F467455

General Info

Members Datasets Scaffolds Average Seq Length
595 332 555 206

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10209358|Ga0307414_102093582
Length 228
Sequence MKPKIIMSNTSDKSIGLMDDKTQKFTEEENEGYLKIDRYNEDKIATIATHYKDILFQIGENPEREGLHKTPERVAKALQFLTHGYDADPEQILRSAMFKEEYSQMVVVKDIEVFSMCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRVVDAFARRLQVQERLTNEIRDCIQKTLNPAGVAVVIECKHLCMSMRGIQKQNSVTTTSAFTGEFAQDKTRAEFLRLITANLH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
22 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
23 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
24 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
25 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
26 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
27 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
28 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
29 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
30 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
31 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
32 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
33 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
34 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
35 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
36 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
37 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
38 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
39 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
40 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
41 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
42 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
208 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
209 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
238 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
239 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
304 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
305 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
306 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
327 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
332 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.67
Isolates 6.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.5
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 8.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3308433 2162886007 Bacteria 12186
2 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
3 JGI24736J21556_1000812 3300001904 Bacteria 5763
4 JGI24736J21556_1001942 3300001904 Bacteria 3678
5 JGI24740J21852_10012653 3300001979 Bacteria 3174
6 JGI24739J22299_10001457 3300001989 Bacteria 8917
7 JGI24737J22298_10000852 3300001990 Bacteria 10878
8 JGI24737J22298_10001745 3300001990 Bacteria 7761
9 JGI24737J22298_10002702 3300001990 Bacteria 6273
10 JGI24737J22298_10015372 3300001990 Bacteria 2477
11 JGI24737J22298_10024646 3300001990 Bacteria 1905
12 JGI24735J21928_10000027 3300002067 Bacteria 83494
13 JGI24735J21928_10015914 3300002067 Bacteria 2341
14 JGI24751J29686_10000772 3300002459 Bacteria 7557
15 JGI25157J39369_1002704 3300002741 Bacteria 4111
16 JGI25164J39214_1001144 3300002772 Bacteria 7484
17 JGI25152J39213_1000043 3300002773 Bacteria 87508
18 JGI25150J39212_1000023 3300002774 Bacteria 130663
19 JGI25151J46595_10000082 3300003187 Bacteria 130832
20 JGI25165J46597_1001050 3300003214 Bacteria 17908
21 JGI25165J46597_1008856 3300003214 Bacteria 1548
22 JGI25153J46596_10000060 3300003215 Bacteria 131744
23 rootH1_10031584 3300003316 Bacteria 16796
24 rootH2_10001273 3300003320 Bacteria 179792
25 rootH2_10114261 3300003320 Bacteria 1972
26 rootL2_10020975 3300003322 Bacteria 6506
27 rootH1_10024310 3300003323 Bacteria 54858
28 rootH1_10083498 3300003323 Bacteria 4553
29 rootH1_10124986 3300003323 Bacteria 2534
30 rootH1_10233543 3300003323 Bacteria 4367
31 Ga0055536_1000002 3300003781 Bacteria 605605
32 Ga0055530_10000739 3300003791 Bacteria 27214
33 Ga0058863_11920979 3300004799 Bacteria 3023
34 Ga0058862_12833523 3300004803 Bacteria 2412
35 Ga0065714_10002980 3300005288 Bacteria 14261
36 Ga0065714_10003630 3300005288 Bacteria 23830
37 Ga0065714_10004446 3300005288 Bacteria 6584
38 Ga0065714_10064525 3300005288 Bacteria 41731
39 Ga0065714_10080235 3300005288 Bacteria 2414
40 Ga0065704_10000206 3300005289 Bacteria 121672
41 Ga0065704_10099903 3300005289 Bacteria 2293
42 Ga0065704_10166991 3300005289 Bacteria 1316
43 Ga0065704_10333564 3300005289 Bacteria 834
44 Ga0070658_10111073 3300005327 Bacteria 2271
45 Ga0070658_10226211 3300005327 Bacteria 1583
46 Ga0070658_10259587 3300005327 Bacteria 1475
47 Ga0070676_10014740 3300005328 Bacteria 4300
48 Ga0070683_100008086 3300005329 Bacteria 8932
49 Ga0070670_100008042 3300005331 Bacteria 8971
50 Ga0070670_100193626 3300005331 Bacteria 1766
51 Ga0070670_100465243 3300005331 Bacteria 1122
52 Ga0070680_100247464 3300005336 Bacteria 1507
53 Ga0070680_100413117 3300005336 Bacteria 1151
54 Ga0068868_100047960 3300005338 Bacteria 3350
55 Ga0070660_100049784 3300005339 Bacteria 3222
56 Ga0070660_100363636 3300005339 Bacteria 1193
57 Ga0070689_100327777 3300005340 Bacteria 1280
58 Ga0070689_100677490 3300005340 Bacteria 899
59 Ga0070674_100016874 3300005356 Bacteria 4582
60 Ga0070673_100026225 3300005364 Bacteria 4302
61 Ga0070688_100335239 3300005365 Bacteria 1103
62 Ga0070659_100000412 3300005366 Bacteria 32519
63 Ga0070659_100040361 3300005366 Bacteria 3646
64 Ga0070667_100467059 3300005367 Bacteria 1154
65 Ga0070700_100311417 3300005441 Bacteria 1153
66 Ga0070700_100745457 3300005441 Bacteria 783
67 Ga0070663_100014280 3300005455 Bacteria 5094
68 Ga0070678_100007878 3300005456 Bacteria 6340
69 Ga0070662_100000468 3300005457 Bacteria 24024
70 Ga0070681_10000627 3300005458 Bacteria 28983
71 Ga0070681_10125196 3300005458 Bacteria 2502
72 Ga0068867_100004302 3300005459 Bacteria 10024
73 Ga0068867_100977383 3300005459 Bacteria 766
74 Ga0070707_100133283 3300005468 Bacteria 2416
75 Ga0070707_100309700 3300005468 Bacteria 1535
76 Ga0070698_100229296 3300005471 Bacteria 1790
77 Ga0070699_100050734 3300005518 Bacteria 3592
78 Ga0070679_100006243 3300005530 Bacteria 11102
79 Ga0070679_100040127 3300005530 Bacteria 4657
80 Ga0070679_100141289 3300005530 Bacteria 2387
81 Ga0070684_100423450 3300005535 Bacteria 1229
82 Ga0070684_100991513 3300005535 Bacteria 788
83 Ga0068853_100039336 3300005539 Bacteria 4033
84 Ga0068853_100231655 3300005539 Bacteria 1690
85 Ga0068853_100428574 3300005539 Bacteria 1241
86 Ga0070672_100191686 3300005543 Bacteria 1707
87 Ga0070693_100597344 3300005547 Bacteria 796
88 Ga0070665_100000118 3300005548 Bacteria 149830
89 Ga0070704_100000050 3300005549 Bacteria 38334
90 Ga0070704_100998476 3300005549 Bacteria 757
91 Ga0068855_100000958 3300005563 Bacteria 35849
92 Ga0068855_100008698 3300005563 Bacteria 12273
93 Ga0068855_100019618 3300005563 Bacteria 8121
94 Ga0068855_100091183 3300005563 Bacteria 3516
95 Ga0068855_100109018 3300005563 Bacteria 3180
96 Ga0068855_100381016 3300005563 Bacteria 1549
97 Ga0068854_100117651 3300005578 Bacteria 2013
98 Ga0068856_100000006 3300005614 Bacteria 223827
99 Ga0068856_100050674 3300005614 Bacteria 4093
100 Ga0068852_100000720 3300005616 Bacteria 21705
101 Ga0068852_100386360 3300005616 Bacteria 1374
102 Ga0068864_100079743 3300005618 Bacteria 2867
103 Ga0068866_10002584 3300005718 Bacteria 7472
104 Ga0068866_10172763 3300005718 Bacteria 1270
105 Ga0068866_10208103 3300005718 Bacteria 1173
106 Ga0068861_100205966 3300005719 Unclassified 1654
107 Ga0068861_100546056 3300005719 Bacteria 1055
108 Ga0068863_100340770 3300005841 Bacteria 1458
109 Ga0068858_100351757 3300005842 Bacteria 1411
110 Ga0068860_101546838 3300005843 Bacteria 685
111 Ga0075366_10014581 3300006195 Bacteria 4490
112 Ga0075366_10042954 3300006195 Bacteria 2677
113 Ga0097621_100000285 3300006237 Bacteria 34046
114 Ga0097621_100340497 3300006237 Bacteria 1332
115 Ga0097621_100612460 3300006237 Bacteria 996
116 Ga0068871_100000080 3300006358 Bacteria 53930
117 Ga0075430_100047773 3300006846 Bacteria 3614
118 Ga0075431_100008882 3300006847 Bacteria 10068
119 Ga0075431_100551069 3300006847 Bacteria 1140
120 Ga0075434_100000318 3300006871 Bacteria 34363
121 Ga0075429_100055559 3300006880 Bacteria 3445
122 Ga0068865_100000218 3300006881 Bacteria 31890
123 Ga0075436_100015330 3300006914 Bacteria 5252
124 Ga0075436_100019266 3300006914 Bacteria 4676
125 Ga0075435_100003168 3300007076 Bacteria 11124
126 Ga0105244_10042625 3300009036 Bacteria 2345
127 Ga0105240_10048169 3300009093 Bacteria 5388
128 Ga0105240_10097171 3300009093 Bacteria 3589
129 Ga0105240_10152098 3300009093 Bacteria 2755
130 Ga0105240_10186200 3300009093 Bacteria 2445
131 Ga0105240_10191749 3300009093 Bacteria 2403
132 Ga0105240_10216578 3300009093 Bacteria 2234
133 Ga0105240_10310454 3300009093 Bacteria 1801
134 Ga0105240_10397261 3300009093 Bacteria 1554
135 Ga0105240_10643183 3300009093 Bacteria 1163
136 Ga0105240_10675164 3300009093 Bacteria 1130
137 Ga0105240_10901263 3300009093 Bacteria 951
138 Ga0105240_10996881 3300009093 Bacteria 896
139 Ga0111539_10014062 3300009094 Bacteria 10002
140 Ga0111539_11293396 3300009094 Bacteria 846
141 Ga0105243_10000046 3300009148 Bacteria 155277
142 Ga0105243_10314960 3300009148 Bacteria 1423
143 Ga0105241_10000999 3300009174 Bacteria 21432
144 Ga0105241_10474511 3300009174 Bacteria 1111
145 Ga0105242_10002835 3300009176 Bacteria 13581
146 Ga0105242_10349946 3300009176 Unclassified 1364
147 Ga0105237_10000088 3300009545 Bacteria 124518
148 Ga0105237_10002840 3300009545 Bacteria 21062
149 Ga0105237_10003145 3300009545 Bacteria 19862
150 Ga0105237_10004869 3300009545 Bacteria 15388
151 Ga0105237_10023283 3300009545 Bacteria 6348
152 Ga0105237_10232232 3300009545 Bacteria 1845
153 Ga0105237_10410378 3300009545 Bacteria 1359
154 Ga0105238_10003441 3300009551 Bacteria 15759
155 Ga0105238_10081249 3300009551 Bacteria 3230
156 Ga0105238_10476982 3300009551 Bacteria 1246
157 Ga0105249_10006600 3300009553 Bacteria 10096
158 Ga0105249_11222409 3300009553 Bacteria 822
159 Ga0105239_10000008 3300010375 Bacteria 376925
160 Ga0105239_10000115 3300010375 Bacteria 113217
161 Ga0105239_10002115 3300010375 Bacteria 25648
162 Ga0105239_10002395 3300010375 Bacteria 23910
163 Ga0105239_10008252 3300010375 Bacteria 11878
164 Ga0105239_10014398 3300010375 Bacteria 8776
165 Ga0105239_10239007 3300010375 Bacteria 2039
166 Ga0105239_10674133 3300010375 Bacteria 1181
167 Ga0105239_10680154 3300010375 Bacteria 1176
168 Ga0105246_10302210 3300011119 Bacteria 1292
169 Ga0105246_10640219 3300011119 Bacteria 924
170 Ga0157373_10000376 3300013100 Bacteria 35743
171 Ga0157373_10000486 3300013100 Bacteria 31473
172 Ga0157373_10000546 3300013100 Bacteria 29458
173 Ga0157373_10042194 3300013100 Bacteria 3261
174 Ga0157373_10405367 3300013100 Bacteria 978
175 Ga0157371_10000151 3300013102 Bacteria 101401
176 Ga0157371_10000888 3300013102 Bacteria 33749
177 Ga0157371_10001401 3300013102 Bacteria 25151
178 Ga0157371_10001845 3300013102 Bacteria 21336
179 Ga0157371_10005485 3300013102 Bacteria 10684
180 Ga0157371_10023303 3300013102 Bacteria 4527
181 Ga0157371_10366364 3300013102 Bacteria 1051
182 Ga0157370_10000597 3300013104 Bacteria 45043
183 Ga0157370_10006731 3300013104 Bacteria 12608
184 Ga0157370_10017828 3300013104 Bacteria 7155
185 Ga0157370_10069775 3300013104 Bacteria 3319
186 Ga0157370_10070205 3300013104 Bacteria 3307
187 Ga0157370_10089848 3300013104 Bacteria 2885
188 Ga0157370_10110214 3300013104 Bacteria 2573
189 Ga0157370_10136766 3300013104 Bacteria 2283
190 Ga0157370_10263023 3300013104 Bacteria 1594
191 Ga0157370_10409702 3300013104 Bacteria 1247
192 Ga0157370_10486180 3300013104 Bacteria 1134
193 Ga0157370_10501905 3300013104 Bacteria 1114
194 Ga0157369_10000101 3300013105 Bacteria 118683
195 Ga0157369_10021519 3300013105 Bacteria 7214
196 Ga0157369_10096977 3300013105 Bacteria 3145
197 Ga0157369_10101557 3300013105 Bacteria 3065
198 Ga0157369_10131283 3300013105 Bacteria 2654
199 Ga0157369_10708961 3300013105 Bacteria 1036
200 Ga0157369_10742467 3300013105 Bacteria 1010
201 Ga0157374_10000741 3300013296 Bacteria 28443
202 Ga0157374_10001208 3300013296 Bacteria 22108
203 Ga0157374_10038994 3300013296 Bacteria 4370
204 Ga0157374_10223725 3300013296 Bacteria 1847
205 Ga0157374_10302577 3300013296 Bacteria 1582
206 Ga0157378_10017834 3300013297 Bacteria 6232
207 Ga0157378_10222586 3300013297 Bacteria 1794
208 Ga0163162_10000011 3300013306 Bacteria 299877
209 Ga0163162_10000012 3300013306 Bacteria 292674
210 Ga0163162_10006625 3300013306 Bacteria 11224
211 Ga0163162_10025616 3300013306 Bacteria 5830
212 Ga0163162_10228148 3300013306 Bacteria 1992
213 Ga0157372_10000041 3300013307 Bacteria 158494
214 Ga0157372_10000199 3300013307 Bacteria 66101
215 Ga0157372_10000538 3300013307 Bacteria 41695
216 Ga0157372_10007865 3300013307 Bacteria 11331
217 Ga0157375_10064342 3300013308 Bacteria 3651
218 Ga0157375_10156528 3300013308 Bacteria 2418
219 Ga0157375_10206292 3300013308 Bacteria 2122
220 Ga0157375_10251304 3300013308 Bacteria 1929
221 Ga0157375_11170978 3300013308 Bacteria 901
222 Ga0163163_10207919 3300014325 Bacteria 2006
223 Ga0163163_10461653 3300014325 Bacteria 1330
224 Ga0163163_10664547 3300014325 Bacteria 1105
225 Ga0157380_10039114 3300014326 Bacteria 3687
226 Ga0182008_10000020 3300014497 Bacteria 228333
227 Ga0182008_10000296 3300014497 Bacteria 39012
228 Ga0182008_10000342 3300014497 Bacteria 36331
229 Ga0182008_10138260 3300014497 Bacteria 1217
230 Ga0182008_10247581 3300014497 Bacteria 919
231 Ga0157379_10086604 3300014968 Bacteria 2809
232 Ga0157376_10090563 3300014969 Bacteria 2647
233 Ga0157376_10637486 3300014969 Bacteria 1065
234 Ga0182006_1000242 3300015261 Bacteria 50864
235 Ga0182006_1000310 3300015261 Bacteria 42614
236 Ga0182006_1000735 3300015261 Bacteria 22520
237 Ga0182006_1005572 3300015261 Bacteria 5979
238 Ga0182006_1022335 3300015261 Bacteria 2632
239 Ga0182007_10008621 3300015262 Bacteria 4173
240 Ga0182007_10062468 3300015262 Bacteria 1221
241 Ga0183373_1002 3300015682 Bacteria 990153
242 Ga0163161_10000330 3300017792 Bacteria 40454
243 Ga0163161_10000565 3300017792 Bacteria 29834
244 Ga0163161_10002836 3300017792 Bacteria 12297
245 Ga0163161_10062000 3300017792 Bacteria 2723
246 Ga0163161_10067561 3300017792 Bacteria 2611
247 Ga0163161_10073200 3300017792 Bacteria 2510
248 Ga0163161_10173456 3300017792 Bacteria 1650
249 Ga0206351_10221156 3300020077 Bacteria 1747
250 Ga0213872_10002511 3300021361 Bacteria 10719
251 Ga0213876_10002643 3300021384 Bacteria 10472
252 Ga0209563_106202 3300025230 Bacteria 2075
253 Ga0207427_100072 3300025231 Bacteria 158364
254 Ga0209437_100026 3300025233 Bacteria 542698
255 Ga0209437_100144 3300025233 Bacteria 164794
256 Ga0207425_1000051 3300025245 Bacteria 166795
257 Ga0209026_1000246 3300025250 Bacteria 69164
258 Ga0209026_1001159 3300025250 Bacteria 12323
259 Ga0209026_1003618 3300025250 Bacteria 4967
260 Ga0209129_1000121 3300025258 Bacteria 135404
261 Ga0209129_1012439 3300025258 Bacteria 1952
262 Ga0209233_1000111 3300025261 Bacteria 260262
263 Ga0209233_1002603 3300025261 Bacteria 6554
264 Ga0209233_1012503 3300025261 Bacteria 2463
265 Ga0209455_1002153 3300025272 Bacteria 7807
266 Ga0209676_1000022 3300025292 Bacteria 605659
267 Ga0209025_1000160 3300025294 Bacteria 166795
268 Ga0209758_1000147 3300025297 Bacteria 166795
269 Ga0209050_1000020 3300025298 Bacteria 605671
270 Ga0209051_1086543 3300025303 Bacteria 886
271 Ga0207642_10018419 3300025899 Bacteria 2680
272 Ga0207642_10166460 3300025899 Bacteria 1189
273 Ga0207647_10000049 3300025904 Bacteria 88392
274 Ga0207647_10000103 3300025904 Bacteria 65792
275 Ga0207647_10116372 3300025904 Bacteria 1578
276 Ga0207645_10000398 3300025907 Bacteria 35913
277 Ga0207705_10000026 3300025909 Bacteria 256051
278 Ga0207705_10049489 3300025909 Bacteria 3024
279 Ga0207705_10229116 3300025909 Bacteria 1413
280 Ga0207684_10395995 3300025910 Bacteria 1187
281 Ga0207654_10075439 3300025911 Bacteria 2015
282 Ga0207707_10010987 3300025912 Bacteria 7877
283 Ga0207695_10007414 3300025913 Bacteria 13973
284 Ga0207695_10015443 3300025913 Bacteria 8988
285 Ga0207695_10092143 3300025913 Bacteria 3041
286 Ga0207695_10097954 3300025913 Bacteria 2932
287 Ga0207695_10185343 3300025913 Bacteria 2000
288 Ga0207695_10383123 3300025913 Bacteria 1292
289 Ga0207695_10416484 3300025913 Bacteria 1228
290 Ga0207671_10000744 3300025914 Bacteria 41309
291 Ga0207671_10004017 3300025914 Bacteria 14293
292 Ga0207671_10006480 3300025914 Bacteria 10419
293 Ga0207671_10007251 3300025914 Bacteria 9654
294 Ga0207671_10009778 3300025914 Bacteria 7981
295 Ga0207671_10104465 3300025914 Bacteria 2149
296 Ga0207671_10266393 3300025914 Bacteria 1349
297 Ga0207660_10205501 3300025917 Bacteria 1540
298 Ga0207660_10346178 3300025917 Bacteria 1191
299 Ga0207657_10076595 3300025919 Bacteria 2821
300 Ga0207657_10225709 3300025919 Bacteria 1499
301 Ga0207652_10004777 3300025921 Bacteria 10982
302 Ga0207652_10027991 3300025921 Bacteria 4700
303 Ga0207646_10097715 3300025922 Bacteria 2631
304 Ga0207646_10785375 3300025922 Bacteria 849
305 Ga0207694_10024569 3300025924 Bacteria 4577
306 Ga0207650_10056844 3300025925 Bacteria 2908
307 Ga0207650_10189142 3300025925 Bacteria 1644
308 Ga0207644_10003140 3300025931 Bacteria 10640
309 Ga0207690_10000049 3300025932 Bacteria 113589
310 Ga0207690_10004182 3300025932 Bacteria 8526
311 Ga0207706_10000111 3300025933 Bacteria 87282
312 Ga0207706_10108611 3300025933 Bacteria 2441
313 Ga0207686_10241814 3300025934 Unclassified 1314
314 Ga0207709_10000020 3300025935 Bacteria 392366
315 Ga0207709_10110310 3300025935 Bacteria 1838
316 Ga0207669_10774433 3300025937 Bacteria 794
317 Ga0207704_10000065 3300025938 Bacteria 69867
318 Ga0207667_10000477 3300025949 Bacteria 53347
319 Ga0207667_10010697 3300025949 Bacteria 10708
320 Ga0207667_10021217 3300025949 Bacteria 7200
321 Ga0207667_10612805 3300025949 Bacteria 1097
322 Ga0207667_10733555 3300025949 Bacteria 988
323 Ga0207651_10066219 3300025960 Bacteria 2537
324 Ga0207712_10078204 3300025961 Bacteria 2400
325 Ga0207668_10447831 3300025972 Unclassified 1101
326 Ga0207640_10035481 3300025981 Bacteria 3122
327 Ga0207677_10049549 3300026023 Bacteria 2835
328 Ga0207703_10317410 3300026035 Bacteria 1426
329 Ga0207639_10007063 3300026041 Bacteria 7658
330 Ga0207639_10156388 3300026041 Bacteria 1916
331 Ga0207639_10369873 3300026041 Bacteria 1285
332 Ga0207678_10025963 3300026067 Bacteria 5112
333 Ga0207708_10597297 3300026075 Unclassified 935
334 Ga0207708_10690005 3300026075 Bacteria 872
335 Ga0207702_10000023 3300026078 Bacteria 189234
336 Ga0207702_10169323 3300026078 Bacteria 2002
337 Ga0207702_10364406 3300026078 Bacteria 1386
338 Ga0207641_10365866 3300026088 Bacteria 1378
339 Ga0207648_10001417 3300026089 Bacteria 26440
340 Ga0207648_10031033 3300026089 Bacteria 4727
341 Ga0207648_10253273 3300026089 Bacteria 1570
342 Ga0207648_11010143 3300026089 Bacteria 779
343 Ga0207676_10035984 3300026095 Unclassified 3763
344 Ga0207674_10084236 3300026116 Bacteria 3178
345 Ga0207675_100438723 3300026118 Bacteria 1292
346 Ga0207675_100749241 3300026118 Bacteria 988
347 Ga0207675_101141607 3300026118 Unclassified 799
348 Ga0207683_10008658 3300026121 Bacteria 8702
349 Ga0207698_10126567 3300026142 Bacteria 2174
350 Ga0207698_10162949 3300026142 Bacteria 1953
351 Ga0207698_10191445 3300026142 Bacteria 1822
352 Ga0209969_1044390 3300027360 Bacteria 693
353 Ga0207428_10074681 3300027907 Bacteria 2658
354 Ga0268266_10000121 3300028379 Bacteria 154995
355 Ga0268265_10017212 3300028380 Bacteria 4983
356 Ga0268264_10399221 3300028381 Bacteria 1321
357 Ga0268264_11186022 3300028381 Bacteria 773
358 Ga0307517_10001388 3300028786 Bacteria 40654
359 Ga0307515_10016181 3300028794 Bacteria 13677
360 Ga0307515_10319199 3300028794 Bacteria 1221
361 Ga0265338_10130761 3300028800 Bacteria 1983
362 Ga0316177_1061403 3300030731 Bacteria 896
363 Ga0316177_1071693 3300030731 Bacteria 4201
364 Ga0316176_1096751 3300030732 Bacteria 6470
365 Ga0316183_1100732 3300030742 Bacteria 40906
366 Ga0316181_1213886 3300030744 Bacteria 3041
367 Ga0316181_1231306 3300030744 Bacteria 13138
368 Ga0265327_10086159 3300031251 Bacteria 1541
369 Ga0265327_10193094 3300031251 Bacteria 926
370 Ga0307509_10050400 3300031507 Bacteria 4458
371 Ga0307408_100000209 3300031548 Bacteria 62437
372 Ga0307408_100000393 3300031548 Bacteria 39808
373 Ga0307408_100000487 3300031548 Bacteria 34716
374 Ga0265313_10116255 3300031595 Bacteria 1171
375 Ga0307405_10012446 3300031731 Bacteria 4504
376 Ga0307412_10000001 3300031911 Bacteria 822691
377 Ga0307412_10000724 3300031911 Bacteria 19071
378 Ga0307412_10083081 3300031911 Bacteria 2219
379 Ga0307412_10149339 3300031911 Bacteria 1722
380 Ga0307412_10286128 3300031911 Unclassified 1296
381 Ga0307409_100713620 3300031995 Bacteria 1003
382 Ga0307416_100490311 3300032002 Bacteria 1291
383 Ga0307414_10001886 3300032004 Bacteria 10825
384 Ga0307414_10013334 3300032004 Bacteria 4890
385 Ga0307414_10019675 3300032004 Bacteria 4190
386 Ga0307414_10052108 3300032004 Bacteria 2846
387 Ga0307414_10058710 3300032004 Bacteria 2712
388 Ga0307414_10060303 3300032004 Bacteria 2682
389 Ga0307414_10068665 3300032004 Bacteria 2544
390 Ga0307414_10098407 3300032004 Bacteria 2194
391 Ga0307414_10192770 3300032004 Bacteria 1650
392 Ga0307414_10209358 3300032004 Bacteria 1592
393 Ga0307510_10000419 3300033180 Bacteria 40732
394 Ga0373941_0106381 3300035115 Unclassified 983
395 Ga0373954_0000087 3300035118 Bacteria 31710
396 Ga0373955_0032403 3300035172 Bacteria 2743
397 Ga0373942_0001205 3300035207 Bacteria 6822
398 Ga0373924_0248595 3300035410 Bacteria 787
399 Ga0373931_0007503 3300035691 Bacteria 5135
400 Ga0373931_0235284 3300035691 Bacteria 1108
401 Ga0373933_0107137 3300035724 Bacteria 1739
402 Ga0373937_0000296 3300036401 Bacteria 47231
403 Ga0395899_0000024 3300037312 Bacteria 357402
404 Ga0395899_0000237 3300037312 Bacteria 74249
405 Ga0395900_0001123 3300037418 Bacteria 33875
406 Ga0395900_0001352 3300037418 Bacteria 29621
407 Ga0395900_0004216 3300037418 Bacteria 15260
408 Ga0395900_0700686 3300037418 Bacteria 946
409 Ga0395898_0022388 3300037466 Bacteria 6400
410 Ga0395898_0763171 3300037466 Bacteria 908
411 Ga0395905_0000246 3300037471 Bacteria 81356
412 Ga0395905_0000347 3300037471 Bacteria 65943
413 Ga0395901_0000184 3300038443 Bacteria 81257
414 Ga0395901_0109857 3300038443 Bacteria 2895
415 Ga0395901_0134229 3300038443 Bacteria 2601
416 Ga0400489_23297 3300039093 Bacteria 1043
417 Ga0436365_0017022 3300039437 Bacteria 19896
418 Ga0436365_1865498 3300039437 Bacteria 1040
419 Ga0436365_1931949 3300039437 Bacteria 26658
420 Ga0436361_1055999 3300039447 Bacteria 7793
421 Ga0451793_0339311 3300041452 Bacteria 932
422 Ga0451802_1573306 3300041460 Bacteria 1073
423 Ga0451835_0168801 3300041492 Unclassified 1461
424 Ga0451843_0248749 3300041509 Bacteria 1120
425 Ga0451853_0991347 3300041512 Bacteria 784
426 Ga0439448_0002050 3300042005 Bacteria 5402
427 Ga0439457_024042 3300042014 Bacteria 1348
428 Ga0466969_0032983 3300044656 Bacteria 2632
429 Ga0466966_0010043 3300044684 Bacteria 6274
430 Ga0466961_0037243 3300044693 Bacteria 3121
431 Ga0466964_0035307 3300044706 Bacteria 1998
432 Ga0466968_0113713 3300044735 Bacteria 1219
433 Ga0466970_0285335 3300044765 Bacteria 929
434 Ga0451576_0247853 3300045051 Bacteria 1861
435 Ga0451576_1388416 3300045051 Unclassified 731
436 Ga0466958_0027342 3300045836 Bacteria 3377
437 Ga0466967_0000469 3300045976 Bacteria 19507
438 Ga0495650_0000098 3300046471 Bacteria 215716
439 Ga0495605_0017082 3300046474 Unclassified 3917
440 Ga0495585_0000308 3300046492 Bacteria 48809
441 Ga0495583_0032516 3300046506 Bacteria 2518
442 Ga0495583_0044858 3300046506 Bacteria 2048
443 Ga0495606_0006041 3300046507 Bacteria 11328
444 Ga0495606_0020092 3300046507 Bacteria 4938
445 Ga0495606_0035610 3300046507 Bacteria 3401
446 Ga0495606_0106567 3300046507 Bacteria 1697
447 Ga0495610_0000054 3300046512 Bacteria 140031
448 Ga0495616_0000433 3300046513 Bacteria 31968
449 Ga0495616_0006824 3300046513 Bacteria 6878
450 Ga0495632_0045318 3300046519 Bacteria 2191
451 Ga0495643_0035714 3300046522 Bacteria 2735
452 Ga0495648_0041623 3300046524 Bacteria 2899
453 Ga0495642_0285348 3300046528 Bacteria 723
454 Ga0495609_0020070 3300046538 Bacteria 3089
455 Ga0495633_0011309 3300046558 Bacteria 4818
456 Ga0495668_0000963 3300046616 Bacteria 31968
457 Ga0495668_0114690 3300046616 Bacteria 1474
458 Ga0495625_0000183 3300046660 Bacteria 98174
459 Ga0495625_0021304 3300046660 Bacteria 4993
460 Ga0495625_0075871 3300046660 Bacteria 2351
461 Ga0495625_0144600 3300046660 Bacteria 1602
462 Ga0495661_0003387 3300046665 Bacteria 11796
463 Ga0495661_0003737 3300046665 Bacteria 11149
464 Ga0495661_0045590 3300046665 Bacteria 2680
465 Ga0495671_0062011 3300046692 Bacteria 1843
466 Ga0495649_0000046 3300046694 Bacteria 120254
467 Ga0495649_0067759 3300046694 Bacteria 1915
468 Ga0495660_0002367 3300046810 Bacteria 12053
469 Ga0495672_0006319 3300047320 Bacteria 9212
470 Ga0495683_0010104 3300047323 Bacteria 5001
471 Ga0495687_007696 3300047443 Bacteria 6290
472 Ga0495686_0001597 3300047472 Bacteria 23929
473 Ga0495686_0015329 3300047472 Bacteria 5239
474 Ga0495686_0030576 3300047472 Bacteria 3497
475 Ga0496116_0004756 3300048919 Bacteria 12822
476 Ga0496117_0000995 3300048920 Bacteria 43366
477 Ga0496122_0000817 3300048925 Bacteria 59596
478 Ga0496122_0060092 3300048925 Bacteria 2801
479 Ga0496123_0008229 3300048926 Bacteria 9615
480 Ga0496123_0027067 3300048926 Bacteria 4279
481 Ga0496125_0304610 3300048928 Bacteria 974
482 Ga0495678_006015 3300049459 Bacteria 6543
483 Ga0501031_0021291 3300049568 Bacteria 4227
484 Ga0501033_0068767 3300049570 Bacteria 2603
485 Ga0501033_0107917 3300049570 Bacteria 2028
486 Ga0501034_0000002 3300049571 Bacteria 565510
487 Ga0501034_0004775 3300049571 Bacteria 15000
488 Ga0501034_0013117 3300049571 Bacteria 8540
489 Ga0501034_0022667 3300049571 Bacteria 6396
490 Ga0501034_0345596 3300049571 Bacteria 1417
491 Ga0501036_0000813 3300049572 Bacteria 23193
492 Ga0501036_0074613 3300049572 Bacteria 2869
493 Ga0501037_0071865 3300049573 Bacteria 2517
494 Ga0501038_0003073 3300049574 Bacteria 15555
495 Ga0501038_0065228 3300049574 Bacteria 3103
496 Ga0501038_0334181 3300049574 Bacteria 1183
497 Ga0501039_0009779 3300049575 Bacteria 7306
498 Ga0501039_0097242 3300049575 Bacteria 2296
499 Ga0501039_0437114 3300049575 Bacteria 1028
500 Ga0501040_0050250 3300049576 Bacteria 2851
501 Ga0501041_0001139 3300049577 Bacteria 14553
502 Ga0501041_0012717 3300049577 Bacteria 4987
503 Ga0501043_0025429 3300049579 Bacteria 4646
504 Ga0501043_0447510 3300049579 Bacteria 971
505 Ga0501046_0011178 3300049580 Bacteria 7691
506 Ga0501047_0550726 3300049581 Bacteria 978
507 Ga0501048_0040000 3300049582 Bacteria 3361
508 Ga0501048_0108631 3300049582 Bacteria 1958
509 Ga0501069_0266341 3300049585 Bacteria 1001
510 Ga0501070_0059508 3300049586 Bacteria 3167
511 Ga0501071_0007860 3300049587 Bacteria 7034
512 Ga0501071_0589265 3300049587 Bacteria 855
513 Ga0501072_0013016 3300049588 Bacteria 6367
514 Ga0501073_0474445 3300049589 Bacteria 865
515 Ga0501074_0047295 3300049590 Bacteria 3110
516 Ga0501075_0090559 3300049591 Bacteria 2320
517 Ga0501076_0002359 3300049592 Bacteria 12925
518 Ga0501077_0000739 3300049593 Bacteria 19791
519 Ga0501198_001244 3300049649 Bacteria 3288
520 Ga0501223_001575 3300049663 Bacteria 5252
521 Ga0501243_016482 3300049675 Bacteria 1193
522 Ga0501252_006249 3300049682 Bacteria 1319
523 Ga0501079_0003530 3300049741 Bacteria 11495
524 Ga0501079_0472761 3300049741 Bacteria 985
525 Ga0501080_0009560 3300049742 Bacteria 8851
526 Ga0501081_0044098 3300049743 Bacteria 3060
527 Ga0501081_0455488 3300049743 Bacteria 951
528 Ga0501083_0392857 3300049744 Bacteria 902
529 Ga0501241_002477 3300049758 Bacteria 3570
530 Ga0501241_016529 3300049758 Bacteria 1346
531 Ga0501035_0088519 3300049822 Bacteria 2728
532 Ga0501044_0014346 3300049823 Bacteria 8555
533 Ga0501045_0030748 3300049824 Bacteria 3887
534 Ga0501045_0073748 3300049824 Bacteria 2513
535 nmdc:mga0k408_16491_c1 3300050493 Bacteria 4100
536 nmdc:mga0k408_671_c1 3300050493 Bacteria 13349
537 nmdc:mga09592_310251_c1 3300050508 Bacteria 1367
538 nmdc:mga0qj67_23955_c1 3300050509 Bacteria 4701
539 nmdc:mga0qj67_515449_c1 3300050509 Bacteria 961
540 nmdc:mga06r32_513442_c1 3300050510 Bacteria 1174
541 nmdc:mga08y16_15272_c1 3300050511 Bacteria 8078
542 nmdc:mga08y16_627299_c1 3300050511 Bacteria 1081
543 nmdc:mga0n895_4843_c1 3300050512 Bacteria 11156
544 nmdc:mga0rr50_4012_c1 3300050513 Bacteria 8584
545 nmdc:mga08x19_23291_c1 3300050514 Bacteria 3841
546 nmdc:mga08x19_3855_c1 3300050514 Bacteria 8926
547 Ga0500635_0002410 3300053080 Bacteria 4631
548 Ga0500651_0001978 3300053093 Bacteria 10625
549 Ga0500608_000417 3300053122 Bacteria 16208
550 Ga0500642_0092787 3300053130 Bacteria 1397
551 Ga0500624_000230 3300053157 Bacteria 20306
552 Ga0501084_0074508 3300054114 Bacteria 2842
553 Ga0587073_0024615 3300059492 Bacteria 1190
554 Ga0501082_0963381 3300060353 Bacteria 746
555 Ga0530510_0000675 3300061734 Bacteria 21957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100413117 Ga0070680_1004131172 180
2 3300005458 Ga0070681_10000627 Ga0070681_1000062723 180
3 3300005530 Ga0070679_100040127 Ga0070679_1000401278 180
4 3300025912 Ga0207707_10010987 Ga0207707_100109873 180
5 3300025917 Ga0207660_10346178 Ga0207660_103461782 180
6 3300025921 Ga0207652_10027991 Ga0207652_100279912 180
7 3300049592 Ga0501076_0002359 Ga0501076_0002359_960_1511 180
8 3300049585 Ga0501069_0266341 Ga0501069_0266341_81_668 181
9 3300049568 Ga0501031_0021291 Ga0501031_0021291_2836_3411 182
10 3300049570 Ga0501033_0068767 Ga0501033_0068767_768_1343 182
11 3300049571 Ga0501034_0345596 Ga0501034_0345596_40_615 182
12 3300049572 Ga0501036_0000813 Ga0501036_0000813_8800_9375 182
13 3300049572 Ga0501036_0074613 Ga0501036_0074613_466_1026 182
14 3300049573 Ga0501037_0071865 Ga0501037_0071865_1824_2399 182
15 3300049574 Ga0501038_0003073 Ga0501038_0003073_13724_14299 182
16 3300049574 Ga0501038_0334181 Ga0501038_0334181_456_1016 182
17 3300049575 Ga0501039_0009779 Ga0501039_0009779_1173_1748 182
18 3300049575 Ga0501039_0097242 Ga0501039_0097242_98_658 182
19 3300049575 Ga0501039_0437114 Ga0501039_0437114_227_790 182
20 3300049576 Ga0501040_0050250 Ga0501040_0050250_1620_2195 182
21 3300049577 Ga0501041_0001139 Ga0501041_0001139_5941_6516 182
22 3300049577 Ga0501041_0012717 Ga0501041_0012717_3220_3780 182
23 3300049579 Ga0501043_0025429 Ga0501043_0025429_2307_2882 182
24 3300049579 Ga0501043_0447510 Ga0501043_0447510_375_935 182
25 3300049580 Ga0501046_0011178 Ga0501046_0011178_1562_2137 182
26 3300049582 Ga0501048_0040000 Ga0501048_0040000_576_1136 182
27 3300049582 Ga0501048_0108631 Ga0501048_0108631_797_1372 182
28 3300049586 Ga0501070_0059508 Ga0501070_0059508_777_1352 182
29 3300049587 Ga0501071_0007860 Ga0501071_0007860_5247_5822 182
30 3300049587 Ga0501071_0589265 Ga0501071_0589265_33_593 182
31 3300049588 Ga0501072_0013016 Ga0501072_0013016_995_1570 182
32 3300049589 Ga0501073_0474445 Ga0501073_0474445_107_682 182
33 3300049590 Ga0501074_0047295 Ga0501074_0047295_1592_2167 182
34 3300049591 Ga0501075_0090559 Ga0501075_0090559_743_1318 182
35 3300049593 Ga0501077_0000739 Ga0501077_0000739_5697_6272 182
36 3300049741 Ga0501079_0003530 Ga0501079_0003530_1004_1579 182
37 3300049742 Ga0501080_0009560 Ga0501080_0009560_5221_5796 182
38 3300049743 Ga0501081_0044098 Ga0501081_0044098_1828_2403 182
39 3300049744 Ga0501083_0392857 Ga0501083_0392857_127_702 182
40 3300049822 Ga0501035_0088519 Ga0501035_0088519_714_1289 182
41 3300049824 Ga0501045_0030748 Ga0501045_0030748_2496_3056 182
42 3300049824 Ga0501045_0073748 Ga0501045_0073748_715_1290 182
43 3300054114 Ga0501084_0074508 Ga0501084_0074508_1554_2129 182
44 3300061734 Ga0530510_0000675 Ga0530510_0000675_12369_12944 182
45 3300045051 Ga0451576_1388416 Ga0451576_1388416_158_715 185
46 3300009551 Ga0105238_10476982 Ga0105238_104769822 186
47 3300044706 Ga0466964_0035307 Ga0466964_0035307_156_731 186
48 3300045976 Ga0466967_0000469 Ga0466967_0000469_13540_14115 186
49 3300060353 Ga0501082_0963381 Ga0501082_0963381_41_616 186
50 3300005468 Ga0070707_100133283 Ga0070707_1001332832 187
51 3300005518 Ga0070699_100050734 Ga0070699_1000507344 187
52 3300005549 Ga0070704_100000050 Ga0070704_10000005024 187
53 3300005842 Ga0068858_100351757 Ga0068858_1003517573 187
54 3300006237 Ga0097621_100612460 Ga0097621_1006124602 187
55 3300006847 Ga0075431_100551069 Ga0075431_1005510691 187
56 3300009094 Ga0111539_11293396 Ga0111539_112933962 187
57 3300014325 Ga0163163_10207919 Ga0163163_102079192 187
58 3300014968 Ga0157379_10086604 Ga0157379_100866045 187
59 3300025922 Ga0207646_10097715 Ga0207646_100977152 187
60 3300026035 Ga0207703_10317410 Ga0207703_103174101 187
61 3300027360 Ga0209969_1044390 Ga0209969_10443901 187
62 3300028380 Ga0268265_10017212 Ga0268265_100172124 187
63 3300032002 Ga0307416_100490311 Ga0307416_1004903112 187
64 3300035118 Ga0373954_0000087 Ga0373954_0000087_8688_9266 187
65 3300035172 Ga0373955_0032403 Ga0373955_0032403_1174_1752 187
66 3300035410 Ga0373924_0248595 Ga0373924_0248595_66_644 187
67 3300035691 Ga0373931_0235284 Ga0373931_0235284_129_707 187
68 3300035724 Ga0373933_0107137 Ga0373933_0107137_418_996 187
69 3300036401 Ga0373937_0000296 Ga0373937_0000296_8128_8706 187
70 3300045051 Ga0451576_0247853 Ga0451576_0247853_456_1034 187
71 3300049741 Ga0501079_0472761 Ga0501079_0472761_247_819 187
72 3300049743 Ga0501081_0455488 Ga0501081_0455488_108_680 187
73 3300050508 nmdc:mga09592_310251_c1 nmdc:mga09592_310251_c1_537_1109 187
74 3300050510 nmdc:mga06r32_513442_c1 nmdc:mga06r32_513442_c1_522_1094 187
75 iso_pu_bacteria 2883291878 2883294564 187
76 3300006846 Ga0075430_100047773 Ga0075430_1000477735 188
77 3300009094 Ga0111539_10014062 Ga0111539_100140626 188
78 3300027907 Ga0207428_10074681 Ga0207428_100746813 188
79 3300050509 nmdc:mga0qj67_515449_c1 nmdc:mga0qj67_515449_c1_134_703 188
80 3300050511 nmdc:mga08y16_15272_c1 nmdc:mga08y16_15272_c1_4287_4856 188
81 3300006871 Ga0075434_100000318 Ga0075434_10000031822 190
82 3300006914 Ga0075436_100015330 Ga0075436_1000153307 190
83 3300006914 Ga0075436_100019266 Ga0075436_1000192666 190
84 3300007076 Ga0075435_100003168 Ga0075435_1000031689 190
85 3300050512 nmdc:mga0n895_4843_c1 nmdc:mga0n895_4843_c1_8009_8599 190
86 3300050513 nmdc:mga0rr50_4012_c1 nmdc:mga0rr50_4012_c1_2666_3256 190
87 3300050514 nmdc:mga08x19_23291_c1 nmdc:mga08x19_23291_c1_987_1577 190
88 3300050514 nmdc:mga08x19_3855_c1 nmdc:mga08x19_3855_c1_7802_8392 190
89 iso_pu_bacteria 2887375801 2887381318 190
90 3300005468 Ga0070707_100309700 Ga0070707_1003097003 191
91 3300005471 Ga0070698_100229296 Ga0070698_1002292962 191
92 3300005549 Ga0070704_100998476 Ga0070704_1009984762 191
93 3300013297 Ga0157378_10222586 Ga0157378_102225862 191
94 3300025910 Ga0207684_10395995 Ga0207684_103959952 191
95 3300025922 Ga0207646_10785375 Ga0207646_107853752 191
96 3300035115 Ga0373941_0106381 Ga0373941_0106381_348_950 191
97 3300035691 Ga0373931_0007503 Ga0373931_0007503_2870_3472 191
98 3300005614 Ga0068856_100050674 Ga0068856_1000506742 192
99 3300026078 Ga0207702_10169323 Ga0207702_101693232 192
100 3300031251 Ga0265327_10193094 Ga0265327_101930941 192
101 3300035207 Ga0373942_0001205 Ga0373942_0001205_1647_2252 194
102 3300026116 Ga0207674_10084236 Ga0207674_100842364 195
103 3300025913 Ga0207695_10185343 Ga0207695_101853431 196
104 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00000890 197
105 3300002459 JGI24751J29686_10000772 JGI24751J29686_100007726 197
106 3300005331 Ga0070670_100008042 Ga0070670_1000080422 197
107 3300005331 Ga0070670_100193626 Ga0070670_1001936263 197
108 3300005331 Ga0070670_100465243 Ga0070670_1004652431 197
109 3300005340 Ga0070689_100327777 Ga0070689_1003277772 197
110 3300005340 Ga0070689_100677490 Ga0070689_1006774902 197
111 3300005356 Ga0070674_100016874 Ga0070674_1000168742 197
112 3300005365 Ga0070688_100335239 Ga0070688_1003352392 197
113 3300005441 Ga0070700_100311417 Ga0070700_1003114171 197
114 3300005441 Ga0070700_100745457 Ga0070700_1007454571 197
115 3300005459 Ga0068867_100977383 Ga0068867_1009773831 197
116 3300005535 Ga0070684_100991513 Ga0070684_1009915131 197
117 3300005539 Ga0068853_100428574 Ga0068853_1004285742 197
118 3300005547 Ga0070693_100597344 Ga0070693_1005973441 197
119 3300005618 Ga0068864_100079743 Ga0068864_1000797433 197
120 3300005718 Ga0068866_10172763 Ga0068866_101727632 197
121 3300005719 Ga0068861_100546056 Ga0068861_1005460562 197
122 3300005841 Ga0068863_100340770 Ga0068863_1003407702 197
123 3300005843 Ga0068860_101546838 Ga0068860_1015468381 197
124 3300006237 Ga0097621_100340497 Ga0097621_1003404973 197
125 3300009093 Ga0105240_10191749 Ga0105240_101917492 197
126 3300009148 Ga0105243_10314960 Ga0105243_103149602 197
127 3300009176 Ga0105242_10349946 Ga0105242_103499461 197
128 3300009553 Ga0105249_10006600 Ga0105249_100066005 197
129 3300009553 Ga0105249_11222409 Ga0105249_112224092 197
130 3300011119 Ga0105246_10640219 Ga0105246_106402191 197
131 3300013105 Ga0157369_10096977 Ga0157369_100969772 197
132 3300013296 Ga0157374_10223725 Ga0157374_102237254 197
133 3300014325 Ga0163163_10461653 Ga0163163_104616532 197
134 3300014325 Ga0163163_10664547 Ga0163163_106645471 197
135 3300014326 Ga0157380_10039114 Ga0157380_100391144 197
136 3300017792 Ga0163161_10062000 Ga0163161_100620003 197
137 3300025899 Ga0207642_10166460 Ga0207642_101664602 197
138 3300025925 Ga0207650_10056844 Ga0207650_100568442 197
139 3300025925 Ga0207650_10189142 Ga0207650_101891422 197
140 3300025935 Ga0207709_10110310 Ga0207709_101103102 197
141 3300025961 Ga0207712_10078204 Ga0207712_100782042 197
142 3300026041 Ga0207639_10369873 Ga0207639_103698732 197
143 3300026075 Ga0207708_10597297 Ga0207708_105972972 197
144 3300026075 Ga0207708_10690005 Ga0207708_106900052 197
145 3300026088 Ga0207641_10365866 Ga0207641_103658662 197
146 3300026089 Ga0207648_10031033 Ga0207648_100310333 197
147 3300026089 Ga0207648_10253273 Ga0207648_102532732 197
148 3300026089 Ga0207648_11010143 Ga0207648_110101431 197
149 3300026095 Ga0207676_10035984 Ga0207676_100359842 197
150 3300026118 Ga0207675_100438723 Ga0207675_1004387232 197
151 3300026118 Ga0207675_100749241 Ga0207675_1007492411 197
152 3300026142 Ga0207698_10191445 Ga0207698_101914453 197
153 3300028381 Ga0268264_10399221 Ga0268264_103992212 197
154 3300028381 Ga0268264_11186022 Ga0268264_111860222 197
155 3300039437 Ga0436365_0017022 Ga0436365_0017022_18078_18674 197
156 3300039437 Ga0436365_1865498 Ga0436365_1865498_31_627 197
157 3300041509 Ga0451843_0248749 Ga0451843_0248749_344_940 197
158 3300041512 Ga0451853_0991347 Ga0451853_0991347_26_622 197
159 3300044765 Ga0466970_0285335 Ga0466970_0285335_52_648 197
160 3300046522 Ga0495643_0035714 Ga0495643_0035714_1864_2466 197
161 3300046616 Ga0495668_0000963 Ga0495668_0000963_25458_26054 197
162 3300047320 Ga0495672_0006319 Ga0495672_0006319_4468_5067 197
163 3300049570 Ga0501033_0107917 Ga0501033_0107917_242_838 197
164 3300049571 Ga0501034_0000002 Ga0501034_0000002_275402_275995 197
165 3300049571 Ga0501034_0013117 Ga0501034_0013117_7270_7866 197
166 3300049571 Ga0501034_0022667 Ga0501034_0022667_423_1019 197
167 3300049581 Ga0501047_0550726 Ga0501047_0550726_237_833 197
168 3300049823 Ga0501044_0014346 Ga0501044_0014346_745_1341 197
169 3300050511 nmdc:mga08y16_627299_c1 nmdc:mga08y16_627299_c1_168_764 197
170 3300005329 Ga0070683_100008086 Ga0070683_1000080869 198
171 3300003322 rootL2_10020975 rootL2_100209756 200
172 3300005719 Ga0068861_100205966 Ga0068861_1002059662 201
173 3300049571 Ga0501034_0004775 Ga0501034_0004775_7761_8396 201
174 3300005289 Ga0065704_10166991 Ga0065704_101669912 203
175 3300005535 Ga0070684_100423450 Ga0070684_1004234502 203
176 3300028794 Ga0307515_10016181 Ga0307515_1001618110 203
177 3300005289 Ga0065704_10099903 Ga0065704_100999033 204
178 3300025934 Ga0207686_10241814 Ga0207686_102418142 204
179 3300025972 Ga0207668_10447831 Ga0207668_104478312 204
180 3300026118 Ga0207675_101141607 Ga0207675_1011416071 204
181 iso_pu_bacteria 2721755487 2722731230 204
182 iso_pu_bacteria 2896344016 2896347310 204
183 iso_pu_bacteria 2902048731 2902052092 204
184 iso_pu_bacteria 2904780799 2904782306 204
185 iso_pu_bacteria 2919177583 2919178497 204
186 3300039093 Ga0400489_23297 Ga0400489_23297_18_647 205
187 iso_pu_bacteria 2585427687 2586206413 205
188 iso_pu_bacteria 2599185184 2599481747 205
189 iso_pu_bacteria 2738541284 2738761377 205
190 iso_pu_bacteria 2738541302 2738852877 205
191 iso_pu_bacteria 2738543023 2739304347 205
192 iso_pu_bacteria 2739367651 2739586821 205
193 iso_pu_bacteria 2739367656 2739615138 205
194 iso_pu_bacteria 2739367663 2739645725 205
195 iso_pu_bacteria 2775506987 2776616011 205
196 iso_pu_bacteria 2818991437 2819547243 205
197 iso_pu_bacteria 2842722452 2842726988 205
198 iso_pu_bacteria 2842909656 2842911010 205
199 iso_pu_bacteria 2849281842 2849283870 205
200 iso_pu_bacteria 2852623160 2852627100 205
201 iso_pu_bacteria 2857627736 2857627927 205
202 iso_pu_bacteria 2884933994 2884935166 205
203 iso_pu_bacteria 2896317667 2896320285 205
204 iso_pu_bacteria 2904445276 2904447724 205
205 iso_pu_bacteria 2919437846 2919439401 205
206 iso_pu_bacteria 2928078545 2928082020 205
207 iso_pu_bacteria 2928147474 2928152040 205
208 iso_pu_bacteria 2932082852 2932088075 205
209 iso_pu_bacteria 2954016120 2954020358 205
210 iso_pu_bacteria 3003233435 3003235904 205
211 iso_pu_bacteria 8055588893 8055591401 205
212 3300009545 Ga0105237_10004869 Ga0105237_1000486910 206
213 3300021384 Ga0213876_10002643 Ga0213876_100026439 206
214 3300025914 Ga0207671_10007251 Ga0207671_1000725110 206
215 3300031251 Ga0265327_10086159 Ga0265327_100861592 206
216 3300039437 Ga0436365_1931949 Ga0436365_1931949_17134_17772 206
217 3300041492 Ga0451835_0168801 Ga0451835_0168801_61_711 206
218 iso_pu_bacteria 2738541283 2738755961 206
219 iso_pu_bacteria 2852627209 2852628202 206
220 iso_pu_bacteria 2919186247 2919188562 206
221 iso_pu_bacteria 2939664404 2939667283 206
222 3300001904 JGI24736J21556_1000812 JGI24736J21556_10008123 207
223 3300001904 JGI24736J21556_1001942 JGI24736J21556_10019425 207
224 3300001979 JGI24740J21852_10012653 JGI24740J21852_100126533 207
225 3300001989 JGI24739J22299_10001457 JGI24739J22299_100014571 207
226 3300001990 JGI24737J22298_10000852 JGI24737J22298_100008529 207
227 3300001990 JGI24737J22298_10001745 JGI24737J22298_100017452 207
228 3300001990 JGI24737J22298_10002702 JGI24737J22298_100027022 207
229 3300001990 JGI24737J22298_10015372 JGI24737J22298_100153722 207
230 3300001990 JGI24737J22298_10024646 JGI24737J22298_100246462 207
231 3300002067 JGI24735J21928_10000027 JGI24735J21928_1000002738 207
232 3300002067 JGI24735J21928_10015914 JGI24735J21928_100159142 207
233 3300002772 JGI25164J39214_1001144 JGI25164J39214_10011444 207
234 3300003214 JGI25165J46597_1001050 JGI25165J46597_10010503 207
235 3300003214 JGI25165J46597_1008856 JGI25165J46597_10088562 207
236 3300003316 rootH1_10031584 rootH1_1003158412 207
237 3300003320 rootH2_10001273 rootH2_10001273155 207
238 3300003320 rootH2_10114261 rootH2_101142611 207
239 3300003323 rootH1_10024310 rootH1_1002431039 207
240 3300003323 rootH1_10083498 rootH1_100834983 207
241 3300003323 rootH1_10124986 rootH1_101249862 207
242 3300004799 Ga0058863_11920979 Ga0058863_119209792 207
243 3300004803 Ga0058862_12833523 Ga0058862_128335233 207
244 3300005288 Ga0065714_10002980 Ga0065714_100029805 207
245 3300005327 Ga0070658_10111073 Ga0070658_101110732 207
246 3300005327 Ga0070658_10226211 Ga0070658_102262112 207
247 3300005327 Ga0070658_10259587 Ga0070658_102595872 207
248 3300005328 Ga0070676_10014740 Ga0070676_100147403 207
249 3300005336 Ga0070680_100247464 Ga0070680_1002474642 207
250 3300005338 Ga0068868_100047960 Ga0068868_1000479602 207
251 3300005339 Ga0070660_100049784 Ga0070660_1000497843 207
252 3300005339 Ga0070660_100363636 Ga0070660_1003636361 207
253 3300005364 Ga0070673_100026225 Ga0070673_1000262253 207
254 3300005366 Ga0070659_100000412 Ga0070659_1000004129 207
255 3300005366 Ga0070659_100040361 Ga0070659_1000403613 207
256 3300005367 Ga0070667_100467059 Ga0070667_1004670592 207
257 3300005455 Ga0070663_100014280 Ga0070663_1000142804 207
258 3300005456 Ga0070678_100007878 Ga0070678_1000078783 207
259 3300005457 Ga0070662_100000468 Ga0070662_10000046813 207
260 3300005458 Ga0070681_10125196 Ga0070681_101251964 207
261 3300005459 Ga0068867_100004302 Ga0068867_1000043023 207
262 3300005530 Ga0070679_100006243 Ga0070679_1000062437 207
263 3300005530 Ga0070679_100141289 Ga0070679_1001412892 207
264 3300005539 Ga0068853_100039336 Ga0068853_1000393363 207
265 3300005539 Ga0068853_100231655 Ga0068853_1002316552 207
266 3300005543 Ga0070672_100191686 Ga0070672_1001916861 207
267 3300005548 Ga0070665_100000118 Ga0070665_100000118146 207
268 3300005563 Ga0068855_100000958 Ga0068855_1000009584 207
269 3300005563 Ga0068855_100008698 Ga0068855_1000086988 207
270 3300005563 Ga0068855_100019618 Ga0068855_1000196183 207
271 3300005563 Ga0068855_100091183 Ga0068855_1000911832 207
272 3300005563 Ga0068855_100109018 Ga0068855_1001090182 207
273 3300005563 Ga0068855_100381016 Ga0068855_1003810163 207
274 3300005578 Ga0068854_100117651 Ga0068854_1001176511 207
275 3300005614 Ga0068856_100000006 Ga0068856_10000000644 207
276 3300005616 Ga0068852_100000720 Ga0068852_10000072011 207
277 3300005616 Ga0068852_100386360 Ga0068852_1003863602 207
278 3300005718 Ga0068866_10002584 Ga0068866_100025843 207
279 3300005718 Ga0068866_10208103 Ga0068866_102081032 207
280 3300006195 Ga0075366_10014581 Ga0075366_100145815 207
281 3300006195 Ga0075366_10042954 Ga0075366_100429542 207
282 3300006237 Ga0097621_100000285 Ga0097621_10000028515 207
283 3300006358 Ga0068871_100000080 Ga0068871_10000008042 207
284 3300006881 Ga0068865_100000218 Ga0068865_10000021819 207
285 3300009093 Ga0105240_10048169 Ga0105240_100481695 207
286 3300009093 Ga0105240_10097171 Ga0105240_100971713 207
287 3300009093 Ga0105240_10152098 Ga0105240_101520982 207
288 3300009093 Ga0105240_10186200 Ga0105240_101862003 207
289 3300009093 Ga0105240_10216578 Ga0105240_102165782 207
290 3300009093 Ga0105240_10310454 Ga0105240_103104543 207
291 3300009093 Ga0105240_10397261 Ga0105240_103972612 207
292 3300009093 Ga0105240_10675164 Ga0105240_106751642 207
293 3300009093 Ga0105240_10901263 Ga0105240_109012632 207
294 3300009093 Ga0105240_10996881 Ga0105240_109968812 207
295 3300009174 Ga0105241_10000999 Ga0105241_100009993 207
296 3300009174 Ga0105241_10474511 Ga0105241_104745111 207
297 3300009176 Ga0105242_10002835 Ga0105242_100028354 207
298 3300009545 Ga0105237_10002840 Ga0105237_1000284012 207
299 3300009545 Ga0105237_10003145 Ga0105237_1000314510 207
300 3300009545 Ga0105237_10023283 Ga0105237_100232832 207
301 3300009545 Ga0105237_10232232 Ga0105237_102322322 207
302 3300009545 Ga0105237_10410378 Ga0105237_104103782 207
303 3300009551 Ga0105238_10003441 Ga0105238_100034418 207
304 3300009551 Ga0105238_10081249 Ga0105238_100812495 207
305 3300010375 Ga0105239_10000115 Ga0105239_1000011579 207
306 3300010375 Ga0105239_10002115 Ga0105239_1000211513 207
307 3300010375 Ga0105239_10002395 Ga0105239_1000239514 207
308 3300010375 Ga0105239_10008252 Ga0105239_100082529 207
309 3300010375 Ga0105239_10014398 Ga0105239_100143983 207
310 3300010375 Ga0105239_10239007 Ga0105239_102390073 207
311 3300010375 Ga0105239_10674133 Ga0105239_106741331 207
312 3300010375 Ga0105239_10680154 Ga0105239_106801542 207
313 3300011119 Ga0105246_10302210 Ga0105246_103022102 207
314 3300013100 Ga0157373_10000486 Ga0157373_1000048625 207
315 3300013102 Ga0157371_10001401 Ga0157371_100014019 207
316 3300013102 Ga0157371_10005485 Ga0157371_100054857 207
317 3300013104 Ga0157370_10089848 Ga0157370_100898483 207
318 3300013104 Ga0157370_10409702 Ga0157370_104097022 207
319 3300013104 Ga0157370_10486180 Ga0157370_104861802 207
320 3300013104 Ga0157370_10501905 Ga0157370_105019052 207
321 3300013105 Ga0157369_10000101 Ga0157369_1000010149 207
322 3300013105 Ga0157369_10101557 Ga0157369_101015572 207
323 3300013105 Ga0157369_10131283 Ga0157369_101312834 207
324 3300013105 Ga0157369_10708961 Ga0157369_107089612 207
325 3300013105 Ga0157369_10742467 Ga0157369_107424672 207
326 3300013296 Ga0157374_10000741 Ga0157374_1000074116 207
327 3300013296 Ga0157374_10001208 Ga0157374_1000120811 207
328 3300013296 Ga0157374_10038994 Ga0157374_100389943 207
329 3300013296 Ga0157374_10302577 Ga0157374_103025772 207
330 3300013297 Ga0157378_10017834 Ga0157378_100178343 207
331 3300013306 Ga0163162_10000012 Ga0163162_10000012157 207
332 3300013306 Ga0163162_10006625 Ga0163162_100066255 207
333 3300013306 Ga0163162_10025616 Ga0163162_100256163 207
334 3300013306 Ga0163162_10228148 Ga0163162_102281484 207
335 3300013307 Ga0157372_10000041 Ga0157372_1000004146 207
336 3300013307 Ga0157372_10000199 Ga0157372_100001999 207
337 3300013307 Ga0157372_10000538 Ga0157372_100005381 207
338 3300013308 Ga0157375_10251304 Ga0157375_102513042 207
339 3300013308 Ga0157375_11170978 Ga0157375_111709781 207
340 3300014969 Ga0157376_10090563 Ga0157376_100905633 207
341 3300014969 Ga0157376_10637486 Ga0157376_106374862 207
342 3300017792 Ga0163161_10073200 Ga0163161_100732003 207
343 3300021361 Ga0213872_10002511 Ga0213872_1000251110 207
344 3300025230 Ga0209563_106202 Ga0209563_1062023 207
345 3300025231 Ga0207427_100072 Ga0207427_10007258 207
346 3300025233 Ga0209437_100026 Ga0209437_100026284 207
347 3300025233 Ga0209437_100144 Ga0209437_100144143 207
348 3300025250 Ga0209026_1001159 Ga0209026_10011598 207
349 3300025250 Ga0209026_1003618 Ga0209026_10036183 207
350 3300025258 Ga0209129_1012439 Ga0209129_10124393 207
351 3300025261 Ga0209233_1000111 Ga0209233_1000111178 207
352 3300025261 Ga0209233_1002603 Ga0209233_10026034 207
353 3300025261 Ga0209233_1012503 Ga0209233_10125034 207
354 3300025272 Ga0209455_1002153 Ga0209455_10021534 207
355 3300025899 Ga0207642_10018419 Ga0207642_100184194 207
356 3300025904 Ga0207647_10000049 Ga0207647_1000004967 207
357 3300025904 Ga0207647_10000103 Ga0207647_1000010352 207
358 3300025904 Ga0207647_10116372 Ga0207647_101163722 207
359 3300025907 Ga0207645_10000398 Ga0207645_1000039812 207
360 3300025909 Ga0207705_10000026 Ga0207705_1000002657 207
361 3300025909 Ga0207705_10049489 Ga0207705_100494891 207
362 3300025909 Ga0207705_10229116 Ga0207705_102291162 207
363 3300025911 Ga0207654_10075439 Ga0207654_100754392 207
364 3300025913 Ga0207695_10007414 Ga0207695_1000741412 207
365 3300025913 Ga0207695_10015443 Ga0207695_100154433 207
366 3300025913 Ga0207695_10092143 Ga0207695_100921434 207
367 3300025913 Ga0207695_10097954 Ga0207695_100979544 207
368 3300025913 Ga0207695_10383123 Ga0207695_103831232 207
369 3300025914 Ga0207671_10004017 Ga0207671_1000401710 207
370 3300025914 Ga0207671_10006480 Ga0207671_100064802 207
371 3300025914 Ga0207671_10009778 Ga0207671_100097784 207
372 3300025914 Ga0207671_10104465 Ga0207671_101044652 207
373 3300025914 Ga0207671_10266393 Ga0207671_102663932 207
374 3300025917 Ga0207660_10205501 Ga0207660_102055012 207
375 3300025919 Ga0207657_10076595 Ga0207657_100765953 207
376 3300025919 Ga0207657_10225709 Ga0207657_102257091 207
377 3300025921 Ga0207652_10004777 Ga0207652_100047774 207
378 3300025924 Ga0207694_10024569 Ga0207694_100245694 207
379 3300025931 Ga0207644_10003140 Ga0207644_100031407 207
380 3300025932 Ga0207690_10000049 Ga0207690_1000004964 207
381 3300025932 Ga0207690_10004182 Ga0207690_100041826 207
382 3300025933 Ga0207706_10000111 Ga0207706_1000011166 207
383 3300025933 Ga0207706_10108611 Ga0207706_101086112 207
384 3300025937 Ga0207669_10774433 Ga0207669_107744332 207
385 3300025938 Ga0207704_10000065 Ga0207704_1000006526 207
386 3300025949 Ga0207667_10000477 Ga0207667_1000047725 207
387 3300025949 Ga0207667_10010697 Ga0207667_100106974 207
388 3300025949 Ga0207667_10021217 Ga0207667_100212175 207
389 3300025949 Ga0207667_10612805 Ga0207667_106128051 207
390 3300025949 Ga0207667_10733555 Ga0207667_107335552 207
391 3300025960 Ga0207651_10066219 Ga0207651_100662193 207
392 3300025981 Ga0207640_10035481 Ga0207640_100354811 207
393 3300026023 Ga0207677_10049549 Ga0207677_100495494 207
394 3300026041 Ga0207639_10007063 Ga0207639_100070633 207
395 3300026041 Ga0207639_10156388 Ga0207639_101563882 207
396 3300026067 Ga0207678_10025963 Ga0207678_100259634 207
397 3300026078 Ga0207702_10000023 Ga0207702_1000002328 207
398 3300026078 Ga0207702_10364406 Ga0207702_103644061 207
399 3300026089 Ga0207648_10001417 Ga0207648_1000141717 207
400 3300026121 Ga0207683_10008658 Ga0207683_100086583 207
401 3300026142 Ga0207698_10126567 Ga0207698_101265672 207
402 3300026142 Ga0207698_10162949 Ga0207698_101629493 207
403 3300028379 Ga0268266_10000121 Ga0268266_1000012111 207
404 3300028786 Ga0307517_10001388 Ga0307517_1000138815 207
405 3300028794 Ga0307515_10319199 Ga0307515_103191992 207
406 3300028800 Ga0265338_10130761 Ga0265338_101307613 207
407 3300031507 Ga0307509_10050400 Ga0307509_100504002 207
408 3300031595 Ga0265313_10116255 Ga0265313_101162552 207
409 3300031911 Ga0307412_10083081 Ga0307412_100830813 207
410 3300033180 Ga0307510_10000419 Ga0307510_1000041919 207
411 3300037312 Ga0395899_0000024 Ga0395899_0000024_178264_178902 207
412 3300037312 Ga0395899_0000237 Ga0395899_0000237_49201_49836 207
413 3300037418 Ga0395900_0001123 Ga0395900_0001123_29681_30319 207
414 3300037418 Ga0395900_0001352 Ga0395900_0001352_8271_8909 207
415 3300037418 Ga0395900_0004216 Ga0395900_0004216_112_750 207
416 3300037418 Ga0395900_0700686 Ga0395900_0700686_158_796 207
417 3300037466 Ga0395898_0022388 Ga0395898_0022388_4355_4993 207
418 3300037466 Ga0395898_0763171 Ga0395898_0763171_122_760 207
419 3300037471 Ga0395905_0000246 Ga0395905_0000246_72408_73046 207
420 3300037471 Ga0395905_0000347 Ga0395905_0000347_59098_59736 207
421 3300038443 Ga0395901_0000184 Ga0395901_0000184_72349_72987 207
422 3300038443 Ga0395901_0109857 Ga0395901_0109857_450_1088 207
423 3300038443 Ga0395901_0134229 Ga0395901_0134229_1791_2429 207
424 3300039447 Ga0436361_1055999 Ga0436361_1055999_1804_2442 207
425 3300041452 Ga0451793_0339311 Ga0451793_0339311_233_871 207
426 3300042005 Ga0439448_0002050 Ga0439448_0002050_1868_2506 207
427 3300044656 Ga0466969_0032983 Ga0466969_0032983_571_1209 207
428 3300044684 Ga0466966_0010043 Ga0466966_0010043_4759_5397 207
429 3300044693 Ga0466961_0037243 Ga0466961_0037243_2180_2818 207
430 3300044735 Ga0466968_0113713 Ga0466968_0113713_354_992 207
431 3300045836 Ga0466958_0027342 Ga0466958_0027342_1470_2108 207
432 3300046471 Ga0495650_0000098 Ga0495650_0000098_164023_164664 207
433 3300046474 Ga0495605_0017082 Ga0495605_0017082_2936_3574 207
434 3300046492 Ga0495585_0000308 Ga0495585_0000308_27131_27772 207
435 3300046506 Ga0495583_0032516 Ga0495583_0032516_475_1116 207
436 3300046506 Ga0495583_0044858 Ga0495583_0044858_698_1339 207
437 3300046507 Ga0495606_0006041 Ga0495606_0006041_7233_7874 207
438 3300046507 Ga0495606_0106567 Ga0495606_0106567_643_1287 207
439 3300046513 Ga0495616_0000433 Ga0495616_0000433_11065_11709 207
440 3300046513 Ga0495616_0006824 Ga0495616_0006824_3629_4270 207
441 3300046519 Ga0495632_0045318 Ga0495632_0045318_102_740 207
442 3300046524 Ga0495648_0041623 Ga0495648_0041623_68_712 207
443 3300046528 Ga0495642_0285348 Ga0495642_0285348_29_667 207
444 3300046616 Ga0495668_0114690 Ga0495668_0114690_283_921 207
445 3300046660 Ga0495625_0000183 Ga0495625_0000183_46636_47277 207
446 3300046660 Ga0495625_0021304 Ga0495625_0021304_1655_2299 207
447 3300046660 Ga0495625_0075871 Ga0495625_0075871_527_1171 207
448 3300046660 Ga0495625_0144600 Ga0495625_0144600_769_1407 207
449 3300046665 Ga0495661_0003387 Ga0495661_0003387_8809_9447 207
450 3300046665 Ga0495661_0003737 Ga0495661_0003737_7219_7860 207
451 3300046665 Ga0495661_0045590 Ga0495661_0045590_1604_2242 207
452 3300046692 Ga0495671_0062011 Ga0495671_0062011_939_1580 207
453 3300046694 Ga0495649_0000046 Ga0495649_0000046_46732_47373 207
454 3300046694 Ga0495649_0067759 Ga0495649_0067759_753_1391 207
455 3300046810 Ga0495660_0002367 Ga0495660_0002367_8549_9190 207
456 3300047323 Ga0495683_0010104 Ga0495683_0010104_410_1048 207
457 3300047443 Ga0495687_007696 Ga0495687_007696_2419_3057 207
458 3300047472 Ga0495686_0001597 Ga0495686_0001597_11167_11805 207
459 3300047472 Ga0495686_0015329 Ga0495686_0015329_1913_2551 207
460 3300047472 Ga0495686_0030576 Ga0495686_0030576_1816_2460 207
461 3300049459 Ga0495678_006015 Ga0495678_006015_414_1058 207
462 3300050493 nmdc:mga0k408_16491_c1 nmdc:mga0k408_16491_c1_277_918 207
463 3300050493 nmdc:mga0k408_671_c1 nmdc:mga0k408_671_c1_12530_13165 207
464 3300053122 Ga0500608_000417 Ga0500608_000417_8312_8950 207
465 3300053130 Ga0500642_0092787 Ga0500642_0092787_168_806 207
466 3300053157 Ga0500624_000230 Ga0500624_000230_19514_20161 207
467 3300059492 Ga0587073_0024615 Ga0587073_0024615_399_1037 207
468 iso_pu_bacteria 2977232053 2977234728 207
469 3300005289 Ga0065704_10333564 Ga0065704_103335641 208
470 3300009093 Ga0105240_10643183 Ga0105240_106431832 208
471 3300009148 Ga0105243_10000046 Ga0105243_1000004653 208
472 3300010375 Ga0105239_10000008 Ga0105239_10000008236 208
473 3300025913 Ga0207695_10416484 Ga0207695_104164841 208
474 3300025935 Ga0207709_10000020 Ga0207709_10000020289 208
475 3300031911 Ga0307412_10149339 Ga0307412_101493392 208
476 3300032004 Ga0307414_10060303 Ga0307414_100603034 208
477 3300032004 Ga0307414_10098407 Ga0307414_100984073 208
478 3300048919 Ga0496116_0004756 Ga0496116_0004756_11403_12032 208
479 3300048920 Ga0496117_0000995 Ga0496117_0000995_8220_8849 208
480 3300048925 Ga0496122_0060092 Ga0496122_0060092_743_1372 208
481 3300048926 Ga0496123_0027067 Ga0496123_0027067_2751_3380 208
482 3300048928 Ga0496125_0304610 Ga0496125_0304610_304_933 208
483 3300049574 Ga0501038_0065228 Ga0501038_0065228_156_830 208
484 3300053080 Ga0500635_0002410 Ga0500635_0002410_1787_2431 208
485 iso_pu_bacteria 2890737413 2890739219 208
486 iso_pu_bacteria 2898713307 2898714527 208
487 2162886007 SwRhRL2b_contig_3308433 SwRhRL2b_0229.00001910 209
488 3300002741 JGI25157J39369_1002704 JGI25157J39369_10027044 209
489 3300002773 JGI25152J39213_1000043 JGI25152J39213_100004327 209
490 3300002774 JGI25150J39212_1000023 JGI25150J39212_100002399 209
491 3300003187 JGI25151J46595_10000082 JGI25151J46595_1000008299 209
492 3300003215 JGI25153J46596_10000060 JGI25153J46596_10000060100 209
493 3300003323 rootH1_10233543 rootH1_102335433 209
494 3300003781 Ga0055536_1000002 Ga0055536_100000244 209
495 3300003791 Ga0055530_10000739 Ga0055530_1000073911 209
496 3300005288 Ga0065714_10003630 Ga0065714_1000363011 209
497 3300005288 Ga0065714_10004446 Ga0065714_100044464 209
498 3300005288 Ga0065714_10064525 Ga0065714_1006452526 209
499 3300005288 Ga0065714_10080235 Ga0065714_100802353 209
500 3300005289 Ga0065704_10000206 Ga0065704_1000020675 209
501 3300006847 Ga0075431_100008882 Ga0075431_1000088828 209
502 3300006880 Ga0075429_100055559 Ga0075429_1000555593 209
503 3300009036 Ga0105244_10042625 Ga0105244_100426252 209
504 3300009545 Ga0105237_10000088 Ga0105237_1000008853 209
505 3300013100 Ga0157373_10000376 Ga0157373_1000037626 209
506 3300013100 Ga0157373_10000546 Ga0157373_1000054616 209
507 3300013100 Ga0157373_10042194 Ga0157373_100421944 209
508 3300013100 Ga0157373_10405367 Ga0157373_104053672 209
509 3300013102 Ga0157371_10000151 Ga0157371_1000015140 209
510 3300013102 Ga0157371_10000888 Ga0157371_1000088825 209
511 3300013102 Ga0157371_10001845 Ga0157371_100018456 209
512 3300013102 Ga0157371_10023303 Ga0157371_100233034 209
513 3300013102 Ga0157371_10366364 Ga0157371_103663642 209
514 3300013104 Ga0157370_10000597 Ga0157370_1000059714 209
515 3300013104 Ga0157370_10006731 Ga0157370_100067313 209
516 3300013104 Ga0157370_10017828 Ga0157370_100178284 209
517 3300013104 Ga0157370_10069775 Ga0157370_100697755 209
518 3300013104 Ga0157370_10070205 Ga0157370_100702053 209
519 3300013104 Ga0157370_10110214 Ga0157370_101102143 209
520 3300013104 Ga0157370_10136766 Ga0157370_101367661 209
521 3300013104 Ga0157370_10263023 Ga0157370_102630232 209
522 3300013105 Ga0157369_10021519 Ga0157369_100215195 209
523 3300013306 Ga0163162_10000011 Ga0163162_10000011236 209
524 3300013307 Ga0157372_10007865 Ga0157372_100078657 209
525 3300013308 Ga0157375_10064342 Ga0157375_100643423 209
526 3300013308 Ga0157375_10156528 Ga0157375_101565283 209
527 3300013308 Ga0157375_10206292 Ga0157375_102062922 209
528 3300014497 Ga0182008_10000020 Ga0182008_1000002045 209
529 3300014497 Ga0182008_10000296 Ga0182008_1000029614 209
530 3300014497 Ga0182008_10000342 Ga0182008_1000034211 209
531 3300014497 Ga0182008_10138260 Ga0182008_101382602 209
532 3300014497 Ga0182008_10247581 Ga0182008_102475812 209
533 3300015261 Ga0182006_1000242 Ga0182006_100024229 209
534 3300015261 Ga0182006_1000310 Ga0182006_100031031 209
535 3300015261 Ga0182006_1000735 Ga0182006_100073512 209
536 3300015261 Ga0182006_1005572 Ga0182006_10055723 209
537 3300015261 Ga0182006_1022335 Ga0182006_10223351 209
538 3300015262 Ga0182007_10008621 Ga0182007_100086213 209
539 3300015262 Ga0182007_10062468 Ga0182007_100624682 209
540 3300015682 Ga0183373_1002 Ga0183373_1002507 209
541 3300017792 Ga0163161_10000330 Ga0163161_1000033026 209
542 3300017792 Ga0163161_10000565 Ga0163161_100005659 209
543 3300017792 Ga0163161_10002836 Ga0163161_100028365 209
544 3300017792 Ga0163161_10067561 Ga0163161_100675613 209
545 3300017792 Ga0163161_10173456 Ga0163161_101734562 209
546 3300020077 Ga0206351_10221156 Ga0206351_102211562 209
547 3300025245 Ga0207425_1000051 Ga0207425_1000051132 209
548 3300025250 Ga0209026_1000246 Ga0209026_100024647 209
549 3300025258 Ga0209129_1000121 Ga0209129_100012199 209
550 3300025292 Ga0209676_1000022 Ga0209676_1000022496 209
551 3300025294 Ga0209025_1000160 Ga0209025_100016028 209
552 3300025297 Ga0209758_1000147 Ga0209758_100014728 209
553 3300025298 Ga0209050_1000020 Ga0209050_100002043 209
554 3300025303 Ga0209051_1086543 Ga0209051_10865431 209
555 3300025914 Ga0207671_10000744 Ga0207671_1000074423 209
556 3300030731 Ga0316177_1061403 Ga0316177_10614032 209
557 3300030731 Ga0316177_1071693 Ga0316177_10716933 209
558 3300030732 Ga0316176_1096751 Ga0316176_10967514 209
559 3300030742 Ga0316183_1100732 Ga0316183_110073220 209
560 3300030744 Ga0316181_1213886 Ga0316181_12138863 209
561 3300030744 Ga0316181_1231306 Ga0316181_12313064 209
562 3300031548 Ga0307408_100000209 Ga0307408_10000020961 209
563 3300031548 Ga0307408_100000393 Ga0307408_10000039339 209
564 3300031548 Ga0307408_100000487 Ga0307408_10000048718 209
565 3300031731 Ga0307405_10012446 Ga0307405_100124462 209
566 3300031911 Ga0307412_10000001 Ga0307412_10000001355 209
567 3300031911 Ga0307412_10000724 Ga0307412_1000072415 209
568 3300031911 Ga0307412_10286128 Ga0307412_102861282 209
569 3300031995 Ga0307409_100713620 Ga0307409_1007136202 209
570 3300032004 Ga0307414_10001886 Ga0307414_100018865 209
571 3300032004 Ga0307414_10013334 Ga0307414_100133343 209
572 3300032004 Ga0307414_10019675 Ga0307414_100196754 209
573 3300032004 Ga0307414_10052108 Ga0307414_100521083 209
574 3300032004 Ga0307414_10058710 Ga0307414_100587102 209
575 3300032004 Ga0307414_10068665 Ga0307414_100686653 209
576 3300032004 Ga0307414_10192770 Ga0307414_101927702 209
577 3300032004 Ga0307414_10209358 Ga0307414_102093582 209
578 3300041460 Ga0451802_1573306 Ga0451802_1573306_175_810 209
579 3300042014 Ga0439457_024042 Ga0439457_024042_99_737 209
580 3300046507 Ga0495606_0020092 Ga0495606_0020092_1439_2086 209
581 3300046507 Ga0495606_0035610 Ga0495606_0035610_1702_2337 209
582 3300046512 Ga0495610_0000054 Ga0495610_0000054_99111_99746 209
583 3300046538 Ga0495609_0020070 Ga0495609_0020070_946_1581 209
584 3300046558 Ga0495633_0011309 Ga0495633_0011309_2464_3099 209
585 3300048925 Ga0496122_0000817 Ga0496122_0000817_31118_31753 209
586 3300048926 Ga0496123_0008229 Ga0496123_0008229_3135_3770 209
587 3300049649 Ga0501198_001244 Ga0501198_001244_285_926 209
588 3300049663 Ga0501223_001575 Ga0501223_001575_1812_2453 209
589 3300049675 Ga0501243_016482 Ga0501243_016482_300_941 209
590 3300049682 Ga0501252_006249 Ga0501252_006249_492_1124 209
591 3300049758 Ga0501241_002477 Ga0501241_002477_1567_2196 209
592 3300049758 Ga0501241_016529 Ga0501241_016529_276_905 209
593 3300050509 nmdc:mga0qj67_23955_c1 nmdc:mga0qj67_23955_c1_2499_3161 209
594 3300053093 Ga0500651_0001978 Ga0500651_0001978_5180_5809 209
595 iso_pu_bacteria 2842903701 2842905068 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

47

224

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z88-assembly1.cif.gz_I human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9766 26 204
6z89-assembly1.cif.gz_D-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9692 22 204
7ala-assembly1.cif.gz_E-2 human gch-gfrp inhibitory complex 0.969 22 204
6z88-assembly1.cif.gz_B human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9684 22 204
7alc-assembly1.cif.gz_C-2 human gch-gfrp stimulatory complex 0.9674 26 204
ID Description Score Start End Superfamily
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9589 77 189 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9525 79 206 3.30.1130.10
1wm9B01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9406 25 73 1.10.286.10
1wuqA01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9384 25 73 1.10.286.10
1wm9A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9362 25 73 1.10.286.10
ID Description Score Start End GO Terms
AF-X1MIN2-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 1.001 79 170 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A7Y1V6H8-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9837 14 156 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-Q2RYU5-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.9814 14 207 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A814HEM1-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9809 23 165 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A521N396-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.9799 14 209 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654

Feature Viewer

pLDDT pTM Quality
90.56 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map