F467462

General Info

Members Datasets Scaffolds Average Seq Length
595 488 256 250

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0005799|Ga0439449_0005799_3121_4032
Length 293
Sequence MKDVSFQLYSARNFPPFAEVLAAIGSAGYTQVEGYGALYAALSDAEIADFKAGLDRNGLSMPTAHFGLDMLESDAPRVLEIAEALGIRAIYCPYLMPDQRPMDAGGWRAFGARLQAAGKPFRDAGLDFGWHNHDFEFHALADGSVPLDQIFAGGPDLSWEADIAWIVRGGGDPFAWISKYPTRITAVHVKDIAPKGENADEDGWADVGEGTLDWKALIQALSRTSAKYFVAEHDNPSDFRRFAKRSLASMRQYLHDLFQACSTVQGHSDRRLCRHQIRRDCAEHRCAARQSGS

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
15 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
16 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
17 2516143018 Ensifer sp. BR816 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
20 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
21 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
24 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
25 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
26 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
27 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
28 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
29 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
30 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
33 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
34 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
35 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
36 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
37 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
38 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
39 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
40 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
41 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
42 2643221557 Ensifer sp. Root558 Isolate Unclassified
43 2643221568 Rhizobium sp. Root564 Isolate Unclassified
44 2643221582 Rhizobium sp. Root651 Isolate Unclassified
45 2643221607 Rhizobium sp. Root73 Isolate Unclassified
46 2643221610 Ensifer sp. Root74 Isolate Unclassified
47 2643221618 Ensifer sp. Root231 Isolate Unclassified
48 2643221626 Ensifer sp. Root31 Isolate Unclassified
49 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
50 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
51 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
52 2643221655 Ensifer sp. Root1252 Isolate Unclassified
53 2643221659 Ensifer sp. Root127 Isolate Unclassified
54 2643221668 Ensifer sp. Root423 Isolate Unclassified
55 2643221675 Ensifer sp. Root1298 Isolate Unclassified
56 2643221680 Ensifer sp. Root1312 Isolate Unclassified
57 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
58 2643221688 Rhizobium sp. Root482 Isolate Unclassified
59 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
60 2643221693 Rhizobium sp. Root491 Isolate Unclassified
61 2643221698 Ensifer sp. Root142 Isolate Unclassified
62 2643221712 Ensifer sp. Root258 Isolate Unclassified
63 2643221718 Rhizobium sp. Root268 Isolate Unclassified
64 2643221719 Rhizobium sp. Root274 Isolate Unclassified
65 2643221723 Ensifer sp. Root278 Isolate Unclassified
66 2643221726 Ensifer sp. Root954 Isolate Unclassified
67 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
68 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
69 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
70 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
71 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
72 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
73 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
74 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
75 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
76 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
77 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
78 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
79 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
80 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
81 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
82 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
83 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
84 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
85 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
86 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
87 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
88 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
89 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
90 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
91 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
92 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
93 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
94 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
95 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
96 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
97 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
98 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
99 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
100 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
101 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
102 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
103 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
104 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
105 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
106 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
107 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
108 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
109 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
110 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
111 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
112 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
113 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
114 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
115 2844163670 Ensifer sp. 1H6 Isolate Unclassified
116 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
117 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
118 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
119 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
120 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
121 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
122 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
123 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
124 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
125 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
126 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
127 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
128 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
129 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
130 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
131 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
132 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
133 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
134 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
135 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
136 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
137 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
138 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
139 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
140 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
141 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
142 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
143 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
144 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
145 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
146 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
147 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
148 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
149 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
150 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
151 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
152 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
153 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
154 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
155 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
156 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
157 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
158 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
159 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
160 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
161 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
162 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
163 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
164 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
165 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
166 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
167 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
168 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
169 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
170 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
171 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
172 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
173 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
174 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
175 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
176 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
177 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
178 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
179 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
180 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
181 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
182 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
183 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
184 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
185 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
186 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
187 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
188 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
189 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
190 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
191 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
192 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
193 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
194 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
195 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
196 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
197 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
198 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
199 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
200 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
201 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
202 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
203 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
204 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
205 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
206 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
207 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
208 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
209 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
210 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
211 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
212 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
213 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
214 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
215 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
216 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
217 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
218 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
219 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
220 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
221 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
222 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
223 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
224 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
225 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
226 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
227 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
228 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
229 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
230 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
231 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
232 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
233 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
234 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
235 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
236 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
237 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
238 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
239 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
240 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
241 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
242 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
243 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
244 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
245 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
246 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
247 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
248 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
249 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
250 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
251 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
252 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
253 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
254 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
255 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
256 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
257 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
258 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
259 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
260 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
261 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
262 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
263 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
264 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
265 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
266 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
267 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
268 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
269 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
270 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
271 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
272 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
273 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
274 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
275 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
276 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
277 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
278 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
279 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
280 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
281 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
282 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
283 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
284 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
285 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
286 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
287 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
288 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
289 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
290 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
291 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
292 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
293 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
294 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
295 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
296 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
297 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
298 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
299 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
300 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
301 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
302 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
303 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
304 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
305 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
306 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
307 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
308 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
309 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
310 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
311 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
312 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
313 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
314 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
315 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
316 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
317 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
318 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
319 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
320 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
321 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
322 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
323 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
324 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
325 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
326 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
327 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
328 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
329 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
330 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
331 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
332 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
333 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
334 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
335 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
336 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
337 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
338 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
339 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
340 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
341 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
342 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
343 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
344 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
345 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
346 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
347 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
348 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
349 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
350 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
351 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
352 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
353 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
354 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
355 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
356 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
357 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
358 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
359 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
360 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
361 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
363 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
365 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
367 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
368 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
373 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
375 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
376 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
377 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
378 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
379 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
380 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
381 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
382 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
383 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
384 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
385 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
386 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
387 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
388 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
389 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
390 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
391 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
394 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
395 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
396 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
397 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
398 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
399 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
400 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
401 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
402 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
403 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
404 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
405 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
406 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
407 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
408 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
409 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
410 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
411 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
414 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
415 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
416 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
423 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
424 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
425 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
426 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
427 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
428 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
429 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
430 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
431 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
448 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
449 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
452 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
459 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
460 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
461 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
462 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
463 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
464 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
465 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
466 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
467 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
468 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
469 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
470 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
471 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
472 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
473 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
474 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
475 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
476 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
477 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
478 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
479 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
480 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
481 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
482 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
483 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
484 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
485 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
486 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
487 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
488 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 43.19
Metatranscriptomes 0
Isolates 56.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 11.26
Nodule 42.69
Rhizoplane 1.85
Rhizosphere 24.54
Stem 0
Stem Tuber 0
Unclassified 18.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1012450 3300002739 Bacteria 1120
2 JGI25159J45721_1000078 3300002987 Bacteria 46708
3 JGI25151J46595_10001940 3300003187 Bacteria 13108
4 JGI25151J46595_10007493 3300003187 Bacteria 5339
5 JGI25151J46595_10014053 3300003187 Bacteria 3583
6 JGI25151J46595_10092124 3300003187 Bacteria 840
7 JGI25160J50197_1000216 3300003354 Bacteria 46708
8 JGI25160J50197_1005522 3300003354 Bacteria 5247
9 JGI25161J50226_1000412 3300003374 Bacteria 20844
10 Ga0055526_1000594 3300003771 Bacteria 28489
11 Ga0055524_1001872 3300003775 Bacteria 11470
12 Ga0055536_1010645 3300003781 Bacteria 3621
13 Ga0055531_10019507 3300003794 Bacteria 2739
14 Ga0058692_1002834 3300003856 Bacteria 5678
15 Ga0055543_1000301 3300004625 Bacteria 35189
16 Ga0065165_1000717 3300005262 Bacteria 46746
17 Ga0065712_10075852 3300005290 Bacteria 3776
18 Ga0065715_10102543 3300005293 Bacteria 3098
19 Ga0070670_100001771 3300005331 Bacteria 17578
20 Ga0068853_100003331 3300005539 Bacteria 12297
21 Ga0068852_100626745 3300005616 Bacteria 1081
22 Ga0081455_10130901 3300005937 Bacteria 1962
23 Ga0081539_10000316 3300005985 Bacteria 107841
24 Ga0075365_10024574 3300006038 Bacteria 3802
25 Ga0075364_10011277 3300006051 Bacteria 5427
26 Ga0075364_10089251 3300006051 Bacteria 2044
27 Ga0075364_10205301 3300006051 Bacteria 1336
28 Ga0075364_10294290 3300006051 Bacteria 1105
29 Ga0075362_10004177 3300006177 Bacteria 5152
30 Ga0075362_10138728 3300006177 Bacteria 1161
31 Ga0075369_10047435 3300006186 Bacteria 1852
32 Ga0075369_10059587 3300006186 Bacteria 1663
33 Ga0075366_10102714 3300006195 Bacteria 1716
34 Ga0079104_1023854 3300006946 Bacteria 1620
35 Ga0099826_10000054 3300006948 Bacteria 71175
36 Ga0099826_10142108 3300006948 Bacteria 1385
37 Ga0157371_10000002 3300013102 Bacteria 665040
38 Ga0157370_10000286 3300013104 Bacteria 64173
39 Ga0171463_1003 3300013249 Bacteria 695693
40 Ga0157372_10161979 3300013307 Bacteria 2586
41 Ga0183363_1047 3300015690 Bacteria 39413
42 Ga0214544_1001682 3300021320 Bacteria 46508
43 Ga0214542_1001614 3300021321 Bacteria 46380
44 Ga0214542_1016791 3300021321 Bacteria 6921
45 Ga0214543_1000078 3300021327 Bacteria 119775
46 Ga0214543_1001395 3300021327 Bacteria 46435
47 Ga0228711_1000016 3300022739 Bacteria 126351
48 Ga0228710_1000013 3300022740 Bacteria 145976
49 Ga0209436_102562 3300025208 Bacteria 5363
50 Ga0209130_1000029 3300025284 Bacteria 323399
51 Ga0209130_1001013 3300025284 Bacteria 21788
52 Ga0209676_1009134 3300025292 Bacteria 4316
53 Ga0209025_1000119 3300025294 Bacteria 210606
54 Ga0209025_1000959 3300025294 Bacteria 43491
55 Ga0209025_1001079 3300025294 Bacteria 39549
56 Ga0209025_1001950 3300025294 Bacteria 23818
57 Ga0209025_1055126 3300025294 Bacteria 1540
58 Ga0209564_1000278 3300025295 Bacteria 105405
59 Ga0209758_1001450 3300025297 Bacteria 27915
60 Ga0209050_1006307 3300025298 Bacteria 7067
61 Ga0209256_1000042 3300025299 Bacteria 341821
62 Ga0209256_1002941 3300025299 Bacteria 12786
63 Ga0207426_1000074 3300025302 Bacteria 323399
64 Ga0207426_1000451 3300025302 Bacteria 65459
65 Ga0209257_1007900 3300025304 Bacteria 6254
66 Ga0209257_1048796 3300025304 Bacteria 1209
67 Ga0207650_10002483 3300025925 Bacteria 12829
68 Ga0207639_10022825 3300026041 Bacteria 4512
69 Ga0207678_10021809 3300026067 Bacteria 5618
70 Ga0209281_1000036 3300027111 Bacteria 369415
71 Ga0209281_1000047 3300027111 Bacteria 326514
72 Ga0209281_1000221 3300027111 Bacteria 122380
73 Ga0209281_1000453 3300027111 Bacteria 58584
74 Ga0209371_1000012 3300027312 Bacteria 748304
75 Ga0209371_1002509 3300027312 Bacteria 10168
76 Ga0209282_1000041 3300027666 Bacteria 122268
77 Ga0209282_1000140 3300027666 Bacteria 42807
78 Ga0209282_1146342 3300027666 Bacteria 1147
79 Ga0209813_10005946 3300027866 Bacteria 2995
80 Ga0307515_10000023 3300028794 Bacteria 400846
81 Ga0307515_10046287 3300028794 Bacteria 6654
82 Ga0268256_1000013 3300030500 Bacteria 752103
83 Ga0316181_1124615 3300030744 Bacteria 4431
84 Ga0307513_10003030 3300031456 Bacteria 22903
85 Ga0307408_100122433 3300031548 Bacteria 2017
86 Ga0307408_100414181 3300031548 Bacteria 1160
87 Ga0307408_100830152 3300031548 Bacteria 841
88 Ga0307405_10061347 3300031731 Bacteria 2377
89 Ga0307406_10556939 3300031901 Bacteria 939
90 Ga0315914_1000030 3300031967 Bacteria 102599
91 Ga0307409_100113846 3300031995 Bacteria 2275
92 Ga0307409_100443880 3300031995 Bacteria 1251
93 Ga0307416_100085503 3300032002 Bacteria 2685
94 Ga0307416_100170370 3300032002 Bacteria 2026
95 Ga0307414_10403856 3300032004 Bacteria 1187
96 Ga0315913_1000017 3300033430 Bacteria 102835
97 Ga0315915_1000017 3300033464 Bacteria 148111
98 Ga0373937_0331826 3300036401 Bacteria 1440
99 Ga0373925_0006563 3300037068 Bacteria 8549
100 Ga0395899_0004825 3300037312 Bacteria 10499
101 Ga0395901_0252383 3300038443 Bacteria 1837
102 Ga0400483_094012 3300039062 Bacteria 2585
103 Ga0436365_0038853 3300039437 Bacteria 1669
104 Ga0439436_0001642 3300041404 Bacteria 6526
105 Ga0439436_0039125 3300041404 Bacteria 1363
106 Ga0439438_030013 3300041405 Bacteria 1452
107 Ga0439439_0010918 3300041406 Bacteria 2178
108 Ga0439465_0040646 3300041413 Bacteria 1503
109 Ga0439449_0005799 3300042007 Bacteria 4721
110 Ga0439452_042476 3300042010 Bacteria 1065
111 Ga0439457_016503 3300042014 Bacteria 1645
112 Ga0450920_011793 3300042122 Bacteria 1632
113 Ga0450906_016895 3300042145 Bacteria 1319
114 Ga0439434_0045950 3300042435 Bacteria 1347
115 Ga0495650_0106826 3300046471 Bacteria 1044
116 Ga0495606_0286344 3300046507 Bacteria 899
117 Ga0495610_0003008 3300046512 Bacteria 13529
118 Ga0495648_0123277 3300046524 Bacteria 1389
119 Ga0495654_0000090 3300046530 Bacteria 101947
120 Ga0495640_0056689 3300046533 Bacteria 2676
121 Ga0495622_0005922 3300046557 Bacteria 5680
122 Ga0495625_0050368 3300046660 Bacteria 2989
123 Ga0495588_0011344 3300046674 Bacteria 4178
124 Ga0495613_0454023 3300046689 Bacteria 868
125 Ga0495671_0023593 3300046692 Bacteria 3213
126 Ga0495604_0048763 3300047317 Bacteria 3293
127 Ga0495676_0296351 3300047321 Bacteria 1092
128 Ga0495681_0000886 3300047470 Bacteria 23149
129 Ga0495686_0053584 3300047472 Bacteria 2528
130 Ga0496100_0196928 3300048903 Bacteria 1466
131 Ga0496110_0444431 3300048913 Bacteria 1182
132 Ga0496113_0022885 3300048916 Bacteria 4427
133 Ga0496114_0056807 3300048917 Bacteria 3267
134 Ga0496116_0076562 3300048919 Bacteria 2095
135 Ga0496117_0000016 3300048920 Bacteria 523642
136 Ga0496117_0006313 3300048920 Bacteria 12058
137 Ga0496117_0030058 3300048920 Bacteria 4176
138 Ga0496117_0082485 3300048920 Bacteria 2106
139 Ga0496118_0000535 3300048921 Bacteria 62444
140 Ga0496118_0036469 3300048921 Bacteria 3975
141 Ga0496118_0088052 3300048921 Bacteria 2150
142 Ga0496119_0021558 3300048922 Bacteria 4651
143 Ga0496119_0085880 3300048922 Bacteria 1800
144 Ga0496120_0000056 3300048923 Bacteria 180367
145 Ga0496120_0013734 3300048923 Bacteria 5437
146 Ga0496121_0000001 3300048924 Bacteria 1830318
147 Ga0496121_0003418 3300048924 Bacteria 22706
148 Ga0496121_0025293 3300048924 Bacteria 5640
149 Ga0496121_0132578 3300048924 Bacteria 1862
150 Ga0496122_0000002 3300048925 Bacteria 905834
151 Ga0496122_0000525 3300048925 Bacteria 79294
152 Ga0496122_0049793 3300048925 Bacteria 3202
153 Ga0496123_0000002 3300048926 Bacteria 1811682
154 Ga0496123_0001014 3300048926 Bacteria 42878
155 Ga0496123_0045707 3300048926 Bacteria 2980
156 Ga0496124_0002629 3300048927 Bacteria 23098
157 Ga0496124_0003159 3300048927 Bacteria 20374
158 Ga0496124_0010219 3300048927 Bacteria 9534
159 Ga0496124_0021431 3300048927 Bacteria 5954
160 Ga0496124_0060519 3300048927 Bacteria 3177
161 Ga0496124_0259440 3300048927 Bacteria 1280
162 Ga0496125_0000001 3300048928 Bacteria 1766138
163 Ga0496125_0002081 3300048928 Bacteria 26974
164 Ga0496125_0110683 3300048928 Bacteria 1990
165 Ga0496125_0152776 3300048928 Bacteria 1582
166 Ga0496126_0000059 3300048929 Bacteria 267449
167 Ga0496126_0001019 3300048929 Bacteria 47578
168 Ga0496126_0060207 3300048929 Bacteria 3416
169 Ga0496126_0111776 3300048929 Bacteria 2379
170 Ga0496126_0317864 3300048929 Bacteria 1280
171 Ga0501031_0045506 3300049568 Bacteria 2863
172 Ga0501031_0058776 3300049568 Bacteria 2506
173 Ga0501032_0010722 3300049569 Bacteria 6596
174 Ga0501032_0077667 3300049569 Bacteria 2210
175 Ga0501032_0147637 3300049569 Bacteria 1547
176 Ga0501032_0150818 3300049569 Bacteria 1529
177 Ga0501032_0236134 3300049569 Bacteria 1188
178 Ga0501033_0014687 3300049570 Bacteria 5945
179 Ga0501033_0022024 3300049570 Bacteria 4807
180 Ga0501034_0153333 3300049571 Bacteria 2279
181 Ga0501034_0179951 3300049571 Bacteria 2079
182 Ga0501034_0218184 3300049571 Bacteria 1860
183 Ga0501034_0362834 3300049571 Bacteria 1376
184 Ga0501036_0224235 3300049572 Bacteria 1578
185 Ga0501037_0000576 3300049573 Bacteria 28887
186 Ga0501037_0069832 3300049573 Bacteria 2557
187 Ga0501037_0137751 3300049573 Bacteria 1748
188 Ga0501037_0447533 3300049573 Bacteria 881
189 Ga0501038_0180703 3300049574 Bacteria 1702
190 Ga0501043_0000003 3300049579 Bacteria 318844
191 Ga0501043_0113194 3300049579 Bacteria 2131
192 Ga0501043_0133085 3300049579 Bacteria 1948
193 Ga0501043_0513885 3300049579 Bacteria 893
194 Ga0501046_0074822 3300049580 Bacteria 2627
195 Ga0501046_0220500 3300049580 Bacteria 1404
196 Ga0501047_0029412 3300049581 Bacteria 5298
197 Ga0501047_0106734 3300049581 Bacteria 2681
198 Ga0501047_0210804 3300049581 Bacteria 1801
199 Ga0501067_0078713 3300049583 Bacteria 1827
200 Ga0501068_0016892 3300049584 Bacteria 4213
201 Ga0501069_0000002 3300049585 Bacteria 269636
202 Ga0501070_0002398 3300049586 Bacteria 16440
203 Ga0501070_0012207 3300049586 Bacteria 7250
204 Ga0501070_0020997 3300049586 Bacteria 5478
205 Ga0501070_0059881 3300049586 Bacteria 3156
206 Ga0501070_0266342 3300049586 Bacteria 1400
207 Ga0501070_0404145 3300049586 Bacteria 1104
208 Ga0501073_0071914 3300049589 Bacteria 2409
209 Ga0501073_0084588 3300049589 Bacteria 2207
210 Ga0501073_0353293 3300049589 Bacteria 1015
211 Ga0501074_0000032 3300049590 Bacteria 65565
212 Ga0501074_0160758 3300049590 Bacteria 1604
213 Ga0501076_0316493 3300049592 Bacteria 1280
214 Ga0501217_015168 3300049661 Bacteria 1752
215 Ga0501079_0097941 3300049741 Bacteria 2274
216 Ga0501080_0003886 3300049742 Bacteria 13223
217 Ga0501080_0028207 3300049742 Bacteria 5220
218 Ga0501080_0052733 3300049742 Bacteria 3785
219 Ga0501080_0645167 3300049742 Bacteria 937
220 Ga0501083_0000819 3300049744 Bacteria 20356
221 Ga0501035_0003327 3300049822 Bacteria 15402
222 Ga0501035_0007806 3300049822 Bacteria 9997
223 Ga0501035_0013206 3300049822 Bacteria 7622
224 Ga0501035_0029283 3300049822 Bacteria 5021
225 Ga0501035_0096606 3300049822 Bacteria 2596
226 Ga0501035_0458699 3300049822 Bacteria 1053
227 Ga0501044_0000161 3300049823 Bacteria 83309
228 Ga0501044_0085828 3300049823 Bacteria 3180
229 Ga0501044_0161833 3300049823 Bacteria 2214
230 Ga0501044_0371125 3300049823 Bacteria 1347
231 nmdc:mga03683_19297_c1 3300050489 Bacteria 2602
232 nmdc:mga03683_57022_c1 3300050489 Bacteria 1643
233 nmdc:mga00v17_156_c1 3300050491 Bacteria 40197
234 nmdc:mga00v17_189481_c1 3300050491 Bacteria 1328
235 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
236 nmdc:mga00v17_8320_c1 3300050491 Bacteria 5581
237 nmdc:mga0yw44_165196_c1 3300050492 Bacteria 1451
238 nmdc:mga0yw44_23854_c1 3300050492 Bacteria 3453
239 nmdc:mga0a205_379208_c1 3300050515 Bacteria 1279
240 nmdc:mga0sz30_112036_c1 3300050516 Bacteria 1196
241 nmdc:mga0sz30_14730_c1 3300050516 Bacteria 3083
242 nmdc:mga0sz30_2395_c1 3300050516 Bacteria 6693
243 Ga0495601_0200492 3300053077 Bacteria 1304
244 Ga0500654_053933 3300053099 Bacteria 2133
245 Ga0500560_022567 3300053107 Bacteria 1814
246 Ga0500618_002658 3300053125 Bacteria 6573
247 Ga0500561_0000065 3300053137 Bacteria 21109
248 Ga0500590_076724 3300053148 Bacteria 1650
249 Ga0500604_0100765 3300053151 Bacteria 952
250 Ga0500616_0081111 3300053153 Bacteria 1630
251 Ga0500624_000733 3300053157 Bacteria 8098
252 Ga0500634_0053112 3300053161 Bacteria 2175
253 Ga0500636_0000034 3300053177 Bacteria 72555
254 Ga0500636_0029235 3300053177 Bacteria 3255
255 Ga0500636_0249858 3300053177 Bacteria 905
256 Ga0501082_0072687 3300060353 Bacteria 2962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0078713 Ga0501067_0078713_1121_1804 226
2 3300046557 Ga0495622_0005922 Ga0495622_0005922_878_1639 235
3 3300049573 Ga0501037_0137751 Ga0501037_0137751_145_891 235
4 3300049580 Ga0501046_0074822 Ga0501046_0074822_408_1154 235
5 3300049581 Ga0501047_0210804 Ga0501047_0210804_536_1282 235
6 3300049586 Ga0501070_0404145 Ga0501070_0404145_206_952 235
7 3300049822 Ga0501035_0096606 Ga0501035_0096606_342_1088 235
8 3300032004 Ga0307414_10403856 Ga0307414_104038561 236
9 3300046524 Ga0495648_0123277 Ga0495648_0123277_598_1359 237
10 3300046533 Ga0495640_0056689 Ga0495640_0056689_858_1619 237
11 3300046689 Ga0495613_0454023 Ga0495613_0454023_34_795 237
12 3300047317 Ga0495604_0048763 Ga0495604_0048763_435_1196 237
13 3300047321 Ga0495676_0296351 Ga0495676_0296351_151_912 237
14 3300053077 Ga0495601_0200492 Ga0495601_0200492_219_980 237
15 3300053148 Ga0500590_076724 Ga0500590_076724_765_1526 237
16 3300053177 Ga0500636_0249858 Ga0500636_0249858_28_789 237
17 3300046471 Ga0495650_0106826 Ga0495650_0106826_264_1025 239
18 3300031995 Ga0307409_100443880 Ga0307409_1004438802 241
19 iso_pu_bacteria 2757320392 2757572115 243
20 3300005616 Ga0068852_100626745 Ga0068852_1006267451 244
21 3300037312 Ga0395899_0004825 Ga0395899_0004825_5855_6652 244
22 3300038443 Ga0395901_0252383 Ga0395901_0252383_803_1600 244
23 3300046507 Ga0495606_0286344 Ga0495606_0286344_66_827 244
24 iso_pu_bacteria 2765235802 2765468596 244
25 iso_pu_bacteria 2767802442 2770198896 244
26 iso_pu_bacteria 2775506902 2776272877 244
27 iso_pu_bacteria 2775506904 2776282280 244
28 iso_pu_bacteria 2839993093 2839996552 244
29 iso_pu_bacteria 2840764183 2840770301 244
30 iso_pu_bacteria 2894652903 2894656811 244
31 iso_pu_bacteria 2904578770 2904582499 244
32 iso_pu_bacteria 2919119836 2919123978 244
33 iso_pu_bacteria 3002141150 3002145523 244
34 iso_pu_bacteria 2551306087 2551698098 245
35 iso_pu_bacteria 2551306087 2551699981 245
36 iso_pu_bacteria 2551306089 2551713205 245
37 iso_pu_bacteria 2551306090 2551722513 245
38 iso_pu_bacteria 8045864390 8045867858 245
39 3300005290 Ga0065712_10075852 Ga0065712_100758522 247
40 3300005293 Ga0065715_10102543 Ga0065715_101025432 247
41 3300013307 Ga0157372_10161979 Ga0157372_101619793 247
42 3300026067 Ga0207678_10021809 Ga0207678_100218092 247
43 3300039062 Ga0400483_094012 Ga0400483_094012_1448_2194 247
44 3300046692 Ga0495671_0023593 Ga0495671_0023593_1132_1878 247
45 3300048913 Ga0496110_0444431 Ga0496110_0444431_407_1168 247
46 3300048927 Ga0496124_0003159 Ga0496124_0003159_18675_19430 247
47 3300049568 Ga0501031_0058776 Ga0501031_0058776_565_1311 247
48 3300049569 Ga0501032_0010722 Ga0501032_0010722_795_1541 247
49 3300049569 Ga0501032_0147637 Ga0501032_0147637_44_790 247
50 3300049569 Ga0501032_0150818 Ga0501032_0150818_26_793 247
51 3300049569 Ga0501032_0236134 Ga0501032_0236134_291_1037 247
52 3300049570 Ga0501033_0014687 Ga0501033_0014687_1978_2724 247
53 3300049570 Ga0501033_0022024 Ga0501033_0022024_423_1169 247
54 3300049571 Ga0501034_0179951 Ga0501034_0179951_479_1225 247
55 3300049571 Ga0501034_0362834 Ga0501034_0362834_382_1128 247
56 3300049572 Ga0501036_0224235 Ga0501036_0224235_519_1286 247
57 3300049573 Ga0501037_0000576 Ga0501037_0000576_22315_23061 247
58 3300049573 Ga0501037_0069832 Ga0501037_0069832_508_1254 247
59 3300049573 Ga0501037_0447533 Ga0501037_0447533_78_824 247
60 3300049574 Ga0501038_0180703 Ga0501038_0180703_514_1260 247
61 3300049579 Ga0501043_0000003 Ga0501043_0000003_240733_241479 247
62 3300049579 Ga0501043_0113194 Ga0501043_0113194_684_1451 247
63 3300049579 Ga0501043_0513885 Ga0501043_0513885_40_786 247
64 3300049580 Ga0501046_0220500 Ga0501046_0220500_479_1225 247
65 3300049581 Ga0501047_0029412 Ga0501047_0029412_3306_4052 247
66 3300049581 Ga0501047_0106734 Ga0501047_0106734_460_1206 247
67 3300049584 Ga0501068_0016892 Ga0501068_0016892_991_1737 247
68 3300049585 Ga0501069_0000002 Ga0501069_0000002_4847_5593 247
69 3300049586 Ga0501070_0002398 Ga0501070_0002398_6281_7027 247
70 3300049586 Ga0501070_0012207 Ga0501070_0012207_2647_3393 247
71 3300049586 Ga0501070_0020997 Ga0501070_0020997_2933_3679 247
72 3300049586 Ga0501070_0059881 Ga0501070_0059881_1270_2016 247
73 3300049586 Ga0501070_0266342 Ga0501070_0266342_195_962 247
74 3300049589 Ga0501073_0071914 Ga0501073_0071914_1021_1767 247
75 3300049589 Ga0501073_0084588 Ga0501073_0084588_956_1702 247
76 3300049589 Ga0501073_0353293 Ga0501073_0353293_168_935 247
77 3300049590 Ga0501074_0000032 Ga0501074_0000032_59405_60151 247
78 3300049590 Ga0501074_0160758 Ga0501074_0160758_45_791 247
79 3300049592 Ga0501076_0316493 Ga0501076_0316493_306_1052 247
80 3300049741 Ga0501079_0097941 Ga0501079_0097941_310_1056 247
81 3300049742 Ga0501080_0003886 Ga0501080_0003886_3506_4252 247
82 3300049742 Ga0501080_0028207 Ga0501080_0028207_1613_2359 247
83 3300049742 Ga0501080_0052733 Ga0501080_0052733_862_1608 247
84 3300049742 Ga0501080_0645167 Ga0501080_0645167_10_756 247
85 3300049744 Ga0501083_0000819 Ga0501083_0000819_13810_14556 247
86 3300049822 Ga0501035_0003327 Ga0501035_0003327_4329_5075 247
87 3300049822 Ga0501035_0007806 Ga0501035_0007806_6055_6801 247
88 3300049822 Ga0501035_0013206 Ga0501035_0013206_6078_6824 247
89 3300049822 Ga0501035_0029283 Ga0501035_0029283_2964_3710 247
90 3300049823 Ga0501044_0000161 Ga0501044_0000161_6019_6765 247
91 3300049823 Ga0501044_0085828 Ga0501044_0085828_1152_1898 247
92 3300049823 Ga0501044_0161833 Ga0501044_0161833_392_1138 247
93 3300049823 Ga0501044_0371125 Ga0501044_0371125_68_814 247
94 3300050515 nmdc:mga0a205_379208_c1 nmdc:mga0a205_379208_c1_218_979 247
95 3300060353 Ga0501082_0072687 Ga0501082_0072687_913_1659 247
96 iso_pu_bacteria 2582581298 2585220810 247
97 iso_pu_bacteria 2585427529 2585548612 247
98 3300003187 JGI25151J46595_10001940 JGI25151J46595_100019409 248
99 3300003354 JGI25160J50197_1005522 JGI25160J50197_10055223 248
100 3300005937 Ga0081455_10130901 Ga0081455_101309012 248
101 3300005985 Ga0081539_10000316 Ga0081539_1000031692 248
102 3300006038 Ga0075365_10024574 Ga0075365_100245742 248
103 3300025284 Ga0209130_1001013 Ga0209130_100101320 248
104 3300025294 Ga0209025_1001079 Ga0209025_100107916 248
105 3300025297 Ga0209758_1001450 Ga0209758_100145016 248
106 3300025302 Ga0207426_1000451 Ga0207426_100045120 248
107 3300036401 Ga0373937_0331826 Ga0373937_0331826_353_1105 248
108 3300046512 Ga0495610_0003008 Ga0495610_0003008_10574_11350 248
109 3300047472 Ga0495686_0053584 Ga0495686_0053584_1075_1866 248
110 3300050492 nmdc:mga0yw44_165196_c1 nmdc:mga0yw44_165196_c1_298_1044 248
111 3300053125 Ga0500618_002658 Ga0500618_002658_2288_3079 248
112 3300053153 Ga0500616_0081111 Ga0500616_0081111_100_852 248
113 iso_pu_bacteria 2551306092 2551736515 248
114 3300005539 Ga0068853_100003331 Ga0068853_1000033313 249
115 3300026041 Ga0207639_10022825 Ga0207639_100228253 249
116 iso_pu_bacteria 2508501122 2509111397 249
117 iso_pu_bacteria 2509276019 2509375664 249
118 iso_pu_bacteria 2510065057 2510303290 249
119 iso_pu_bacteria 2510461069 2510840036 249
120 iso_pu_bacteria 2511231052 2511501972 249
121 iso_pu_bacteria 2512047086 2512533340 249
122 iso_pu_bacteria 2512875026 2512971091 249
123 iso_pu_bacteria 2513237086 2513582631 249
124 iso_pu_bacteria 2513237089 2513604552 249
125 iso_pu_bacteria 2513237091 2513615467 249
126 iso_pu_bacteria 2513237140 2513881256 249
127 iso_pu_bacteria 2513237143 2513902387 249
128 iso_pu_bacteria 2513237156 2513984593 249
129 iso_pu_bacteria 2513237159 2513997063 249
130 iso_pu_bacteria 2513237160 2514007605 249
131 iso_pu_bacteria 2515154107 2515608765 249
132 iso_pu_bacteria 2516143018 2516209692 249
133 iso_pu_bacteria 2516653046 2516893268 249
134 iso_pu_bacteria 2517487022 2517570025 249
135 iso_pu_bacteria 2524023207 2524448832 249
136 iso_pu_bacteria 2537561587 2537877765 249
137 iso_pu_bacteria 2551306084 2551675154 249
138 iso_pu_bacteria 2551306084 2551680520 249
139 iso_pu_bacteria 2551306085 2551688053 249
140 iso_pu_bacteria 2554235003 2554245551 249
141 iso_pu_bacteria 2558860100 2558867980 249
142 iso_pu_bacteria 2558860242 2559296619 249
143 iso_pu_bacteria 2582581283 2585166136 249
144 iso_pu_bacteria 2582581306 2585267660 249
145 iso_pu_bacteria 2582581865 2585386719 249
146 iso_pu_bacteria 2582581866 2585393051 249
147 iso_pu_bacteria 2599185156 2599331586 249
148 iso_pu_bacteria 2599185210 2599602888 249
149 iso_pu_bacteria 2599185352 2600193089 249
150 iso_pu_bacteria 2600255279 2601610497 249
151 iso_pu_bacteria 2600255308 2601747173 249
152 iso_pu_bacteria 2643221557 2643803589 249
153 iso_pu_bacteria 2643221568 2643854246 249
154 iso_pu_bacteria 2643221582 2643917408 249
155 iso_pu_bacteria 2643221607 2644050731 249
156 iso_pu_bacteria 2643221610 2644067556 249
157 iso_pu_bacteria 2643221618 2644107702 249
158 iso_pu_bacteria 2643221626 2644148627 249
159 iso_pu_bacteria 2643221636 2644205205 249
160 iso_pu_bacteria 2643221637 2644210224 249
161 iso_pu_bacteria 2643221653 2644298400 249
162 iso_pu_bacteria 2643221655 2644309096 249
163 iso_pu_bacteria 2643221659 2644332924 249
164 iso_pu_bacteria 2643221668 2644375236 249
165 iso_pu_bacteria 2643221675 2644418609 249
166 iso_pu_bacteria 2643221680 2644451976 249
167 iso_pu_bacteria 2643221686 2644483649 249
168 iso_pu_bacteria 2643221688 2644491800 249
169 iso_pu_bacteria 2643221689 2644501352 249
170 iso_pu_bacteria 2643221693 2644520748 249
171 iso_pu_bacteria 2643221698 2644545904 249
172 iso_pu_bacteria 2643221712 2644615038 249
173 iso_pu_bacteria 2643221718 2644653776 249
174 iso_pu_bacteria 2643221719 2644656629 249
175 iso_pu_bacteria 2643221723 2644676575 249
176 iso_pu_bacteria 2643221726 2644690738 249
177 iso_pu_bacteria 2657244999 2657681195 249
178 iso_pu_bacteria 2690316117 2692315847 249
179 iso_pu_bacteria 2751185821 2753461862 249
180 iso_pu_bacteria 2791355082 2792581762 249
181 iso_pu_bacteria 2791355091 2792620168 249
182 iso_pu_bacteria 2791355092 2792626412 249
183 iso_pu_bacteria 2791355094 2792639361 249
184 iso_pu_bacteria 2791355253 2793279938 249
185 iso_pu_bacteria 2802428858 2802719520 249
186 iso_pu_bacteria 2802428859 2802726887 249
187 iso_pu_bacteria 2802428860 2802732254 249
188 iso_pu_bacteria 2802428861 2802739857 249
189 iso_pu_bacteria 2802428862 2802745363 249
190 iso_pu_bacteria 2802428863 2802752755 249
191 iso_pu_bacteria 2802429268 2804752395 249
192 iso_pu_bacteria 2808606387 2808987072 249
193 iso_pu_bacteria 2818991272 2819241739 249
194 iso_pu_bacteria 2818991439 2819560625 249
195 iso_pu_bacteria 2818991461 2819684750 249
196 iso_pu_bacteria 2821123053 2821129479 249
197 iso_pu_bacteria 2838074704 2838079591 249
198 iso_pu_bacteria 2838675328 2838677882 249
199 iso_pu_bacteria 2838714209 2838717213 249
200 iso_pu_bacteria 2838719591 2838722177 249
201 iso_pu_bacteria 2838724970 2838727962 249
202 iso_pu_bacteria 2838736955 2838738489 249
203 iso_pu_bacteria 2841840854 2841841142 249
204 iso_pu_bacteria 2841846520 2841849621 249
205 iso_pu_bacteria 2841859092 2841861343 249
206 iso_pu_bacteria 2842124991 2842127631 249
207 iso_pu_bacteria 2842130223 2842132775 249
208 iso_pu_bacteria 2842140634 2842140920 249
209 iso_pu_bacteria 2842152218 2842154768 249
210 iso_pu_bacteria 2842170452 2842173267 249
211 iso_pu_bacteria 2842175837 2842178389 249
212 iso_pu_bacteria 2842187318 2842190321 249
213 iso_pu_bacteria 2842211629 2842214635 249
214 iso_pu_bacteria 2842224351 2842227354 249
215 iso_pu_bacteria 2842515876 2842518390 249
216 iso_pu_bacteria 2842521101 2842522695 249
217 iso_pu_bacteria 2842922631 2842923984 249
218 iso_pu_bacteria 2844163670 2844167585 249
219 iso_pu_bacteria 2847417321 2847419088 249
220 iso_pu_bacteria 2848992105 2848994118 249
221 iso_pu_bacteria 2850079185 2850081160 249
222 iso_pu_bacteria 2854916844 2854917968 249
223 iso_pu_bacteria 2855825444 2855825991 249
224 iso_pu_bacteria 2855872281 2855876763 249
225 iso_pu_bacteria 2857531043 2857535119 249
226 iso_pu_bacteria 2858800743 2858802323 249
227 iso_pu_bacteria 2891048133 2891050896 249
228 iso_pu_bacteria 2896384573 2896384845 249
229 iso_pu_bacteria 2899792073 2899795599 249
230 iso_pu_bacteria 2899803654 2899809012 249
231 iso_pu_bacteria 2899845264 2899849925 249
232 iso_pu_bacteria 2913295892 2913300838 249
233 iso_pu_bacteria 2915980308 2915981887 249
234 iso_pu_bacteria 2915986958 2915991338 249
235 iso_pu_bacteria 2915993759 2915994362 249
236 iso_pu_bacteria 2916000859 2916004383 249
237 iso_pu_bacteria 2916007675 2916008147 249
238 iso_pu_bacteria 2916014648 2916015086 249
239 iso_pu_bacteria 2916021584 2916024233 249
240 iso_pu_bacteria 2916028427 2916031765 249
241 iso_pu_bacteria 2916035215 2916041273 249
242 iso_pu_bacteria 2916041962 2916042735 249
243 iso_pu_bacteria 2916048683 2916052279 249
244 iso_pu_bacteria 2916055098 2916056434 249
245 iso_pu_bacteria 2916061851 2916067573 249
246 iso_pu_bacteria 2916068649 2916074291 249
247 iso_pu_bacteria 2916076590 2916080866 249
248 iso_pu_bacteria 2919114240 2919117471 249
249 iso_pu_bacteria 2919166419 2919168633 249
250 iso_pu_bacteria 2920760137 2920766092 249
251 iso_pu_bacteria 2920822456 2920824724 249
252 iso_pu_bacteria 2921201388 2921201935 249
253 iso_pu_bacteria 2921208531 2921211207 249
254 iso_pu_bacteria 2921237296 2921240726 249
255 iso_pu_bacteria 2921244191 2921244637 249
256 iso_pu_bacteria 2921250672 2921251170 249
257 iso_pu_bacteria 2921257292 2921262465 249
258 iso_pu_bacteria 2921263974 2921265113 249
259 iso_pu_bacteria 2921282425 2921283770 249
260 iso_pu_bacteria 2921289301 2921296322 249
261 iso_pu_bacteria 2921296804 2921299374 249
262 iso_pu_bacteria 2924144063 2924147101 249
263 iso_pu_bacteria 2924150972 2924155255 249
264 iso_pu_bacteria 2924158325 2924160766 249
265 iso_pu_bacteria 2924165586 2924167344 249
266 iso_pu_bacteria 2924172951 2924178985 249
267 iso_pu_bacteria 2924179722 2924184073 249
268 iso_pu_bacteria 2924186466 2924189066 249
269 iso_pu_bacteria 2924193448 2924194793 249
270 iso_pu_bacteria 2924200457 2924203359 249
271 iso_pu_bacteria 2924207177 2924208833 249
272 iso_pu_bacteria 2924214083 2924217923 249
273 iso_pu_bacteria 2924221636 2924226511 249
274 iso_pu_bacteria 2924228884 2924229947 249
275 iso_pu_bacteria 2926754445 2926758917 249
276 iso_pu_bacteria 2926760298 2926763571 249
277 iso_pu_bacteria 2929138655 2929138834 249
278 iso_pu_bacteria 2933006813 2933009849 249
279 iso_pu_bacteria 2933011516 2933014017 249
280 iso_pu_bacteria 2933594066 2933595804 249
281 iso_pu_bacteria 2936996657 2936998121 249
282 iso_pu_bacteria 2937002841 2937005067 249
283 iso_pu_bacteria 2937009748 2937012205 249
284 iso_pu_bacteria 2937016420 2937018636 249
285 iso_pu_bacteria 2937023124 2937028975 249
286 iso_pu_bacteria 2937029754 2937031279 249
287 iso_pu_bacteria 2937036028 2937038580 249
288 iso_pu_bacteria 2937042894 2937045884 249
289 iso_pu_bacteria 2937049772 2937050947 249
290 iso_pu_bacteria 2937056579 2937061541 249
291 iso_pu_bacteria 2937063883 2937065226 249
292 iso_pu_bacteria 2937071275 2937073051 249
293 iso_pu_bacteria 2937078374 2937079801 249
294 iso_pu_bacteria 2937084907 2937087054 249
295 iso_pu_bacteria 2937091812 2937097591 249
296 iso_pu_bacteria 2937098957 2937099538 249
297 iso_pu_bacteria 2937106411 2937110012 249
298 iso_pu_bacteria 2937113482 2937116266 249
299 iso_pu_bacteria 2937119839 2937123076 249
300 iso_pu_bacteria 2937126314 2937128711 249
301 iso_pu_bacteria 2941499720 2941504974 249
302 iso_pu_bacteria 2957375807 2957376587 249
303 iso_pu_bacteria 2957382221 2957384805 249
304 iso_pu_bacteria 2957388812 2957394847 249
305 iso_pu_bacteria 2957395598 2957398267 249
306 iso_pu_bacteria 2957402308 2957403203 249
307 iso_pu_bacteria 2957408893 2957411596 249
308 iso_pu_bacteria 2957415311 2957418320 249
309 iso_pu_bacteria 2957422303 2957423293 249
310 iso_pu_bacteria 2957430029 2957432802 249
311 iso_pu_bacteria 2957437181 2957441267 249
312 iso_pu_bacteria 2957443900 2957444991 249
313 iso_pu_bacteria 2957450854 2957455972 249
314 iso_pu_bacteria 2957457609 2957459917 249
315 iso_pu_bacteria 2957464669 2957465995 249
316 iso_pu_bacteria 2957471148 2957477090 249
317 iso_pu_bacteria 2957478035 2957479216 249
318 iso_pu_bacteria 2957484790 2957486259 249
319 iso_pu_bacteria 2957491536 2957498036 249
320 iso_pu_bacteria 2957498199 2957498695 249
321 iso_pu_bacteria 2957505466 2957507654 249
322 iso_pu_bacteria 2960584000 2960584306 249
323 iso_pu_bacteria 2960591022 2960592714 249
324 iso_pu_bacteria 2960597568 2960602684 249
325 iso_pu_bacteria 2960603979 2960605937 249
326 iso_pu_bacteria 2960610863 2960612423 249
327 iso_pu_bacteria 2960617483 2960620011 249
328 iso_pu_bacteria 2960624210 2960630921 249
329 iso_pu_bacteria 2960631154 2960632831 249
330 iso_pu_bacteria 2960637947 2960639855 249
331 iso_pu_bacteria 2960645483 2960650507 249
332 iso_pu_bacteria 2960652885 2960660036 249
333 iso_pu_bacteria 2960660292 2960660847 249
334 iso_pu_bacteria 2960667422 2960670969 249
335 iso_pu_bacteria 2960674078 2960675910 249
336 iso_pu_bacteria 2960680706 2960681862 249
337 iso_pu_bacteria 2960687367 2960689953 249
338 iso_pu_bacteria 2960693952 2960694658 249
339 iso_pu_bacteria 2964607997 2964609192 249
340 iso_pu_bacteria 2964615318 2964616579 249
341 iso_pu_bacteria 2964621998 2964622579 249
342 iso_pu_bacteria 2964628898 2964635800 249
343 iso_pu_bacteria 2964636051 2964640950 249
344 iso_pu_bacteria 2964643177 2964649476 249
345 iso_pu_bacteria 2964649959 2964651784 249
346 iso_pu_bacteria 2964656573 2964661008 249
347 iso_pu_bacteria 2964663802 2964667046 249
348 iso_pu_bacteria 2964670856 2964677504 249
349 iso_pu_bacteria 2964678106 2964684094 249
350 iso_pu_bacteria 2964685014 2964687286 249
351 iso_pu_bacteria 2964691889 2964692860 249
352 iso_pu_bacteria 2964698721 2964702319 249
353 iso_pu_bacteria 2964705432 2964711847 249
354 iso_pu_bacteria 2964712639 2964716768 249
355 iso_pu_bacteria 2964719344 2964723893 249
356 iso_pu_bacteria 2967664464 2967665498 249
357 iso_pu_bacteria 2967671571 2967672563 249
358 iso_pu_bacteria 2967678726 2967681854 249
359 iso_pu_bacteria 2967686174 2967691703 249
360 iso_pu_bacteria 2967693043 2967695252 249
361 iso_pu_bacteria 2967699805 2967703248 249
362 iso_pu_bacteria 2967706974 2967707791 249
363 iso_pu_bacteria 2967714385 2967716664 249
364 iso_pu_bacteria 2967721400 2967721665 249
365 iso_pu_bacteria 2967728569 2967734986 249
366 iso_pu_bacteria 2967735183 2967736863 249
367 iso_pu_bacteria 2967742019 2967744125 249
368 iso_pu_bacteria 2967748971 2967755484 249
369 iso_pu_bacteria 2967755722 2967758752 249
370 iso_pu_bacteria 2967762386 2967765382 249
371 iso_pu_bacteria 2967769361 2967775660 249
372 iso_pu_bacteria 2967775926 2967782289 249
373 iso_pu_bacteria 2970019648 2970026516 249
374 iso_pu_bacteria 2970026789 2970031008 249
375 iso_pu_bacteria 2970033650 2970039724 249
376 iso_pu_bacteria 2970047711 2970054424 249
377 iso_pu_bacteria 2970054988 2970057809 249
378 iso_pu_bacteria 2970061556 2970066700 249
379 iso_pu_bacteria 2970068827 2970072997 249
380 iso_pu_bacteria 2970076120 2970077461 249
381 iso_pu_bacteria 2970082768 2970086194 249
382 iso_pu_bacteria 2970088815 2970091170 249
383 iso_pu_bacteria 2970095765 2970097291 249
384 iso_pu_bacteria 2970102677 2970107502 249
385 iso_pu_bacteria 2970109326 2970110863 249
386 iso_pu_bacteria 2970116247 2970122163 249
387 iso_pu_bacteria 2970122695 2970122983 249
388 iso_pu_bacteria 2970129317 2970131686 249
389 iso_pu_bacteria 2970136068 2970138584 249
390 iso_pu_bacteria 2970143518 2970144097 249
391 iso_pu_bacteria 2970149975 2970154253 249
392 iso_pu_bacteria 2970156795 2970160214 249
393 iso_pu_bacteria 2970164137 2970167125 249
394 iso_pu_bacteria 2970170962 2970173281 249
395 iso_pu_bacteria 2970177841 2970180318 249
396 iso_pu_bacteria 2970184632 2970187582 249
397 iso_pu_bacteria 2970191845 2970193339 249
398 iso_pu_bacteria 2977516862 2977522400 249
399 iso_pu_bacteria 2977523885 2977529040 249
400 iso_pu_bacteria 2977530762 2977531672 249
401 iso_pu_bacteria 2977537788 2977540561 249
402 iso_pu_bacteria 2977544691 2977549087 249
403 iso_pu_bacteria 2977551784 2977554415 249
404 iso_pu_bacteria 2977558990 2977560185 249
405 iso_pu_bacteria 2977565890 2977572257 249
406 iso_pu_bacteria 2977572785 2977575292 249
407 iso_pu_bacteria 2977579622 2977580176 249
408 iso_pu_bacteria 2978969890 2978971323 249
409 iso_pu_bacteria 2979089926 2979091389 249
410 iso_pu_bacteria 2979095461 2979096912 249
411 iso_pu_bacteria 2979100975 2979101417 249
412 iso_pu_bacteria 2984509177 2984510631 249
413 iso_pu_bacteria 2984518228 2984518666 249
414 iso_pu_bacteria 2984537506 2984538980 249
415 iso_pu_bacteria 2984587000 2984588468 249
416 iso_pu_bacteria 2984601300 2984605677 249
417 iso_pu_bacteria 2989349275 2989349416 249
418 iso_pu_bacteria 2989771324 2989774941 249
419 iso_pu_bacteria 2989776772 2989778928 249
420 iso_pu_bacteria 2995392953 2995393080 249
421 iso_pu_bacteria 3003930520 3003933778 249
422 iso_pu_bacteria 643692032 643825978 249
423 iso_pu_bacteria 648276728 648739560 249
424 iso_pu_bacteria 650716007 650843041 249
425 iso_pu_bacteria 8003570095 8003574250 249
426 iso_pu_bacteria 8003992118 8003993851 249
427 iso_pu_bacteria 8003999396 8004001396 249
428 iso_pu_bacteria 8005246636 8005248481 249
429 iso_pu_bacteria 8005658619 8005659560 249
430 iso_pu_bacteria 8024486573 8024492251 249
431 iso_pu_bacteria 8049293176 8049294962 249
432 iso_pu_bacteria 8054460903 8054464584 249
433 iso_pu_bacteria 8054558443 8054560255 249
434 iso_pu_bacteria 8056875544 8056877780 249
435 3300048903 Ga0496100_0196928 Ga0496100_0196928_693_1445 250
436 3300048917 Ga0496114_0056807 Ga0496114_0056807_1512_2264 250
437 3300039437 Ga0436365_0038853 Ga0436365_0038853_496_1257 251
438 3300002739 JGI25158J39367_1012450 JGI25158J39367_10124501 253
439 3300002987 JGI25159J45721_1000078 JGI25159J45721_100007839 253
440 3300003187 JGI25151J46595_10007493 JGI25151J46595_100074935 253
441 3300003187 JGI25151J46595_10014053 JGI25151J46595_100140532 253
442 3300003187 JGI25151J46595_10092124 JGI25151J46595_100921241 253
443 3300003354 JGI25160J50197_1000216 JGI25160J50197_100021612 253
444 3300003374 JGI25161J50226_1000412 JGI25161J50226_100041222 253
445 3300003771 Ga0055526_1000594 Ga0055526_100059416 253
446 3300003775 Ga0055524_1001872 Ga0055524_10018726 253
447 3300003781 Ga0055536_1010645 Ga0055536_10106452 253
448 3300003794 Ga0055531_10019507 Ga0055531_100195072 253
449 3300003856 Ga0058692_1002834 Ga0058692_10028345 253
450 3300004625 Ga0055543_1000301 Ga0055543_100030139 253
451 3300005262 Ga0065165_1000717 Ga0065165_100071712 253
452 3300005331 Ga0070670_100001771 Ga0070670_1000017716 253
453 3300006051 Ga0075364_10011277 Ga0075364_100112773 253
454 3300006051 Ga0075364_10089251 Ga0075364_100892512 253
455 3300006051 Ga0075364_10205301 Ga0075364_102053012 253
456 3300006051 Ga0075364_10294290 Ga0075364_102942901 253
457 3300006177 Ga0075362_10004177 Ga0075362_100041775 253
458 3300006177 Ga0075362_10138728 Ga0075362_101387282 253
459 3300006186 Ga0075369_10047435 Ga0075369_100474352 253
460 3300006186 Ga0075369_10059587 Ga0075369_100595872 253
461 3300006195 Ga0075366_10102714 Ga0075366_101027142 253
462 3300006946 Ga0079104_1023854 Ga0079104_10238542 253
463 3300006948 Ga0099826_10000054 Ga0099826_1000005421 253
464 3300006948 Ga0099826_10142108 Ga0099826_101421082 253
465 3300013102 Ga0157371_10000002 Ga0157371_10000002431 253
466 3300013104 Ga0157370_10000286 Ga0157370_1000028611 253
467 3300013249 Ga0171463_1003 Ga0171463_1003637 253
468 3300015690 Ga0183363_1047 Ga0183363_104719 253
469 3300021320 Ga0214544_1001682 Ga0214544_100168221 253
470 3300021321 Ga0214542_1001614 Ga0214542_100161420 253
471 3300021321 Ga0214542_1016791 Ga0214542_10167914 253
472 3300021327 Ga0214543_1000078 Ga0214543_100007824 253
473 3300021327 Ga0214543_1001395 Ga0214543_100139520 253
474 3300022739 Ga0228711_1000016 Ga0228711_100001637 253
475 3300022740 Ga0228710_1000013 Ga0228710_100001397 253
476 3300025208 Ga0209436_102562 Ga0209436_1025622 253
477 3300025284 Ga0209130_1000029 Ga0209130_1000029286 253
478 3300025292 Ga0209676_1009134 Ga0209676_10091342 253
479 3300025294 Ga0209025_1000119 Ga0209025_100011993 253
480 3300025294 Ga0209025_1000959 Ga0209025_10009596 253
481 3300025294 Ga0209025_1001950 Ga0209025_100195011 253
482 3300025294 Ga0209025_1055126 Ga0209025_10551262 253
483 3300025295 Ga0209564_1000278 Ga0209564_100027882 253
484 3300025298 Ga0209050_1006307 Ga0209050_10063076 253
485 3300025299 Ga0209256_1000042 Ga0209256_100004226 253
486 3300025299 Ga0209256_1002941 Ga0209256_10029413 253
487 3300025302 Ga0207426_1000074 Ga0207426_100007412 253
488 3300025304 Ga0209257_1007900 Ga0209257_10079003 253
489 3300025304 Ga0209257_1048796 Ga0209257_10487962 253
490 3300025925 Ga0207650_10002483 Ga0207650_100024836 253
491 3300027111 Ga0209281_1000036 Ga0209281_1000036263 253
492 3300027111 Ga0209281_1000047 Ga0209281_1000047205 253
493 3300027111 Ga0209281_1000221 Ga0209281_100022133 253
494 3300027111 Ga0209281_1000453 Ga0209281_10004535 253
495 3300027312 Ga0209371_1000012 Ga0209371_1000012176 253
496 3300027312 Ga0209371_1002509 Ga0209371_10025098 253
497 3300027666 Ga0209282_1000041 Ga0209282_100004133 253
498 3300027666 Ga0209282_1000140 Ga0209282_10001403 253
499 3300027666 Ga0209282_1146342 Ga0209282_11463422 253
500 3300027866 Ga0209813_10005946 Ga0209813_100059462 253
501 3300028794 Ga0307515_10000023 Ga0307515_10000023289 253
502 3300028794 Ga0307515_10046287 Ga0307515_100462874 253
503 3300030500 Ga0268256_1000013 Ga0268256_1000013176 253
504 3300030744 Ga0316181_1124615 Ga0316181_11246152 253
505 3300031456 Ga0307513_10003030 Ga0307513_100030307 253
506 3300031548 Ga0307408_100122433 Ga0307408_1001224332 253
507 3300031548 Ga0307408_100414181 Ga0307408_1004141812 253
508 3300031548 Ga0307408_100830152 Ga0307408_1008301521 253
509 3300031731 Ga0307405_10061347 Ga0307405_100613471 253
510 3300031901 Ga0307406_10556939 Ga0307406_105569391 253
511 3300031967 Ga0315914_1000030 Ga0315914_100003098 253
512 3300031995 Ga0307409_100113846 Ga0307409_1001138462 253
513 3300032002 Ga0307416_100085503 Ga0307416_1000855032 253
514 3300032002 Ga0307416_100170370 Ga0307416_1001703702 253
515 3300033430 Ga0315913_1000017 Ga0315913_100001796 253
516 3300033464 Ga0315915_1000017 Ga0315915_100001769 253
517 3300037068 Ga0373925_0006563 Ga0373925_0006563_3469_4236 253
518 3300041404 Ga0439436_0001642 Ga0439436_0001642_1169_1930 253
519 3300041404 Ga0439436_0039125 Ga0439436_0039125_180_941 253
520 3300041405 Ga0439438_030013 Ga0439438_030013_652_1413 253
521 3300041406 Ga0439439_0010918 Ga0439439_0010918_1352_2113 253
522 3300041413 Ga0439465_0040646 Ga0439465_0040646_367_1128 253
523 3300042007 Ga0439449_0005799 Ga0439449_0005799_3121_4032 253
524 3300042010 Ga0439452_042476 Ga0439452_042476_284_1045 253
525 3300042014 Ga0439457_016503 Ga0439457_016503_44_805 253
526 3300042122 Ga0450920_011793 Ga0450920_011793_379_1140 253
527 3300042145 Ga0450906_016895 Ga0450906_016895_55_816 253
528 3300042435 Ga0439434_0045950 Ga0439434_0045950_146_907 253
529 3300046530 Ga0495654_0000090 Ga0495654_0000090_62137_62901 253
530 3300046660 Ga0495625_0050368 Ga0495625_0050368_699_1460 253
531 3300046674 Ga0495588_0011344 Ga0495588_0011344_3319_4095 253
532 3300047470 Ga0495681_0000886 Ga0495681_0000886_1240_2016 253
533 3300048916 Ga0496113_0022885 Ga0496113_0022885_2721_3497 253
534 3300048919 Ga0496116_0076562 Ga0496116_0076562_342_1118 253
535 3300048920 Ga0496117_0000016 Ga0496117_0000016_312316_313092 253
536 3300048920 Ga0496117_0006313 Ga0496117_0006313_850_1611 253
537 3300048920 Ga0496117_0030058 Ga0496117_0030058_3132_3893 253
538 3300048920 Ga0496117_0082485 Ga0496117_0082485_348_1124 253
539 3300048921 Ga0496118_0000535 Ga0496118_0000535_4687_5463 253
540 3300048921 Ga0496118_0036469 Ga0496118_0036469_1646_2422 253
541 3300048921 Ga0496118_0088052 Ga0496118_0088052_507_1268 253
542 3300048922 Ga0496119_0021558 Ga0496119_0021558_3521_4297 253
543 3300048922 Ga0496119_0085880 Ga0496119_0085880_449_1210 253
544 3300048923 Ga0496120_0000056 Ga0496120_0000056_1293_2069 253
545 3300048923 Ga0496120_0013734 Ga0496120_0013734_4305_5066 253
546 3300048924 Ga0496121_0000001 Ga0496121_0000001_276010_276771 253
547 3300048924 Ga0496121_0003418 Ga0496121_0003418_4515_5276 253
548 3300048924 Ga0496121_0025293 Ga0496121_0025293_330_1094 253
549 3300048924 Ga0496121_0132578 Ga0496121_0132578_1071_1847 253
550 3300048925 Ga0496122_0000002 Ga0496122_0000002_312977_313753 253
551 3300048925 Ga0496122_0000525 Ga0496122_0000525_24528_25289 253
552 3300048925 Ga0496122_0049793 Ga0496122_0049793_68_829 253
553 3300048926 Ga0496123_0000002 Ga0496123_0000002_1497930_1498706 253
554 3300048926 Ga0496123_0000002 Ga0496123_0000002_312977_313753 253
555 3300048926 Ga0496123_0001014 Ga0496123_0001014_1139_1900 253
556 3300048926 Ga0496123_0045707 Ga0496123_0045707_1817_2578 253
557 3300048927 Ga0496124_0002629 Ga0496124_0002629_2129_2905 253
558 3300048927 Ga0496124_0010219 Ga0496124_0010219_1373_2134 253
559 3300048927 Ga0496124_0021431 Ga0496124_0021431_987_1748 253
560 3300048927 Ga0496124_0060519 Ga0496124_0060519_2127_2891 253
561 3300048927 Ga0496124_0259440 Ga0496124_0259440_116_892 253
562 3300048928 Ga0496125_0000001 Ga0496125_0000001_388036_388797 253
563 3300048928 Ga0496125_0002081 Ga0496125_0002081_17067_17828 253
564 3300048928 Ga0496125_0110683 Ga0496125_0110683_545_1321 253
565 3300048928 Ga0496125_0152776 Ga0496125_0152776_783_1559 253
566 3300048929 Ga0496126_0000059 Ga0496126_0000059_165344_166105 253
567 3300048929 Ga0496126_0001019 Ga0496126_0001019_23087_23848 253
568 3300048929 Ga0496126_0060207 Ga0496126_0060207_934_1695 253
569 3300048929 Ga0496126_0111776 Ga0496126_0111776_74_835 253
570 3300048929 Ga0496126_0317864 Ga0496126_0317864_219_995 253
571 3300049568 Ga0501031_0045506 Ga0501031_0045506_1281_2042 253
572 3300049569 Ga0501032_0077667 Ga0501032_0077667_703_1464 253
573 3300049571 Ga0501034_0153333 Ga0501034_0153333_718_1479 253
574 3300049571 Ga0501034_0218184 Ga0501034_0218184_710_1471 253
575 3300049579 Ga0501043_0133085 Ga0501043_0133085_845_1606 253
576 3300049661 Ga0501217_015168 Ga0501217_015168_675_1436 253
577 3300049822 Ga0501035_0458699 Ga0501035_0458699_77_838 253
578 3300050489 nmdc:mga03683_19297_c1 nmdc:mga03683_19297_c1_1809_2585 253
579 3300050489 nmdc:mga03683_57022_c1 nmdc:mga03683_57022_c1_825_1601 253
580 3300050491 nmdc:mga00v17_156_c1 nmdc:mga00v17_156_c1_10391_11152 253
581 3300050491 nmdc:mga00v17_189481_c1 nmdc:mga00v17_189481_c1_219_995 253
582 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_92185_92961 253
583 3300050491 nmdc:mga00v17_8320_c1 nmdc:mga00v17_8320_c1_3184_3945 253
584 3300050492 nmdc:mga0yw44_23854_c1 nmdc:mga0yw44_23854_c1_912_1688 253
585 3300050516 nmdc:mga0sz30_112036_c1 nmdc:mga0sz30_112036_c1_195_971 253
586 3300050516 nmdc:mga0sz30_14730_c1 nmdc:mga0sz30_14730_c1_987_1763 253
587 3300050516 nmdc:mga0sz30_2395_c1 nmdc:mga0sz30_2395_c1_1890_2666 253
588 3300053099 Ga0500654_053933 Ga0500654_053933_975_1736 253
589 3300053107 Ga0500560_022567 Ga0500560_022567_19_795 253
590 3300053137 Ga0500561_0000065 Ga0500561_0000065_20072_20848 253
591 3300053151 Ga0500604_0100765 Ga0500604_0100765_10_771 253
592 3300053157 Ga0500624_000733 Ga0500624_000733_6003_6779 253
593 3300053161 Ga0500634_0053112 Ga0500634_0053112_603_1379 253
594 3300053177 Ga0500636_0000034 Ga0500636_0000034_28762_29523 253
595 3300053177 Ga0500636_0029235 Ga0500636_0029235_1296_2057 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

21

253

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8973 1 234
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8855 1 234
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8369 3 236
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8297 2 253
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8244 2 252
ID Description Score Start End Superfamily
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7658 2 252 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7543 2 252 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7541 1 252 3.20.20.150
5tnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7496 1 251 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7485 1 252 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A4V1VG79-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9945 95 253 GO:0016853
AF-A0A436LZM8-F1-model_v4 deleted 0.9928 129 253
AF-A0A7C9KJU5-F1-model_v4 deleted 0.9923 3 253
AF-C4WPF9-F1-model_v4 Xylose isomerase domain-containing protein 0.9898 2 253 GO:0016853
AF-A0A526QT68-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9898 122 253 GO:0016853

Feature Viewer

pLDDT pTM Quality
96.69 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map