006931	Bacteria	712
164	Ga0099795_10187017	3300007788	Bacteria	868
165	Ga0105250_10061231	3300009092	Bacteria	1513
166	Ga0105240_10412521	3300009093	Bacteria	1519
167	Ga0105245_10186775	3300009098	Bacteria	1983
168	Ga0105245_10291527	3300009098	Bacteria	1598
169	Ga0105247_10000007	3300009101	Bacteria	409490
170	Ga0105247_10003247	3300009101	Bacteria	10678
171	Ga0114129_10015768	3300009147	Bacteria	10743
172	Ga0105243_10011199	3300009148	Bacteria	6785
173	Ga0105243_10459680	3300009148	Bacteria	1196
174	Ga0105243_11701199	3300009148	Bacteria	660
175	Ga0105241_10055348	3300009174	Bacteria	3039
176	Ga0105242_10005726	3300009176	Bacteria	9581
177	Ga0105248_10000114	3300009177	Bacteria	90862
178	Ga0105248_10048582	3300009177	Bacteria	4760
179	Ga0105237_10107827	3300009545	Bacteria	2777
180	Ga0105237_10192583	3300009545	Bacteria	2039
181	Ga0105238_10283898	3300009551	Bacteria	1637
182	Ga0105249_10000001	3300009553	Bacteria	504948
183	Ga0105249_10000571	3300009553	Bacteria	33782
184	Ga0105249_10022729	3300009553	Bacteria	5620
185	Ga0105249_10319356	3300009553	Bacteria	1564
186	Ga0105249_10698389	3300009553	Bacteria	1074
187	Ga0105239_10025100	3300010375	Bacteria	6565
188	Ga0105239_10437349	3300010375	Bacteria	1483
189	Ga0105239_12607122	3300010375	Bacteria	590
190	Ga0105246_10021849	3300011119	Bacteria	4123
191	Ga0157369_10036410	3300013105	Bacteria	5392
192	Ga0157369_10173571	3300013105	Bacteria	2270
193	Ga0157369_10267168	3300013105	Bacteria	1783
194	Ga0157369_11051836	3300013105	Bacteria	833
195	Ga0157374_10006968	3300013296	Bacteria	9621
196	Ga0157374_10256862	3300013296	Bacteria	1720
197	Ga0157378_10008241	3300013297	Bacteria	9087
198	Ga0163162_10016111	3300013306	Bacteria	7307
199	Ga0163162_10120550	3300013306	Bacteria	2727
200	Ga0163162_10174672	3300013306	Bacteria	2273
201	Ga0163162_10395744	3300013306	Bacteria	1514
202	Ga0157372_10018172	3300013307	Bacteria	7559
203	Ga0157372_10265583	3300013307	Bacteria	1993
204	Ga0157375_10008425	3300013308	Bacteria	9031
205	Ga0157375_10092964	3300013308	Bacteria	3081
206	Ga0163163_10037889	3300014325	Bacteria	4693
207	Ga0163163_10104316	3300014325	Bacteria	2860
208	Ga0163163_11712204	3300014325	Bacteria	689
209	Ga0157380_10138632	3300014326	Bacteria	2086
210	Ga0157380_11364193	3300014326	Bacteria	758
211	Ga0157377_10009736	3300014745	Bacteria	4730
212	Ga0157377_10086734	3300014745	Bacteria	1840
213	Ga0157379_10041560	3300014968	Bacteria	4104
214	Ga0157379_10145433	3300014968	Bacteria	2138
215	Ga0157379_10241042	3300014968	Bacteria	1640
216	Ga0157376_10060494	3300014969	Bacteria	3181
217	Ga0157376_10984927	3300014969	Bacteria	865
218	Ga0163161_10051677	3300017792	Bacteria	2978
219	Ga0197907_10839765	3300020069	Bacteria	606
220	Ga0206354_10876564	3300020081	Bacteria	3546
221	Ga0206353_11197234	3300020082	Bacteria	2374
222	Ga0206353_11804735	3300020082	Bacteria	862
223	Ga0154015_1356081	3300020610	Bacteria	923
224	Ga0213876_10004600	3300021384	Bacteria	7692
225	Ga0213876_10042243	3300021384	Bacteria	2409
226	Ga0213875_10008295	3300021388	Bacteria	5326
227	Ga0213875_10215704	3300021388	Bacteria	904
228	Ga0224712_10426176	3300022467	Bacteria	635
229	Ga0209051_1000559	3300025303	Bacteria	45332
230	Ga0209051_1000670	3300025303	Bacteria	38433
231	Ga0209051_1004955	3300025303	Bacteria	7958
232	Ga0209051_1023471	3300025303	Bacteria	2563
233	Ga0207696_1061666	3300025711	Bacteria	1054
234	Ga0207696_1118296	3300025711	Bacteria	715
235	Ga0207692_10002871	3300025898	Bacteria	6666
236	Ga0207642_10004191	3300025899	Bacteria	4636
237	Ga0207710_10000013	3300025900	Bacteria	409402
238	Ga0207710_10029557	3300025900	Bacteria	2386
239	Ga0207688_10000260	3300025901	Bacteria	23944
240	Ga0207688_10004585	3300025901	Bacteria	7521
241	Ga0207680_10042133	3300025903	Bacteria	2668
242	Ga0207647_10022930	3300025904	Bacteria	4139
243	Ga0207647_10135469	3300025904	Bacteria	1446
244	Ga0207685_10122423	3300025905	Bacteria	1144
245	Ga0207699_10050318	3300025906	Bacteria	2456
246	Ga0207645_10043388	3300025907	Bacteria	2878
247	Ga0207643_10110014	3300025908	Bacteria	1623
248	Ga0207654_10054815	3300025911	Bacteria	2305
249	Ga0207654_10488586	3300025911	Bacteria	868
250	Ga0207695_10682148	3300025913	Bacteria	908
251	Ga0207671_10061500	3300025914	Bacteria	2786
252	Ga0207671_10347689	3300025914	Bacteria	1175
253	Ga0207671_10488045	3300025914	Bacteria	982
254	Ga0207693_10000746	3300025915	Bacteria	29275
255	Ga0207663_10001664	3300025916	Bacteria	10471
256	Ga0207660_10422115	3300025917	Bacteria	1076
257	Ga0207662_10044086	3300025918	Bacteria	2633
258	Ga0207652_10754438	3300025921	Bacteria	866
259	Ga0207681_10054039	3300025923	Bacteria	2729
260	Ga0207681_10276446	3300025923	Bacteria	1320
261	Ga0207681_10313740	3300025923	Bacteria	1244
262	Ga0207694_10188254	3300025924	Bacteria	1676
263	Ga0207694_10198363	3300025924	Bacteria	1632
264	Ga0207694_10275390	3300025924	Bacteria	1381
265	Ga0207650_10718395	3300025925	Bacteria	845
266	Ga0207659_10373270	3300025926	Bacteria	1188
267	Ga0207687_10003514	3300025927	Bacteria	10547
268	Ga0207687_10041216	3300025927	Bacteria	3169
269	Ga0207687_10189019	3300025927	Bacteria	1601
270	Ga0207700_10851864	3300025928	Bacteria	815
271	Ga0207664_10108390	3300025929	Bacteria	2306
272	Ga0207664_10114398	3300025929	Bacteria	2248
273	Ga0207664_10535041	3300025929	Bacteria	1051
274	Ga0207644_10002301	3300025931	Bacteria	12387
275	Ga0207644_10065378	3300025931	Bacteria	2645
276	Ga0207644_10548697	3300025931	Bacteria	956
277	Ga0207690_10134372	3300025932	Bacteria	1815
278	Ga0207706_10027942	3300025933	Bacteria	5041
279	Ga0207686_10003214	3300025934	Bacteria	8789
280	Ga0207686_10578504	3300025934	Bacteria	881
281	Ga0207709_10013307	3300025935	Bacteria	4539
282	Ga0207709_10819282	3300025935	Bacteria	752
283	Ga0207670_10069803	3300025936	Bacteria	2425
284	Ga0207669_10001849	3300025937	Bacteria	8977
285	Ga0207704_10009249	3300025938	Bacteria	4744
286	Ga0207704_10152806	3300025938	Bacteria	1631
287	Ga0207665_10009326	3300025939	Bacteria	6440
288	Ga0207665_10374649	3300025939	Bacteria	1079
289	Ga0207691_10032645	3300025940	Bacteria	4853
290	Ga0207711_10000509	3300025941	Bacteria	40017
291	Ga0207711_10020043	3300025941	Bacteria	5573
292	Ga0207689_10007202	3300025942	Bacteria	9770
293	Ga0207689_10023188	3300025942	Bacteria	5211
294	Ga0207661_10101327	3300025944	Bacteria	2419
295	Ga0207667_10175182	3300025949	Bacteria	2204
296	Ga0207667_10475706	3300025949	Bacteria	1268
297	Ga0207651_10139038	3300025960	Bacteria	1873
298	Ga0207651_10846176	3300025960	Bacteria	813
299	Ga0207712_10000006	3300025961	Bacteria	573204
300	Ga0207712_10002891	3300025961	Bacteria	10978
301	Ga0207712_10364173	3300025961	Bacteria	1205
302	Ga0207668_10016386	3300025972	Bacteria	4624
303	Ga0207668_10046507	3300025972	Bacteria	2965
304	Ga0207668_10599315	3300025972	Bacteria	959
305	Ga0207668_11027231	3300025972	Bacteria	737
306	Ga0207640_10034350	3300025981	Bacteria	3165
307	Ga0207640_10348786	3300025981	Bacteria	1189
308	Ga0207658_10000140	3300025986	Bacteria	76436
309	Ga0207658_10028892	3300025986	Bacteria	3908
310	Ga0207658_10047391	3300025986	Bacteria	3145
311	Ga0207658_10087002	3300025986	Bacteria	2412
312	Ga0207658_10421909	3300025986	Bacteria	1176
313	Ga0207677_10017120	3300026023	Bacteria	4312
314	Ga0207677_10838661	3300026023	Bacteria	825
315	Ga0207703_10035621	3300026035	Bacteria	3955
316	Ga0207703_10147284	3300026035	Bacteria	2049
317	Ga0207703_10633297	3300026035	Bacteria	1013
318	Ga0207703_10860820	3300026035	Bacteria	867
319	Ga0207639_10003165	3300026041	Bacteria	11072
320	Ga0207639_10003981	3300026041	Bacteria	9971
321	Ga0207678_10007185	3300026067	Bacteria	9873
322	Ga0207678_10020141	3300026067	Bacteria	5858
323	Ga0207678_10178881	3300026067	Bacteria	1811
324	Ga0207678_10286595	3300026067	Bacteria	1414
325	Ga0207708_10001994	3300026075	Bacteria	15032
326	Ga0207708_10012840	3300026075	Bacteria	6248
327	Ga0207702_10290898	3300026078	Bacteria	1548
328	Ga0207641_10001303	3300026088	Bacteria	24724
329	Ga0207641_10016337	3300026088	Bacteria	6077
330	Ga0207641_10104908	3300026088	Bacteria	2496
331	Ga0207648_10007111	3300026089	Bacteria	11043
332	Ga0207648_10461648	3300026089	Bacteria	1158
333	Ga0207676_10043706	3300026095	Bacteria	3452
334	Ga0207676_10386667	3300026095	Bacteria	1304
335	Ga0207675_100001797	3300026118	Bacteria	21474
336	Ga0207675_100096737	3300026118	Bacteria	2780
337	Ga0207675_100106483	3300026118	Bacteria	2644
338	Ga0207675_100483113	3300026118	Bacteria	1231
339	Ga0207683_10002908	3300026121	Bacteria	14937
340	Ga0207683_10014923	3300026121	Bacteria	6613
341	Ga0207698_10011342	3300026142	Bacteria	5772
342	Ga0207698_10021999	3300026142	Bacteria	4421
343	Ga0209813_10074638	3300027866	Bacteria	1109
344	Ga0268266_10005705	3300028379	Bacteria	11543
345	Ga0268266_10122835	3300028379	Bacteria	2312
346	Ga0268266_11516814	3300028379	Bacteria	646
347	Ga0268265_10000016	3300028380	Bacteria	299380
348	Ga0268265_10050188	3300028380	Bacteria	3142
349	Ga0268265_10076257	3300028380	Bacteria	2629
350	Ga0268264_10000026	3300028381	Bacteria	459088
351	Ga0268264_10006043	3300028381	Bacteria	10234
352	Ga0265327_10041399	3300031251	Bacteria	2483
353	Ga0307413_10256829	3300031824	Bacteria	1300
354	Ga0307413_10495616	3300031824	Bacteria	980
355	Ga0307410_10020801	3300031852	Bacteria	4023
356	Ga0326468_10026548	3300031889	Bacteria	736
357	Ga0307407_11447329	3300031903	Bacteria	542
358	Ga0307412_10393467	3300031911	Bacteria	1126
359	Ga0307409_100041854	3300031995	Bacteria	3426
360	Ga0307409_100275652	3300031995	Bacteria	1552
361	Ga0307416_100562078	3300032002	Bacteria	1216
362	Ga0307416_101103615	3300032002	Bacteria	898
363	Ga0307416_101384215	3300032002	Bacteria	809
364	Ga0307416_101637804	3300032002	Bacteria	749
365	Ga0307411_10091731	3300032005	Bacteria	2123
366	Ga0307411_10878513	3300032005	Bacteria	795
367	Ga0373948_0036858	3300034817	Bacteria	1009
368	Ga0373932_0121213	3300035112	Bacteria	872
369	Ga0373939_0106580	3300035114	Bacteria	970
370	Ga0373960_0021166	3300035121	Bacteria	1727
371	Ga0373942_0011706	3300035207	Bacteria	2084
372	Ga0395900_0590527	3300037418	Bacteria	1052
373	Ga0395905_0554642	3300037471	Bacteria	1050
374	Ga0395905_0883832	3300037471	Bacteria	797
375	Ga0436364_0885697	3300037853	Bacteria	9847
376	Ga0436364_1414646	3300037853	Bacteria	1979
377	Ga0436365_0233085	3300039437	Bacteria	55703
378	Ga0436365_1469572	3300039437	Bacteria	17871
379	Ga0439466_0019077	3300041411	Bacteria	2456
380	Ga0439466_0046122	3300041411	Bacteria	1440
381	Ga0439466_0243545	3300041411	Bacteria	545
382	Ga0439465_0007534	3300041413	Bacteria	3457
383	Ga0451789_0160745	3300041443	Bacteria	1210
384	Ga0451791_0150588	3300041451	Bacteria	1387
385	Ga0451795_1462032	3300041456	Bacteria	1877
386	Ga0451800_1310095	3300041459	Bacteria	728
387	Ga0451806_476265	3300041462	Bacteria	666
388	Ga0451841_0706611	3300041498	Bacteria	664
389	Ga0451855_0158425	3300041511	Bacteria	914
390	Ga0439431_0000616	3300041997	Bacteria	7567
391	Ga0439433_0077917	3300041999	Bacteria	804
392	Ga0439445_0004730	3300042004	Bacteria	3087
393	Ga0439434_0001062	3300042435	Bacteria	7953
394	Ga0439434_0036587	3300042435	Bacteria	1502
395	Ga0439435_0107976	3300042436	Bacteria	861
396	Ga0466969_0464645	3300044656	Bacteria	576
397	Ga0466972_0042154	3300044658	Bacteria	2220
398	Ga0466972_0053371	3300044658	Bacteria	1946
399	Ga0466972_0099690	3300044658	Bacteria	1375
400	Ga0466972_0369505	3300044658	Bacteria	671
401	Ga0466965_0107182	3300044683	Bacteria	1434
402	Ga0466965_0410168	3300044683	Bacteria	750
403	Ga0466966_0006706	3300044684	Bacteria	7628
404	Ga0466966_0020951	3300044684	Bacteria	4298
405	Ga0466966_0076800	3300044684	Bacteria	2085
406	Ga0466966_0270493	3300044684	Bacteria	1022
407	Ga0466961_0014317	3300044693	Bacteria	5091
408	Ga0466961_0180475	3300044693	Bacteria	1311
409	Ga0466963_0003320	3300044694	Bacteria	9180
410	Ga0466963_0096137	3300044694	Bacteria	2023
411	Ga0466963_0123807	3300044694	Bacteria	1781
412	Ga0466964_0074746	3300044706	Bacteria	1441
413	Ga0466964_0193369	3300044706	Bacteria	972
414	Ga0466971_0006048	3300044719	Bacteria	5267
415	Ga0466971_0150932	3300044719	Bacteria	1085
416	Ga0466971_0338042	3300044719	Bacteria	727
417	Ga0466968_0039931	3300044735	Bacteria	1977
418	Ga0466970_0032284	3300044765	Bacteria	2766
419	Ga0466970_0262587	3300044765	Bacteria	969
420	Ga0466957_0071249	3300044842	Bacteria	2149
421	Ga0466960_0000160	3300044901	Bacteria	22849
422	Ga0466960_0037360	3300044901	Bacteria	2278
423	Ga0466960_0599413	3300044901	Bacteria	654
424	Ga0466959_0020284	3300045049	Bacteria	4895
425	Ga0466959_0146991	3300045049	Bacteria	1662
426	Ga0466958_0021656	3300045836	Bacteria	3759
427	Ga0466958_0033603	3300045836	Bacteria	3057
428	Ga0466958_0072674	3300045836	Bacteria	2106
429	Ga0466967_0008107	3300045976	Bacteria	7663
430	Ga0466967_0020721	3300045976	Bacteria	5322
431	Ga0466967_0045558	3300045976	Bacteria	3811
432	Ga0466967_0076344	3300045976	Bacteria	3014
433	Ga0466967_0089569	3300045976	Bacteria	2794
434	Ga0466967_0642763	3300045976	Bacteria	1049
435	Ga0466967_0900511	3300045976	Bacteria	880
436	Ga0466967_0953722	3300045976	Bacteria	854
437	Ga0466967_2084427	3300045976	Bacteria	563
438	Ga0495638_0007753	3300046460	Bacteria	7664
439	Ga0495650_0131440	3300046471	Bacteria	913
440	Ga0495583_0061078	3300046506	Bacteria	1683
441	Ga0495642_0441454	3300046528	Bacteria	575
442	Ga0495668_0155627	3300046616	Bacteria	1252
443	Ga0495635_0344636	3300046663	Bacteria	994
444	Ga0495669_0345909	3300046684	Bacteria	719
445	Ga0495671_0557193	3300046692	Bacteria	546
446	Ga0495649_0080084	3300046694	Bacteria	1747
447	Ga0495649_0496965	3300046694	Bacteria	607
448	Ga0495683_0387765	3300047323	Bacteria	583
449	Ga0495686_0003082	3300047472	Bacteria	14748
450	Ga0496100_0538021	3300048903	Bacteria	903
451	Ga0496100_1317433	3300048903	Bacteria	570
452	Ga0496101_0017747	3300048904	Bacteria	4827
453	Ga0496101_1410040	3300048904	Bacteria	543
454	Ga0496102_0000124	3300048905	Bacteria	110030
455	Ga0496102_0005205	3300048905	Bacteria	11042
456	Ga0496102_0028603	3300048905	Bacteria	4980
457	Ga0496102_0179710	3300048905	Bacteria	1993
458	Ga0496102_0710090	3300048905	Bacteria	928
459	Ga0496103_0000508	3300048906	Bacteria	32109
460	Ga0496103_0003040	3300048906	Bacteria	10326
461	Ga0496103_0026040	3300048906	Bacteria	3539
462	Ga0496104_0056389	3300048907	Bacteria	3715
463	Ga0496104_0133709	3300048907	Bacteria	2382
464	Ga0496104_0322448	3300048907	Bacteria	1458
465	Ga0496105_0111625	3300048908	Bacteria	2256
466	Ga0496106_0001551	3300048909	Bacteria	17316
467	Ga0496106_1205355	3300048909	Bacteria	590
468	Ga0496107_0003635	3300048910	Bacteria	10358
469	Ga0496107_0069942	3300048910	Bacteria	2548
470	Ga0496108_0000404	3300048911	Bacteria	35603
471	Ga0496108_0780065	3300048911	Bacteria	825
472	Ga0496109_0097266	3300048912	Bacteria	2728
473	Ga0496109_0679925	3300048912	Bacteria	967
474	Ga0496110_0315208	3300048913	Bacteria	1424
475	Ga0496111_0089920	3300048914	Bacteria	2249
476	Ga0496112_0013285	3300048915	Bacteria	7602
477	Ga0496112_0071213	3300048915	Bacteria	3436
478	Ga0496112_0142184	3300048915	Bacteria	2369
479	Ga0496113_0024830	3300048916	Bacteria	4266
480	Ga0496114_0006211	3300048917	Bacteria	9407
481	Ga0496114_0458826	3300048917	Bacteria	1128
482	Ga0496115_0001218	3300048918	Bacteria	18453
483	Ga0496115_1072335	3300048918	Bacteria	612
484	Ga0496116_0056677	3300048919	Bacteria	2566
485	Ga0496117_0013000	3300048920	Bacteria	7290
486	Ga0496118_0001433	3300048921	Bacteria	35920
487	Ga0496118_0001878	3300048921	Bacteria	29986
488	Ga0496119_0009124	3300048922	Bacteria	8583
489	Ga0496119_0173937	3300048922	Bacteria	1135
490	Ga0496122_0368277	3300048925	Bacteria	743
491	Ga0496124_0112298	3300048927	Bacteria	2191
492	Ga0496125_0014062	3300048928	Bacteria	7822
493	Ga0496126_0001833	3300048929	Bacteria	30996
494	Ga0496126_0003135	3300048929	Bacteria	21318
495	Ga0496126_0159639	3300048929	Bacteria	1927
496	Ga0496126_0276460	3300048929	Bacteria	1392
497	Ga0496126_1193613	3300048929	Bacteria	560
498	Ga0501031_0178955	3300049568	Bacteria	1385
499	Ga0501032_0136391	3300049569	Bacteria	1617
500	Ga0501033_0048291	3300049570	Bacteria	3162
501	Ga0501034_0055681	3300049571	Bacteria	3979
502	Ga0501034_0077266	3300049571	Bacteria	3335
503	Ga0501034_0165549	3300049571	Bacteria	2180
504	Ga0501036_0020752	3300049572	Bacteria	5518
505	Ga0501036_0305966	3300049572	Bacteria	1329
506	Ga0501037_0056471	3300049573	Bacteria	2867
507	Ga0501037_0254535	3300049573	Bacteria	1228
508	Ga0501038_0060252	3300049574	Bacteria	3248
509	Ga0501038_0330995	3300049574	Bacteria	1190
510	Ga0501038_0352421	3300049574	Bacteria	1146
511	Ga0501038_0446684	3300049574	Bacteria	995
512	Ga0501043_0061057	3300049579	Bacteria	2960
513	Ga0501043_0061402	3300049579	Bacteria	2952
514	Ga0501043_0139013	3300049579	Bacteria	1902
515	Ga0501043_0417403	3300049579	Bacteria	1012
516	Ga0501046_0009563	3300049580	Bacteria	8364
517	Ga0501047_0007251	3300049581	Bacteria	10423
518	Ga0501047_0045861	3300049581	Bacteria	4225
519	Ga0501047_0228889	3300049581	Bacteria	1713
520	Ga0501047_0451395	3300049581	Bacteria	1115
521	Ga0501047_0486415	3300049581	Bacteria	1061
522	Ga0501048_0000234	3300049582	Bacteria	36730
523	Ga0501048_0001407	3300049582	Bacteria	18259
524	Ga0501069_0005374	3300049585	Bacteria	6665
525	Ga0501070_0001863	3300049586	Bacteria	18631
526	Ga0501070_0075127	3300049586	Bacteria	2797
527	Ga0501070_0311191	3300049586	Bacteria	1282
528	Ga0501074_0199788	3300049590	Bacteria	1425
529	Ga0501074_0699068	3300049590	Bacteria	716
530	Ga0501083_0026374	3300049744	Bacteria	4016
531	Ga0501035_0000279	3300049822	Bacteria	60584
532	Ga0501035_0005970	3300049822	Bacteria	11464
533	Ga0501035_0007035	3300049822	Bacteria	10513
534	Ga0501035_0200889	3300049822	Bacteria	1710
535	Ga0501035_0686349	3300049822	Bacteria	827
536	Ga0501044_0000637	3300049823	Bacteria	42365
537	Ga0501044_0007594	3300049823	Bacteria	11919
538	Ga0501044_0538962	3300049823	Bacteria	1065
539	nmdc:mga03683_49514_c1	3300050489	Bacteria	1749
540	nmdc:mga03683_61821_c1	3300050489	Bacteria	1585
541	nmdc:mga03683_94142_c1	3300050489	Bacteria	1309
542	nmdc:mga03n38_15312_c1	3300050490	Bacteria	2959
543	nmdc:mga03n38_16316_c1	3300050490	Bacteria	2887
544	nmdc:mga03n38_187435_c1	3300050490	Bacteria	1064
545	nmdc:mga03n38_257734_c1	3300050490	Bacteria	923
546	nmdc:mga03n38_32320_c1	3300050490	Bacteria	2216
547	nmdc:mga03n38_3675_c1	3300050490	Bacteria	4963
548	nmdc:mga03n38_482470_c1	3300050490	Bacteria	693
549	nmdc:mga03n38_523166_c1	3300050490	Bacteria	668
550	nmdc:mga03n38_754_c1	3300050490	Bacteria	8571
551	nmdc:mga00v17_11522_c1	3300050491	Bacteria	4861
552	nmdc:mga00v17_120424_c1	3300050491	Bacteria	1670
553	nmdc:mga00v17_1794_c1	3300050491	Bacteria	11123
554	nmdc:mga00v17_21140_c1	3300050491	Bacteria	3738
555	nmdc:mga00v17_220393_c1	3300050491	Bacteria	1228
556	nmdc:mga00v17_23269_c1	3300050491	Bacteria	3583
557	nmdc:mga00v17_416917_c1	3300050491	Bacteria	872
558	nmdc:mga00v17_453072_c1	3300050491	Bacteria	833
559	nmdc:mga00v17_469196_c1	3300050491	Bacteria	817
560	nmdc:mga00v17_58870_c1	3300050491	Bacteria	2355
561	nmdc:mga00v17_77022_c1	3300050491	Bacteria	2076
562	nmdc:mga0yw44_13066_c1	3300050492	Bacteria	4355
563	nmdc:mga0yw44_149837_c1	3300050492	Bacteria	1521
564	nmdc:mga0yw44_239549_c1	3300050492	Bacteria	1205
565	nmdc:mga0yw44_260655_c1	3300050492	Bacteria	1155
566	nmdc:mga0yw44_83604_c1	3300050492	Bacteria	2005
567	nmdc:mga06z11_192438_c1	3300050494	Bacteria	1181
568	nmdc:mga06z11_79233_c1	3300050494	Bacteria	1758
569	nmdc:mga06z11_96051_c1	3300050494	Bacteria	1618
570	nmdc:mga04h51_170485_c1	3300050495	Bacteria	842
571	nmdc:mga07m45_20271_c1	3300050496	Bacteria	3611
572	nmdc:mga07m45_269658_c1	3300050496	Bacteria	990
573	nmdc:mga07m45_36614_c1	3300050496	Bacteria	2734
574	nmdc:mga07m45_67930_c1	3300050496	Bacteria	2026
575	nmdc:mga07m45_815_c1	3300050496	Bacteria	13450
576	nmdc:mga05p37_97327_c1	3300050507	Bacteria	3625
577	nmdc:mga09592_449835_c1	3300050508	Bacteria	1111
578	nmdc:mga0qj67_7487_c1	3300050509	Bacteria	8062
579	nmdc:mga06r32_58363_c1	3300050510	Bacteria	3709
580	nmdc:mga0sz30_175182_c1	3300050516	Bacteria	951
581	nmdc:mga0sz30_196379_c1	3300050516	Bacteria	896
582	nmdc:mga0sz30_3222_c1	3300050516	Bacteria	5860
583	nmdc:mga0sz30_3324_c1	3300050516	Bacteria	5785
584	nmdc:mga0sz30_81200_c1	3300050516	Bacteria	1403
585	Ga0500556_0005281	3300053104	Bacteria	3650
586	Ga0500642_0320778	3300053130	Bacteria	695
587	Ga0500604_0145699	3300053151	Bacteria	802
588	Ga0500616_0016819	3300053153	Bacteria	4156
589	Ga0500636_0079372	3300053177	Bacteria	1893
590	Ga0466962_0016048	3300061719	Bacteria	3613
591	Ga0466962_0087385	3300061719	Bacteria	1493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035121	Ga0373960_0021166	Ga0373960_0021166_849_1274	123
2	3300044656	Ga0466969_0464645	Ga0466969_0464645_186_566	125
3	3300025914	Ga0207671_10347689	Ga0207671_103476891	127
4	3300005329	Ga0070683_101541795	Ga0070683_1015417951	131
5	3300005367	Ga0070667_100007328	Ga0070667_1000073284	131
6	3300005455	Ga0070663_100112993	Ga0070663_1001129932	131
7	3300005563	Ga0068855_100050060	Ga0068855_1000500604	131
8	3300005578	Ga0068854_100318040	Ga0068854_1003180402	131
9	3300006931	Ga0097620_101631607	Ga0097620_1016316072	131
10	3300013105	Ga0157369_11051836	Ga0157369_110518362	131
11	3300020069	Ga0197907_10839765	Ga0197907_108397651	131
12	3300020081	Ga0206354_10876564	Ga0206354_108765645	131
13	3300020082	Ga0206353_11197234	Ga0206353_111972342	131
14	3300020082	Ga0206353_11804735	Ga0206353_118047351	131
15	3300020610	Ga0154015_1356081	Ga0154015_13560812	131
16	3300022467	Ga0224712_10426176	Ga0224712_104261761	131
17	3300025913	Ga0207695_10682148	Ga0207695_106821481	131
18	3300025935	Ga0207709_10819282	Ga0207709_108192822	131
19	3300025949	Ga0207667_10475706	Ga0207667_104757062	131
20	3300025981	Ga0207640_10348786	Ga0207640_103487862	131
21	3300026067	Ga0207678_10178881	Ga0207678_101788812	131
22	3300031251	Ga0265327_10041399	Ga0265327_100413993	131
23	3300037418	Ga0395900_0590527	Ga0395900_0590527_76_531	131
24	3300044684	Ga0466966_0006706	Ga0466966_0006706_1707_2162	131
25	3300044684	Ga0466966_0076800	Ga0466966_0076800_729_1181	131
26	3300044684	Ga0466966_0270493	Ga0466966_0270493_227_679	131
27	3300044693	Ga0466961_0014317	Ga0466961_0014317_1995_2447	131
28	3300044693	Ga0466961_0180475	Ga0466961_0180475_186_641	131
29	3300044719	Ga0466971_0338042	Ga0466971_0338042_44_496	131
30	3300044765	Ga0466970_0032284	Ga0466970_0032284_344_796	131
31	3300045049	Ga0466959_0020284	Ga0466959_0020284_3201_3656	131
32	3300045049	Ga0466959_0146991	Ga0466959_0146991_210_662	131
33	3300045836	Ga0466958_0021656	Ga0466958_0021656_1480_1932	131
34	3300045976	Ga0466967_2084427	Ga0466967_2084427_77_532	131
35	3300049570	Ga0501033_0048291	Ga0501033_0048291_1068_1523	131
36	3300049573	Ga0501037_0254535	Ga0501037_0254535_708_1163	131
37	3300049574	Ga0501038_0330995	Ga0501038_0330995_66_521	131
38	3300049581	Ga0501047_0228889	Ga0501047_0228889_383_838	131
39	3300049586	Ga0501070_0311191	Ga0501070_0311191_63_518	131
40	3300049590	Ga0501074_0199788	Ga0501074_0199788_710_1165	131
41	3300049822	Ga0501035_0686349	Ga0501035_0686349_131_586	131
42	3300053177	Ga0500636_0079372	Ga0500636_0079372_1305_1769	131
43	3300005616	Ga0068852_100030421	Ga0068852_1000304214	132
44	3300009098	Ga0105245_10291527	Ga0105245_102915272	132
45	3300009553	Ga0105249_10698389	Ga0105249_106983892	132
46	3300010375	Ga0105239_10437349	Ga0105239_104373492	132
47	3300025911	Ga0207654_10488586	Ga0207654_104885862	132
48	3300025927	Ga0207687_10189019	Ga0207687_101890192	132
49	3300025961	Ga0207712_10364173	Ga0207712_103641732	132
50	3300026142	Ga0207698_10011342	Ga0207698_100113424	132
51	3300048929	Ga0496126_0159639	Ga0496126_0159639_734_1192	132
52	3300049568	Ga0501031_0178955	Ga0501031_0178955_861_1319	132
53	3300049569	Ga0501032_0136391	Ga0501032_0136391_33_491	132
54	3300049571	Ga0501034_0165549	Ga0501034_0165549_1151_1609	132
55	3300049572	Ga0501036_0020752	Ga0501036_0020752_613_1071	132
56	3300049573	Ga0501037_0056471	Ga0501037_0056471_1129_1587	132
57	3300049574	Ga0501038_0060252	Ga0501038_0060252_1246_1704	132
58	3300049579	Ga0501043_0139013	Ga0501043_0139013_540_998	132
59	3300049581	Ga0501047_0045861	Ga0501047_0045861_658_1116	132
60	3300049582	Ga0501048_0000234	Ga0501048_0000234_22482_22940	132
61	3300049586	Ga0501070_0075127	Ga0501070_0075127_1185_1643	132
62	3300049822	Ga0501035_0005970	Ga0501035_0005970_9598_10056	132
63	3300003792	Ga0055540_1001022	Ga0055540_10010223	133
64	3300003792	Ga0055540_1001973	Ga0055540_10019732	133
65	3300005455	Ga0070663_100171600	Ga0070663_1001716002	133
66	3300009148	Ga0105243_11701199	Ga0105243_117011991	133
67	3300009551	Ga0105238_10283898	Ga0105238_102838982	133
68	3300021384	Ga0213876_10004600	Ga0213876_100046007	133
69	3300021384	Ga0213876_10042243	Ga0213876_100422433	133
70	3300021388	Ga0213875_10008295	Ga0213875_100082952	133
71	3300021388	Ga0213875_10215704	Ga0213875_102157041	133
72	3300025303	Ga0209051_1000559	Ga0209051_10005593	133
73	3300025303	Ga0209051_1000670	Ga0209051_100067039	133
74	3300025303	Ga0209051_1004955	Ga0209051_10049557	133
75	3300025303	Ga0209051_1023471	Ga0209051_10234712	133
76	3300025924	Ga0207694_10198363	Ga0207694_101983632	133
77	3300026041	Ga0207639_10003165	Ga0207639_100031657	133
78	3300026067	Ga0207678_10286595	Ga0207678_102865952	133
79	3300031824	Ga0307413_10495616	Ga0307413_104956162	133
80	3300031995	Ga0307409_100275652	Ga0307409_1002756522	133
81	3300032002	Ga0307416_100562078	Ga0307416_1005620782	133
82	3300032002	Ga0307416_101103615	Ga0307416_1011036152	133
83	3300032002	Ga0307416_101637804	Ga0307416_1016378041	133
84	3300032005	Ga0307411_10878513	Ga0307411_108785132	133
85	3300037853	Ga0436364_0885697	Ga0436364_0885697_4309_4764	133
86	3300037853	Ga0436364_1414646	Ga0436364_1414646_1079_1534	133
87	3300039437	Ga0436365_0233085	Ga0436365_0233085_1591_2046	133
88	3300039437	Ga0436365_1469572	Ga0436365_1469572_3933_4388	133
89	3300041411	Ga0439466_0019077	Ga0439466_0019077_254_718	133
90	3300041443	Ga0451789_0160745	Ga0451789_0160745_367_822	133
91	3300041451	Ga0451791_0150588	Ga0451791_0150588_721_1176	133
92	3300041456	Ga0451795_1462032	Ga0451795_1462032_90_545	133
93	3300041459	Ga0451800_1310095	Ga0451800_1310095_12_467	133
94	3300041462	Ga0451806_476265	Ga0451806_476265_94_549	133
95	3300041997	Ga0439431_0000616	Ga0439431_0000616_2772_3236	133
96	3300041999	Ga0439433_0077917	Ga0439433_0077917_242_706	133
97	3300042004	Ga0439445_0004730	Ga0439445_0004730_707_1171	133
98	3300042435	Ga0439434_0001062	Ga0439434_0001062_2051_2515	133
99	3300046471	Ga0495650_0131440	Ga0495650_0131440_104_559	133
100	3300047472	Ga0495686_0003082	Ga0495686_0003082_6635_7090	133
101	3300048925	Ga0496122_0368277	Ga0496122_0368277_245_700	133
102	3300050490	nmdc:mga03n38_257734_c1	nmdc:mga03n38_257734_c1_345_809	133
103	3300050491	nmdc:mga00v17_220393_c1	nmdc:mga00v17_220393_c1_444_899	133
104	3300050491	nmdc:mga00v17_23269_c1	nmdc:mga00v17_23269_c1_364_828	133
105	3300050492	nmdc:mga0yw44_260655_c1	nmdc:mga0yw44_260655_c1_106_561	133
106	iso_pu_bacteria	2643221687	2644485915	133
107	iso_pu_bacteria	2643221715	2644633788	133
108	iso_pu_bacteria	2902810491	2902814919	133
109	iso_pu_bacteria	2902837492	2902840738	133
110	3300005329	Ga0070683_100128902	Ga0070683_1001289022	134
111	3300013105	Ga0157369_10036410	Ga0157369_100364102	134
112	3300013105	Ga0157369_10267168	Ga0157369_102671682	134
113	3300025927	Ga0207687_10041216	Ga0207687_100412165	134
114	3300025928	Ga0207700_10851864	Ga0207700_108518642	134
115	3300025929	Ga0207664_10108390	Ga0207664_101083902	134
116	3300025934	Ga0207686_10578504	Ga0207686_105785042	134
117	3300025944	Ga0207661_10101327	Ga0207661_101013272	134
118	3300044684	Ga0466966_0020951	Ga0466966_0020951_1853_2311	134
119	3300044694	Ga0466963_0003320	Ga0466963_0003320_3690_4148	134
120	3300044694	Ga0466963_0096137	Ga0466963_0096137_96_554	134
121	3300044694	Ga0466963_0123807	Ga0466963_0123807_81_539	134
122	3300044719	Ga0466971_0150932	Ga0466971_0150932_67_525	134
123	3300044842	Ga0466957_0071249	Ga0466957_0071249_522_980	134
124	3300044901	Ga0466960_0000160	Ga0466960_0000160_6940_7398	134
125	3300044901	Ga0466960_0599413	Ga0466960_0599413_51_524	134
126	3300045836	Ga0466958_0033603	Ga0466958_0033603_1732_2190	134
127	3300045976	Ga0466967_0008107	Ga0466967_0008107_5669_6127	134
128	3300045976	Ga0466967_0020721	Ga0466967_0020721_200_658	134
129	3300045976	Ga0466967_0045558	Ga0466967_0045558_740_1198	134
130	3300045976	Ga0466967_0089569	Ga0466967_0089569_123_590	134
131	3300045976	Ga0466967_0642763	Ga0466967_0642763_432_890	134
132	3300045976	Ga0466967_0900511	Ga0466967_0900511_308_766	134
133	3300049571	Ga0501034_0055681	Ga0501034_0055681_1174_1632	134
134	3300049572	Ga0501036_0305966	Ga0501036_0305966_587_1081	134
135	3300049574	Ga0501038_0352421	Ga0501038_0352421_422_916	134
136	3300049574	Ga0501038_0446684	Ga0501038_0446684_56_514	134
137	3300049579	Ga0501043_0061057	Ga0501043_0061057_656_1114	134
138	3300049579	Ga0501043_0061402	Ga0501043_0061402_42_536	134
139	3300049580	Ga0501046_0009563	Ga0501046_0009563_7360_7818	134
140	3300049581	Ga0501047_0007251	Ga0501047_0007251_1176_1670	134
141	3300049581	Ga0501047_0451395	Ga0501047_0451395_622_1080	134
142	3300049581	Ga0501047_0486415	Ga0501047_0486415_57_515	134
143	3300049582	Ga0501048_0001407	Ga0501048_0001407_10871_11329	134
144	3300049585	Ga0501069_0005374	Ga0501069_0005374_3256_3714	134
145	3300049586	Ga0501070_0001863	Ga0501070_0001863_10451_10909	134
146	3300049590	Ga0501074_0699068	Ga0501074_0699068_211_669	134
147	3300049744	Ga0501083_0026374	Ga0501083_0026374_458_916	134
148	3300049822	Ga0501035_0000279	Ga0501035_0000279_31732_32226	134
149	3300049822	Ga0501035_0007035	Ga0501035_0007035_7335_7793	134
150	3300049823	Ga0501044_0000637	Ga0501044_0000637_21041_21535	134
151	3300049823	Ga0501044_0007594	Ga0501044_0007594_115_573	134
152	3300049823	Ga0501044_0538962	Ga0501044_0538962_178_636	134
153	3300061719	Ga0466962_0087385	Ga0466962_0087385_854_1312	134
154	3300005468	Ga0070707_100568817	Ga0070707_1005688172	135
155	3300005518	Ga0070699_100031654	Ga0070699_1000316542	135
156	3300025929	Ga0207664_10114398	Ga0207664_101143982	135
157	3300037471	Ga0395905_0554642	Ga0395905_0554642_61_522	135
158	3300001977	JGI24746J21847_1010685	JGI24746J21847_10106852	136
159	3300001991	JGI24743J22301_10001010	JGI24743J22301_100010103	136
160	3300002073	JGI24745J21846_1002134	JGI24745J21846_10021342	136
161	3300002073	JGI24745J21846_1009568	JGI24745J21846_10095682	136
162	3300002075	JGI24738J21930_10044404	JGI24738J21930_100444041	136
163	3300002076	JGI24749J21850_1013602	JGI24749J21850_10136022	136
164	3300002077	JGI24744J21845_10004784	JGI24744J21845_100047842	136
165	3300002239	JGI24034J26672_10006040	JGI24034J26672_100060402	136
166	3300002239	JGI24034J26672_10050509	JGI24034J26672_100505091	136
167	3300002244	JGI24742J22300_10004082	JGI24742J22300_100040823	136
168	3300002244	JGI24742J22300_10042744	JGI24742J22300_100427442	136
169	3300002459	JGI24751J29686_10030077	JGI24751J29686_100300772	136
170	3300005328	Ga0070676_10121352	Ga0070676_101213522	136
171	3300005334	Ga0068869_100012198	Ga0068869_1000121984	136
172	3300005334	Ga0068869_100030341	Ga0068869_1000303413	136
173	3300005335	Ga0070666_10066183	Ga0070666_100661832	136
174	3300005338	Ga0068868_100005636	Ga0068868_1000056363	136
175	3300005338	Ga0068868_100030793	Ga0068868_1000307935	136
176	3300005340	Ga0070689_100023752	Ga0070689_1000237522	136
177	3300005341	Ga0070691_10032357	Ga0070691_100323572	136
178	3300005343	Ga0070687_100145201	Ga0070687_1001452012	136
179	3300005345	Ga0070692_10229860	Ga0070692_102298602	136
180	3300005347	Ga0070668_100006698	Ga0070668_1000066989	136
181	3300005347	Ga0070668_100007651	Ga0070668_1000076517	136
182	3300005347	Ga0070668_100198004	Ga0070668_1001980042	136
183	3300005347	Ga0070668_101191579	Ga0070668_1011915792	136
184	3300005353	Ga0070669_100004702	Ga0070669_1000047024	136
185	3300005353	Ga0070669_100266423	Ga0070669_1002664232	136
186	3300005353	Ga0070669_100431467	Ga0070669_1004314671	136
187	3300005354	Ga0070675_100496840	Ga0070675_1004968402	136
188	3300005355	Ga0070671_100002887	Ga0070671_1000028874	136
189	3300005355	Ga0070671_100101984	Ga0070671_1001019843	136
190	3300005355	Ga0070671_100182112	Ga0070671_1001821122	136
191	3300005356	Ga0070674_100001170	Ga0070674_1000011704	136
192	3300005364	Ga0070673_100344145	Ga0070673_1003441451	136
193	3300005364	Ga0070673_100687313	Ga0070673_1006873132	136
194	3300005365	Ga0070688_100004109	Ga0070688_1000041095	136
195	3300005365	Ga0070688_100049112	Ga0070688_1000491122	136
196	3300005366	Ga0070659_100100615	Ga0070659_1001006152	136
197	3300005367	Ga0070667_100000082	Ga0070667_10000008296	136
198	3300005367	Ga0070667_100009513	Ga0070667_1000095133	136
199	3300005367	Ga0070667_100011197	Ga0070667_1000111975	136
200	3300005367	Ga0070667_100510227	Ga0070667_1005102272	136
201	3300005434	Ga0070709_10141227	Ga0070709_101412272	136
202	3300005435	Ga0070714_101905978	Ga0070714_1019059781	136
203	3300005437	Ga0070710_10002128	Ga0070710_100021283	136
204	3300005438	Ga0070701_10011263	Ga0070701_100112636	136
205	3300005439	Ga0070711_100015221	Ga0070711_1000152217	136
206	3300005440	Ga0070705_100010220	Ga0070705_1000102202	136
207	3300005441	Ga0070700_100003549	Ga0070700_1000035493	136
208	3300005441	Ga0070700_100101358	Ga0070700_1001013582	136
209	3300005444	Ga0070694_100016227	Ga0070694_1000162274	136
210	3300005455	Ga0070663_100028853	Ga0070663_1000288531	136
211	3300005456	Ga0070678_100000177	Ga0070678_10000017722	136
212	3300005456	Ga0070678_101783543	Ga0070678_1017835431	136
213	3300005457	Ga0070662_100616477	Ga0070662_1006164772	136
214	3300005459	Ga0068867_100003680	Ga0068867_1000036807	136
215	3300005466	Ga0070685_10108827	Ga0070685_101088272	136
216	3300005466	Ga0070685_10314838	Ga0070685_103148382	136
217	3300005539	Ga0068853_100001131	Ga0068853_1000011316	136
218	3300005539	Ga0068853_100066305	Ga0068853_1000663052	136
219	3300005543	Ga0070672_100059223	Ga0070672_1000592233	136
220	3300005545	Ga0070695_100008719	Ga0070695_1000087193	136
221	3300005546	Ga0070696_100002227	Ga0070696_10000222712	136
222	3300005547	Ga0070693_100069140	Ga0070693_1000691401	136
223	3300005547	Ga0070693_100091935	Ga0070693_1000919352	136
224	3300005548	Ga0070665_100004757	Ga0070665_1000047572	136
225	3300005548	Ga0070665_100009147	Ga0070665_1000091475	136
226	3300005548	Ga0070665_100048189	Ga0070665_1000481892	136
227	3300005549	Ga0070704_100002312	Ga0070704_1000023125	136
228	3300005563	Ga0068855_100018184	Ga0068855_1000181845	136
229	3300005578	Ga0068854_100011754	Ga0068854_1000117543	136
230	3300005578	Ga0068854_100122727	Ga0068854_1001227272	136
231	3300005614	Ga0068856_100060318	Ga0068856_1000603184	136
232	3300005615	Ga0070702_100002356	Ga0070702_1000023562	136
233	3300005615	Ga0070702_100075687	Ga0070702_1000756873	136
234	3300005616	Ga0068852_100067819	Ga0068852_1000678192	136
235	3300005617	Ga0068859_100000129	Ga0068859_10000012955	136
236	3300005617	Ga0068859_100018045	Ga0068859_1000180456	136
237	3300005617	Ga0068859_100299832	Ga0068859_1002998322	136
238	3300005618	Ga0068864_100433839	Ga0068864_1004338392	136
239	3300005718	Ga0068866_10000949	Ga0068866_100009499	136
240	3300005719	Ga0068861_100000376	Ga0068861_1000003767	136
241	3300005719	Ga0068861_101138100	Ga0068861_1011381002	136
242	3300005841	Ga0068863_100000886	Ga0068863_1000008866	136
243	3300005841	Ga0068863_100009169	Ga0068863_10000916912	136
244	3300005841	Ga0068863_100628974	Ga0068863_1006289742	136
245	3300005842	Ga0068858_100002114	Ga0068858_10000211411	136
246	3300005842	Ga0068858_100041609	Ga0068858_1000416096	136
247	3300005842	Ga0068858_100650566	Ga0068858_1006505662	136
248	3300005842	Ga0068858_100919631	Ga0068858_1009196312	136
249	3300005842	Ga0068858_101210593	Ga0068858_1012105932	136
250	3300005843	Ga0068860_100000011	Ga0068860_100000011322	136
251	3300005843	Ga0068860_100005391	Ga0068860_1000053915	136
252	3300005844	Ga0068862_100000012	Ga0068862_10000001297	136
253	3300005844	Ga0068862_100019264	Ga0068862_1000192645	136
254	3300005844	Ga0068862_100898680	Ga0068862_1008986802	136
255	3300005937	Ga0081455_10165828	Ga0081455_101658282	136
256	3300005983	Ga0081540_1075792	Ga0081540_10757922	136
257	3300006038	Ga0075365_10008135	Ga0075365_100081353	136
258	3300006038	Ga0075365_10159823	Ga0075365_101598232	136
259	3300006038	Ga0075365_10204735	Ga0075365_102047352	136
260	3300006042	Ga0075368_10020658	Ga0075368_100206583	136
261	3300006042	Ga0075368_10240378	Ga0075368_102403782	136
262	3300006048	Ga0075363_100000429	Ga0075363_1000004292	136
263	3300006048	Ga0075363_100000510	Ga0075363_1000005104	136
264	3300006048	Ga0075363_100020975	Ga0075363_1000209752	136
265	3300006048	Ga0075363_100025153	Ga0075363_1000251532	136
266	3300006048	Ga0075363_100046685	Ga0075363_1000466852	136
267	3300006048	Ga0075363_100047278	Ga0075363_1000472782	136
268	3300006048	Ga0075363_100156404	Ga0075363_1001564042	136
269	3300006051	Ga0075364_10000434	Ga0075364_1000043414	136
270	3300006051	Ga0075364_10004810	Ga0075364_100048106	136
271	3300006051	Ga0075364_10015550	Ga0075364_100155503	136
272	3300006051	Ga0075364_10034751	Ga0075364_100347512	136
273	3300006051	Ga0075364_10054131	Ga0075364_100541313	136
274	3300006051	Ga0075364_10084010	Ga0075364_100840102	136
275	3300006051	Ga0075364_10129702	Ga0075364_101297021	136
276	3300006173	Ga0070716_100004213	Ga0070716_1000042136	136
277	3300006175	Ga0070712_100004584	Ga0070712_1000045843	136
278	3300006177	Ga0075362_10028146	Ga0075362_100281462	136
279	3300006177	Ga0075362_10069815	Ga0075362_100698152	136
280	3300006177	Ga0075362_10201883	Ga0075362_102018832	136
281	3300006178	Ga0075367_10009678	Ga0075367_100096787	136
282	3300006178	Ga0075367_10033374	Ga0075367_100333743	136
283	3300006178	Ga0075367_10113806	Ga0075367_101138062	136
284	3300006186	Ga0075369_10000371	Ga0075369_1000037110	136
285	3300006186	Ga0075369_10000654	Ga0075369_100006544	136
286	3300006186	Ga0075369_10015506	Ga0075369_100155062	136
287	3300006186	Ga0075369_10024123	Ga0075369_100241232	136
288	3300006186	Ga0075369_10070978	Ga0075369_100709782	136
289	3300006186	Ga0075369_10173120	Ga0075369_101731202	136
290	3300006195	Ga0075366_10069579	Ga0075366_100695793	136
291	3300006237	Ga0097621_100073962	Ga0097621_1000739622	136
292	3300006353	Ga0075370_10000676	Ga0075370_100006768	136
293	3300006353	Ga0075370_10003971	Ga0075370_100039713	136
294	3300006353	Ga0075370_10021143	Ga0075370_100211435	136
295	3300006353	Ga0075370_10055037	Ga0075370_100550372	136
296	3300006353	Ga0075370_10229681	Ga0075370_102296812	136
297	3300006353	Ga0075370_10436094	Ga0075370_104360941	136
298	3300006358	Ga0068871_100254374	Ga0068871_1002543741	136
299	3300006844	Ga0075428_100003620	Ga0075428_1000036207	136
300	3300006844	Ga0075428_101502188	Ga0075428_1015021882	136
301	3300006846	Ga0075430_100020465	Ga0075430_1000204658	136
302	3300006846	Ga0075430_100115188	Ga0075430_1001151882	136
303	3300006881	Ga0068865_100002733	Ga0068865_1000027336	136
304	3300006931	Ga0097620_100000129	Ga0097620_10000012955	136
305	3300006931	Ga0097620_100018045	Ga0097620_1000180456	136
306	3300006931	Ga0097620_100299849	Ga0097620_1002998492	136
307	3300006931	Ga0097620_100601049	Ga0097620_1006010492	136
308	3300007788	Ga0099795_10187017	Ga0099795_101870171	136
309	3300009092	Ga0105250_10061231	Ga0105250_100612312	136
310	3300009093	Ga0105240_10412521	Ga0105240_104125212	136
311	3300009098	Ga0105245_10186775	Ga0105245_101867752	136
312	3300009101	Ga0105247_10000007	Ga0105247_10000007120	136
313	3300009101	Ga0105247_10003247	Ga0105247_100032477	136
314	3300009147	Ga0114129_10015768	Ga0114129_100157688	136
315	3300009148	Ga0105243_10011199	Ga0105243_100111998	136
316	3300009148	Ga0105243_10459680	Ga0105243_104596802	136
317	3300009174	Ga0105241_10055348	Ga0105241_100553483	136
318	3300009176	Ga0105242_10005726	Ga0105242_100057268	136
319	3300009177	Ga0105248_10000114	Ga0105248_1000011473	136
320	3300009177	Ga0105248_10048582	Ga0105248_100485825	136
321	3300009545	Ga0105237_10107827	Ga0105237_101078273	136
322	3300009545	Ga0105237_10192583	Ga0105237_101925832	136
323	3300009553	Ga0105249_10000001	Ga0105249_10000001365	136
324	3300009553	Ga0105249_10000571	Ga0105249_1000057137	136
325	3300009553	Ga0105249_10022729	Ga0105249_100227297	136
326	3300009553	Ga0105249_10319356	Ga0105249_103193562	136
327	3300010375	Ga0105239_10025100	Ga0105239_100251002	136
328	3300010375	Ga0105239_12607122	Ga0105239_126071222	136
329	3300011119	Ga0105246_10021849	Ga0105246_100218492	136
330	3300013105	Ga0157369_10173571	Ga0157369_101735712	136
331	3300013296	Ga0157374_10006968	Ga0157374_100069684	136
332	3300013296	Ga0157374_10256862	Ga0157374_102568622	136
333	3300013297	Ga0157378_10008241	Ga0157378_100082417	136
334	3300013306	Ga0163162_10016111	Ga0163162_100161112	136
335	3300013306	Ga0163162_10120550	Ga0163162_101205502	136
336	3300013306	Ga0163162_10174672	Ga0163162_101746722	136
337	3300013306	Ga0163162_10395744	Ga0163162_103957441	136
338	3300013307	Ga0157372_10018172	Ga0157372_100181727	136
339	3300013307	Ga0157372_10265583	Ga0157372_102655832	136
340	3300013308	Ga0157375_10008425	Ga0157375_100084257	136
341	3300013308	Ga0157375_10092964	Ga0157375_100929644	136
342	3300014325	Ga0163163_10037889	Ga0163163_100378895	136
343	3300014325	Ga0163163_10104316	Ga0163163_101043163	136
344	3300014325	Ga0163163_11712204	Ga0163163_117122042	136
345	3300014326	Ga0157380_10138632	Ga0157380_101386322	136
346	3300014326	Ga0157380_11364193	Ga0157380_113641932	136
347	3300014745	Ga0157377_10009736	Ga0157377_100097362	136
348	3300014745	Ga0157377_10086734	Ga0157377_100867342	136
349	3300014968	Ga0157379_10041560	Ga0157379_100415602	136
350	3300014968	Ga0157379_10145433	Ga0157379_101454332	136
351	3300014968	Ga0157379_10241042	Ga0157379_102410422	136
352	3300014969	Ga0157376_10060494	Ga0157376_100604944	136
353	3300014969	Ga0157376_10984927	Ga0157376_109849271	136
354	3300017792	Ga0163161_10051677	Ga0163161_100516773	136
355	3300025711	Ga0207696_1061666	Ga0207696_10616662	136
356	3300025711	Ga0207696_1118296	Ga0207696_11182962	136
357	3300025898	Ga0207692_10002871	Ga0207692_100028717	136
358	3300025899	Ga0207642_10004191	Ga0207642_100041912	136
359	3300025900	Ga0207710_10000013	Ga0207710_10000013120	136
360	3300025900	Ga0207710_10029557	Ga0207710_100295572	136
361	3300025901	Ga0207688_10000260	Ga0207688_100002607	136
362	3300025901	Ga0207688_10004585	Ga0207688_100045857	136
363	3300025903	Ga0207680_10042133	Ga0207680_100421332	136
364	3300025904	Ga0207647_10022930	Ga0207647_100229302	136
365	3300025904	Ga0207647_10135469	Ga0207647_101354692	136
366	3300025905	Ga0207685_10122423	Ga0207685_101224232	136
367	3300025906	Ga0207699_10050318	Ga0207699_100503182	136
368	3300025907	Ga0207645_10043388	Ga0207645_100433883	136
369	3300025908	Ga0207643_10110014	Ga0207643_101100142	136
370	3300025911	Ga0207654_10054815	Ga0207654_100548152	136
371	3300025914	Ga0207671_10061500	Ga0207671_100615003	136
372	3300025914	Ga0207671_10488045	Ga0207671_104880452	136
373	3300025915	Ga0207693_10000746	Ga0207693_1000074620	136
374	3300025916	Ga0207663_10001664	Ga0207663_100016645	136
375	3300025917	Ga0207660_10422115	Ga0207660_104221152	136
376	3300025918	Ga0207662_10044086	Ga0207662_100440864	136
377	3300025921	Ga0207652_10754438	Ga0207652_107544382	136
378	3300025923	Ga0207681_10054039	Ga0207681_100540393	136
379	3300025923	Ga0207681_10276446	Ga0207681_102764462	136
380	3300025923	Ga0207681_10313740	Ga0207681_103137401	136
381	3300025924	Ga0207694_10188254	Ga0207694_101882541	136
382	3300025924	Ga0207694_10275390	Ga0207694_102753902	136
383	3300025925	Ga0207650_10718395	Ga0207650_107183952	136
384	3300025926	Ga0207659_10373270	Ga0207659_103732702	136
385	3300025927	Ga0207687_10003514	Ga0207687_100035147	136
386	3300025929	Ga0207664_10535041	Ga0207664_105350412	136
387	3300025931	Ga0207644_10002301	Ga0207644_100023014	136
388	3300025931	Ga0207644_10065378	Ga0207644_100653783	136
389	3300025931	Ga0207644_10548697	Ga0207644_105486972	136
390	3300025932	Ga0207690_10134372	Ga0207690_101343722	136
391	3300025933	Ga0207706_10027942	Ga0207706_100279425	136
392	3300025934	Ga0207686_10003214	Ga0207686_100032142	136
393	3300025935	Ga0207709_10013307	Ga0207709_100133073	136
394	3300025936	Ga0207670_10069803	Ga0207670_100698031	136
395	3300025937	Ga0207669_10001849	Ga0207669_100018493	136
396	3300025938	Ga0207704_10009249	Ga0207704_100092494	136
397	3300025938	Ga0207704_10152806	Ga0207704_101528062	136
398	3300025939	Ga0207665_10009326	Ga0207665_100093263	136
399	3300025939	Ga0207665_10374649	Ga0207665_103746492	136
400	3300025940	Ga0207691_10032645	Ga0207691_100326453	136
401	3300025941	Ga0207711_10000509	Ga0207711_1000050930	136
402	3300025941	Ga0207711_10020043	Ga0207711_100200435	136
403	3300025942	Ga0207689_10007202	Ga0207689_100072022	136
404	3300025942	Ga0207689_10023188	Ga0207689_100231883	136
405	3300025949	Ga0207667_10175182	Ga0207667_101751822	136
406	3300025960	Ga0207651_10139038	Ga0207651_101390382	136
407	3300025960	Ga0207651_10846176	Ga0207651_108461761	136
408	3300025961	Ga0207712_10000006	Ga0207712_10000006126	136
409	3300025961	Ga0207712_10002891	Ga0207712_100028915	136
410	3300025972	Ga0207668_10016386	Ga0207668_100163864	136
411	3300025972	Ga0207668_10046507	Ga0207668_100465073	136
412	3300025972	Ga0207668_10599315	Ga0207668_105993151	136
413	3300025972	Ga0207668_11027231	Ga0207668_110272312	136
414	3300025981	Ga0207640_10034350	Ga0207640_100343504	136
415	3300025986	Ga0207658_10000140	Ga0207658_1000014069	136
416	3300025986	Ga0207658_10028892	Ga0207658_100288925	136
417	3300025986	Ga0207658_10047391	Ga0207658_100473913	136
418	3300025986	Ga0207658_10087002	Ga0207658_100870022	136
419	3300025986	Ga0207658_10421909	Ga0207658_104219092	136
420	3300026023	Ga0207677_10017120	Ga0207677_100171203	136
421	3300026023	Ga0207677_10838661	Ga0207677_108386612	136
422	3300026035	Ga0207703_10035621	Ga0207703_100356212	136
423	3300026035	Ga0207703_10147284	Ga0207703_101472842	136
424	3300026035	Ga0207703_10633297	Ga0207703_106332972	136
425	3300026035	Ga0207703_10860820	Ga0207703_108608202	136
426	3300026041	Ga0207639_10003981	Ga0207639_100039815	136
427	3300026067	Ga0207678_10007185	Ga0207678_1000718511	136
428	3300026067	Ga0207678_10020141	Ga0207678_100201416	136
429	3300026075	Ga0207708_10001994	Ga0207708_1000199411	136
430	3300026075	Ga0207708_10012840	Ga0207708_100128407	136
431	3300026078	Ga0207702_10290898	Ga0207702_102908982	136
432	3300026088	Ga0207641_10001303	Ga0207641_1000130322	136
433	3300026088	Ga0207641_10016337	Ga0207641_100163373	136
434	3300026088	Ga0207641_10104908	Ga0207641_101049083	136
435	3300026089	Ga0207648_10007111	Ga0207648_100071116	136
436	3300026089	Ga0207648_10461648	Ga0207648_104616482	136
437	3300026095	Ga0207676_10043706	Ga0207676_100437063	136
438	3300026095	Ga0207676_10386667	Ga0207676_103866672	136
439	3300026118	Ga0207675_100001797	Ga0207675_1000017977	136
440	3300026118	Ga0207675_100096737	Ga0207675_1000967374	136
441	3300026118	Ga0207675_100106483	Ga0207675_1001064832	136
442	3300026118	Ga0207675_100483113	Ga0207675_1004831132	136
443	3300026121	Ga0207683_10002908	Ga0207683_100029086	136
444	3300026121	Ga0207683_10014923	Ga0207683_100149237	136
445	3300026142	Ga0207698_10021999	Ga0207698_100219995	136
446	3300027866	Ga0209813_10074638	Ga0209813_100746381	136
447	3300028379	Ga0268266_10005705	Ga0268266_100057058	136
448	3300028379	Ga0268266_10122835	Ga0268266_101228352	136
449	3300028379	Ga0268266_11516814	Ga0268266_115168141	136
450	3300028380	Ga0268265_10000016	Ga0268265_10000016122	136
451	3300028380	Ga0268265_10050188	Ga0268265_100501884	136
452	3300028380	Ga0268265_10076257	Ga0268265_100762573	136
453	3300028381	Ga0268264_10000026	Ga0268264_10000026124	136
454	3300028381	Ga0268264_10006043	Ga0268264_100060435	136
455	3300031824	Ga0307413_10256829	Ga0307413_102568292	136
456	3300031852	Ga0307410_10020801	Ga0307410_100208016	136
457	3300031889	Ga0326468_10026548	Ga0326468_100265482	136
458	3300031903	Ga0307407_11447329	Ga0307407_114473291	136
459	3300031911	Ga0307412_10393467	Ga0307412_103934672	136
460	3300031995	Ga0307409_100041854	Ga0307409_1000418542	136
461	3300032002	Ga0307416_101384215	Ga0307416_1013842152	136
462	3300032005	Ga0307411_10091731	Ga0307411_100917313	136
463	3300034817	Ga0373948_0036858	Ga0373948_0036858_509_973	136
464	3300035112	Ga0373932_0121213	Ga0373932_0121213_152_616	136
465	3300035114	Ga0373939_0106580	Ga0373939_0106580_227_637	136
466	3300035207	Ga0373942_0011706	Ga0373942_0011706_851_1315	136
467	3300037471	Ga0395905_0883832	Ga0395905_0883832_305_769	136
468	3300041411	Ga0439466_0046122	Ga0439466_0046122_235_708	136
469	3300041411	Ga0439466_0243545	Ga0439466_0243545_11_520	136
470	3300041413	Ga0439465_0007534	Ga0439465_0007534_262_735	136
471	3300041498	Ga0451841_0706611	Ga0451841_0706611_44_514	136
472	3300041511	Ga0451855_0158425	Ga0451855_0158425_304_768	136
473	3300042435	Ga0439434_0036587	Ga0439434_0036587_597_1070	136
474	3300042436	Ga0439435_0107976	Ga0439435_0107976_112_576	136
475	3300044658	Ga0466972_0042154	Ga0466972_0042154_752_1216	136
476	3300044658	Ga0466972_0053371	Ga0466972_0053371_682_1146	136
477	3300044658	Ga0466972_0099690	Ga0466972_0099690_755_1219	136
478	3300044658	Ga0466972_0369505	Ga0466972_0369505_93_557	136
479	3300044683	Ga0466965_0107182	Ga0466965_0107182_141_605	136
480	3300044683	Ga0466965_0410168	Ga0466965_0410168_210_674	136
481	3300044706	Ga0466964_0074746	Ga0466964_0074746_54_518	136
482	3300044706	Ga0466964_0193369	Ga0466964_0193369_469_933	136
483	3300044719	Ga0466971_0006048	Ga0466971_0006048_1374_1838	136
484	3300044735	Ga0466968_0039931	Ga0466968_0039931_279_743	136
485	3300044765	Ga0466970_0262587	Ga0466970_0262587_108_572	136
486	3300044901	Ga0466960_0037360	Ga0466960_0037360_1307_1771	136
487	3300045836	Ga0466958_0072674	Ga0466958_0072674_839_1303	136
488	3300045976	Ga0466967_0076344	Ga0466967_0076344_764_1228	136
489	3300045976	Ga0466967_0953722	Ga0466967_0953722_245_709	136
490	3300046460	Ga0495638_0007753	Ga0495638_0007753_5065_5529	136
491	3300046506	Ga0495583_0061078	Ga0495583_0061078_374_838	136
492	3300046528	Ga0495642_0441454	Ga0495642_0441454_91_555	136
493	3300046616	Ga0495668_0155627	Ga0495668_0155627_510_974	136
494	3300046663	Ga0495635_0344636	Ga0495635_0344636_176_640	136
495	3300046684	Ga0495669_0345909	Ga0495669_0345909_286_696	136
496	3300046692	Ga0495671_0557193	Ga0495671_0557193_72_536	136
497	3300046694	Ga0495649_0080084	Ga0495649_0080084_268_732	136
498	3300046694	Ga0495649_0496965	Ga0495649_0496965_53_517	136
499	3300047323	Ga0495683_0387765	Ga0495683_0387765_33_497	136
500	3300048903	Ga0496100_0538021	Ga0496100_0538021_294_764	136
501	3300048903	Ga0496100_1317433	Ga0496100_1317433_55_528	136
502	3300048904	Ga0496101_0017747	Ga0496101_0017747_3483_3947	136
503	3300048904	Ga0496101_1410040	Ga0496101_1410040_30_503	136
504	3300048905	Ga0496102_0000124	Ga0496102_0000124_68814_69278	136
505	3300048905	Ga0496102_0005205	Ga0496102_0005205_6376_6840	136
506	3300048905	Ga0496102_0028603	Ga0496102_0028603_3132_3596	136
507	3300048905	Ga0496102_0179710	Ga0496102_0179710_411_881	136
508	3300048905	Ga0496102_0710090	Ga0496102_0710090_422_895	136
509	3300048906	Ga0496103_0000508	Ga0496103_0000508_13223_13687	136
510	3300048906	Ga0496103_0003040	Ga0496103_0003040_6686_7150	136
511	3300048906	Ga0496103_0026040	Ga0496103_0026040_1941_2411	136
512	3300048907	Ga0496104_0056389	Ga0496104_0056389_1111_1521	136
513	3300048907	Ga0496104_0133709	Ga0496104_0133709_123_593	136
514	3300048907	Ga0496104_0322448	Ga0496104_0322448_438_911	136
515	3300048908	Ga0496105_0111625	Ga0496105_0111625_246_716	136
516	3300048909	Ga0496106_0001551	Ga0496106_0001551_16305_16769	136
517	3300048909	Ga0496106_1205355	Ga0496106_1205355_16_480	136
518	3300048910	Ga0496107_0003635	Ga0496107_0003635_7858_8322	136
519	3300048910	Ga0496107_0069942	Ga0496107_0069942_1965_2429	136
520	3300048911	Ga0496108_0000404	Ga0496108_0000404_28450_28860	136
521	3300048911	Ga0496108_0780065	Ga0496108_0780065_126_596	136
522	3300048912	Ga0496109_0097266	Ga0496109_0097266_314_724	136
523	3300048912	Ga0496109_0679925	Ga0496109_0679925_61_531	136
524	3300048913	Ga0496110_0315208	Ga0496110_0315208_786_1196	136
525	3300048914	Ga0496111_0089920	Ga0496111_0089920_1527_1997	136
526	3300048915	Ga0496112_0013285	Ga0496112_0013285_558_968	136
527	3300048915	Ga0496112_0071213	Ga0496112_0071213_1993_2466	136
528	3300048915	Ga0496112_0142184	Ga0496112_0142184_808_1278	136
529	3300048916	Ga0496113_0024830	Ga0496113_0024830_3506_3916	136
530	3300048917	Ga0496114_0006211	Ga0496114_0006211_2090_2554	136
531	3300048917	Ga0496114_0458826	Ga0496114_0458826_356_829	136
532	3300048918	Ga0496115_0001218	Ga0496115_0001218_167_631	136
533	3300048918	Ga0496115_1072335	Ga0496115_1072335_67_540	136
534	3300048919	Ga0496116_0056677	Ga0496116_0056677_1055_1519	136
535	3300048920	Ga0496117_0013000	Ga0496117_0013000_440_904	136
536	3300048921	Ga0496118_0001433	Ga0496118_0001433_17230_17694	136
537	3300048921	Ga0496118_0001878	Ga0496118_0001878_16079_16543	136
538	3300048922	Ga0496119_0009124	Ga0496119_0009124_204_668	136
539	3300048922	Ga0496119_0173937	Ga0496119_0173937_210_680	136
540	3300048927	Ga0496124_0112298	Ga0496124_0112298_927_1391	136
541	3300048928	Ga0496125_0014062	Ga0496125_0014062_100_564	136
542	3300048929	Ga0496126_0001833	Ga0496126_0001833_21073_21537	136
543	3300048929	Ga0496126_0003135	Ga0496126_0003135_7090_7554	136
544	3300048929	Ga0496126_0276460	Ga0496126_0276460_656_1120	136
545	3300048929	Ga0496126_1193613	Ga0496126_1193613_139_549	136
546	3300049571	Ga0501034_0077266	Ga0501034_0077266_582_1055	136
547	3300049579	Ga0501043_0417403	Ga0501043_0417403_263_727	136
548	3300049822	Ga0501035_0200889	Ga0501035_0200889_691_1155	136
549	3300050489	nmdc:mga03683_49514_c1	nmdc:mga03683_49514_c1_262_726	136
550	3300050489	nmdc:mga03683_61821_c1	nmdc:mga03683_61821_c1_440_904	136
551	3300050489	nmdc:mga03683_94142_c1	nmdc:mga03683_94142_c1_665_1138	136
552	3300050490	nmdc:mga03n38_15312_c1	nmdc:mga03n38_15312_c1_1125_1589	136
553	3300050490	nmdc:mga03n38_16316_c1	nmdc:mga03n38_16316_c1_149_613	136
554	3300050490	nmdc:mga03n38_187435_c1	nmdc:mga03n38_187435_c1_32_496	136
555	3300050490	nmdc:mga03n38_32320_c1	nmdc:mga03n38_32320_c1_1234_1698	136
556	3300050490	nmdc:mga03n38_3675_c1	nmdc:mga03n38_3675_c1_1512_1985	136
557	3300050490	nmdc:mga03n38_482470_c1	nmdc:mga03n38_482470_c1_42_506	136
558	3300050490	nmdc:mga03n38_523166_c1	nmdc:mga03n38_523166_c1_149_622	136
559	3300050490	nmdc:mga03n38_754_c1	nmdc:mga03n38_754_c1_3103_3567	136
560	3300050491	nmdc:mga00v17_11522_c1	nmdc:mga00v17_11522_c1_2022_2486	136
561	3300050491	nmdc:mga00v17_120424_c1	nmdc:mga00v17_120424_c1_270_734	136
562	3300050491	nmdc:mga00v17_1794_c1	nmdc:mga00v17_1794_c1_7581_8054	136
563	3300050491	nmdc:mga00v17_21140_c1	nmdc:mga00v17_21140_c1_1509_1973	136
564	3300050491	nmdc:mga00v17_416917_c1	nmdc:mga00v17_416917_c1_166_630	136
565	3300050491	nmdc:mga00v17_453072_c1	nmdc:mga00v17_453072_c1_47_511	136
566	3300050491	nmdc:mga00v17_469196_c1	nmdc:mga00v17_469196_c1_147_611	136
567	3300050491	nmdc:mga00v17_58870_c1	nmdc:mga00v17_58870_c1_1115_1579	136
568	3300050491	nmdc:mga00v17_77022_c1	nmdc:mga00v17_77022_c1_76_540	136
569	3300050492	nmdc:mga0yw44_13066_c1	nmdc:mga0yw44_13066_c1_3318_3782	136
570	3300050492	nmdc:mga0yw44_149837_c1	nmdc:mga0yw44_149837_c1_602_1066	136
571	3300050492	nmdc:mga0yw44_239549_c1	nmdc:mga0yw44_239549_c1_576_1040	136
572	3300050492	nmdc:mga0yw44_83604_c1	nmdc:mga0yw44_83604_c1_1450_1914	136
573	3300050494	nmdc:mga06z11_192438_c1	nmdc:mga06z11_192438_c1_463_927	136
574	3300050494	nmdc:mga06z11_79233_c1	nmdc:mga06z11_79233_c1_150_623	136
575	3300050494	nmdc:mga06z11_96051_c1	nmdc:mga06z11_96051_c1_275_739	136
576	3300050495	nmdc:mga04h51_170485_c1	nmdc:mga04h51_170485_c1_59_532	136
577	3300050496	nmdc:mga07m45_20271_c1	nmdc:mga07m45_20271_c1_663_1127	136
578	3300050496	nmdc:mga07m45_269658_c1	nmdc:mga07m45_269658_c1_150_620	136
579	3300050496	nmdc:mga07m45_36614_c1	nmdc:mga07m45_36614_c1_1863_2327	136
580	3300050496	nmdc:mga07m45_67930_c1	nmdc:mga07m45_67930_c1_813_1277	136
581	3300050496	nmdc:mga07m45_815_c1	nmdc:mga07m45_815_c1_9106_9570	136
582	3300050507	nmdc:mga05p37_97327_c1	nmdc:mga05p37_97327_c1_2850_3314	136
583	3300050508	nmdc:mga09592_449835_c1	nmdc:mga09592_449835_c1_33_497	136
584	3300050509	nmdc:mga0qj67_7487_c1	nmdc:mga0qj67_7487_c1_3957_4421	136
585	3300050510	nmdc:mga06r32_58363_c1	nmdc:mga06r32_58363_c1_1263_1727	136
586	3300050516	nmdc:mga0sz30_175182_c1	nmdc:mga0sz30_175182_c1_56_520	136
587	3300050516	nmdc:mga0sz30_196379_c1	nmdc:mga0sz30_196379_c1_308_772	136
588	3300050516	nmdc:mga0sz30_3222_c1	nmdc:mga0sz30_3222_c1_3896_4369	136
589	3300050516	nmdc:mga0sz30_3324_c1	nmdc:mga0sz30_3324_c1_4921_5385	136
590	3300050516	nmdc:mga0sz30_81200_c1	nmdc:mga0sz30_81200_c1_867_1340	136
591	3300053104	Ga0500556_0005281	Ga0500556_0005281_841_1305	136
592	3300053130	Ga0500642_0320778	Ga0500642_0320778_134_598	136
593	3300053151	Ga0500604_0145699	Ga0500604_0145699_176_640	136
594	3300053153	Ga0500616_0016819	Ga0500616_0016819_3227_3691	136
595	3300061719	Ga0466962_0016048	Ga0466962_0016048_2811_3275	136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

4

131

0.95 PF08534

Redoxin

2

147

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3drn-assembly2.cif.gz_B	the crystal structure of bcp1 from sulfolobus sulfataricus	0.9266	2	135
5epf-assembly1.cif.gz_A	crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis	0.9007	2	132
4eo3-assembly1.cif.gz_B	peroxiredoxin nitroreductase fusion enzyme	0.8787	8	135
3drn-assembly2.cif.gz_B	the crystal structure of bcp1 from sulfolobus sulfataricus	0.8749	2	135
3ixr-assembly1.cif.gz_A	crystal structure of xylella fastidiosa prxq c47s mutant	0.8682	2	134

ID	Description	Score	Start	End	Superfamily
3drnB00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9266	2	135	3.40.30.10
af_Q559T9_1_157_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9187	10	136	3.40.30.10
af_Q54W30_4_152_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9176	4	136	3.40.30.10
af_Q54W09_3_152_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9147	2	132	3.40.30.10
af_I1MS47_66_213_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9107	6	132	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0N9HWP4-F1-model_v4	thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase)	0.9439	2	132	GO:0005737 GO:0008379 GO:0034599 GO:0045454
AF-A0A1I5Z0H8-F1-model_v4	thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase)	0.9396	2	133	GO:0005737 GO:0008379 GO:0034599 GO:0045454
AF-A0A7J3RXP4-F1-model_v4	thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase)	0.939	2	135	GO:0005737 GO:0008379 GO:0009579 GO:0034599 GO:0045454
AF-A0A512RSE9-F1-model_v4	thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase)	0.9367	4	132	GO:0005737 GO:0008379 GO:0009579 GO:0034599 GO:0045454
AF-A0A7C5FU43-F1-model_v4	thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase)	0.9347	9	135	GO:0005737 GO:0008379 GO:0009579 GO:0034599 GO:0045454

Feature Viewer

pLDDT	pTM	Quality
88.01	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467466

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00578

AhpC-TSA

AhpC/TSA family

4

131

0.95

PF08534

Redoxin

Redoxin

2

147

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map