F467455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 332 | 555 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10209358|Ga0307414_102093582 |
| Length | 228 |
| Sequence | MKPKIIMSNTSDKSIGLMDDKTQKFTEEENEGYLKIDRYNEDKIATIATHYKDILFQIGENPEREGLHKTPERVAKALQFLTHGYDADPEQILRSAMFKEEYSQMVVVKDIEVFSMCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRVVDAFARRLQVQERLTNEIRDCIQKTLNPAGVAVVIECKHLCMSMRGIQKQNSVTTTSAFTGEFAQDKTRAEFLRLITANLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 5 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 6 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 7 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 8 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 9 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 10 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 11 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 12 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 13 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 14 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 15 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 16 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 17 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 18 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 19 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 20 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 21 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 22 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 23 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 24 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 25 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 26 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 27 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 28 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 29 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 30 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 31 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 32 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 33 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 34 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 35 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 36 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 37 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 38 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 39 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 40 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 41 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 42 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 43 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 44 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 45 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 46 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 47 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 48 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 50 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 51 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 52 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 53 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 54 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 55 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 56 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 57 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 58 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 70 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 207 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 208 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 209 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 239 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 304 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 306 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 324 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 332 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.61 |
| Metatranscriptomes | 0.67 |
| Isolates | 6.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.71 |
| Nodule | 0 |
| Rhizoplane | 0.5 |
| Rhizosphere | 85.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3308433 | 2162886007 | Bacteria | 12186 |
| 2 | SwRhRL2b_contig_677025 | 2162886007 | Bacteria | 181955 |
| 3 | JGI24736J21556_1000812 | 3300001904 | Bacteria | 5763 |
| 4 | JGI24736J21556_1001942 | 3300001904 | Bacteria | 3678 |
| 5 | JGI24740J21852_10012653 | 3300001979 | Bacteria | 3174 |
| 6 | JGI24739J22299_10001457 | 3300001989 | Bacteria | 8917 |
| 7 | JGI24737J22298_10000852 | 3300001990 | Bacteria | 10878 |
| 8 | JGI24737J22298_10001745 | 3300001990 | Bacteria | 7761 |
| 9 | JGI24737J22298_10002702 | 3300001990 | Bacteria | 6273 |
| 10 | JGI24737J22298_10015372 | 3300001990 | Bacteria | 2477 |
| 11 | JGI24737J22298_10024646 | 3300001990 | Bacteria | 1905 |
| 12 | JGI24735J21928_10000027 | 3300002067 | Bacteria | 83494 |
| 13 | JGI24735J21928_10015914 | 3300002067 | Bacteria | 2341 |
| 14 | JGI24751J29686_10000772 | 3300002459 | Bacteria | 7557 |
| 15 | JGI25157J39369_1002704 | 3300002741 | Bacteria | 4111 |
| 16 | JGI25164J39214_1001144 | 3300002772 | Bacteria | 7484 |
| 17 | JGI25152J39213_1000043 | 3300002773 | Bacteria | 87508 |
| 18 | JGI25150J39212_1000023 | 3300002774 | Bacteria | 130663 |
| 19 | JGI25151J46595_10000082 | 3300003187 | Bacteria | 130832 |
| 20 | JGI25165J46597_1001050 | 3300003214 | Bacteria | 17908 |
| 21 | JGI25165J46597_1008856 | 3300003214 | Bacteria | 1548 |
| 22 | JGI25153J46596_10000060 | 3300003215 | Bacteria | 131744 |
| 23 | rootH1_10031584 | 3300003316 | Bacteria | 16796 |
| 24 | rootH2_10001273 | 3300003320 | Bacteria | 179792 |
| 25 | rootH2_10114261 | 3300003320 | Bacteria | 1972 |
| 26 | rootL2_10020975 | 3300003322 | Bacteria | 6506 |
| 27 | rootH1_10024310 | 3300003323 | Bacteria | 54858 |
| 28 | rootH1_10083498 | 3300003323 | Bacteria | 4553 |
| 29 | rootH1_10124986 | 3300003323 | Bacteria | 2534 |
| 30 | rootH1_10233543 | 3300003323 | Bacteria | 4367 |
| 31 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 32 | Ga0055530_10000739 | 3300003791 | Bacteria | 27214 |
| 33 | Ga0058863_11920979 | 3300004799 | Bacteria | 3023 |
| 34 | Ga0058862_12833523 | 3300004803 | Bacteria | 2412 |
| 35 | Ga0065714_10002980 | 3300005288 | Bacteria | 14261 |
| 36 | Ga0065714_10003630 | 3300005288 | Bacteria | 23830 |
| 37 | Ga0065714_10004446 | 3300005288 | Bacteria | 6584 |
| 38 | Ga0065714_10064525 | 3300005288 | Bacteria | 41731 |
| 39 | Ga0065714_10080235 | 3300005288 | Bacteria | 2414 |
| 40 | Ga0065704_10000206 | 3300005289 | Bacteria | 121672 |
| 41 | Ga0065704_10099903 | 3300005289 | Bacteria | 2293 |
| 42 | Ga0065704_10166991 | 3300005289 | Bacteria | 1316 |
| 43 | Ga0065704_10333564 | 3300005289 | Bacteria | 834 |
| 44 | Ga0070658_10111073 | 3300005327 | Bacteria | 2271 |
| 45 | Ga0070658_10226211 | 3300005327 | Bacteria | 1583 |
| 46 | Ga0070658_10259587 | 3300005327 | Bacteria | 1475 |
| 47 | Ga0070676_10014740 | 3300005328 | Bacteria | 4300 |
| 48 | Ga0070683_100008086 | 3300005329 | Bacteria | 8932 |
| 49 | Ga0070670_100008042 | 3300005331 | Bacteria | 8971 |
| 50 | Ga0070670_100193626 | 3300005331 | Bacteria | 1766 |
| 51 | Ga0070670_100465243 | 3300005331 | Bacteria | 1122 |
| 52 | Ga0070680_100247464 | 3300005336 | Bacteria | 1507 |
| 53 | Ga0070680_100413117 | 3300005336 | Bacteria | 1151 |
| 54 | Ga0068868_100047960 | 3300005338 | Bacteria | 3350 |
| 55 | Ga0070660_100049784 | 3300005339 | Bacteria | 3222 |
| 56 | Ga0070660_100363636 | 3300005339 | Bacteria | 1193 |
| 57 | Ga0070689_100327777 | 3300005340 | Bacteria | 1280 |
| 58 | Ga0070689_100677490 | 3300005340 | Bacteria | 899 |
| 59 | Ga0070674_100016874 | 3300005356 | Bacteria | 4582 |
| 60 | Ga0070673_100026225 | 3300005364 | Bacteria | 4302 |
| 61 | Ga0070688_100335239 | 3300005365 | Bacteria | 1103 |
| 62 | Ga0070659_100000412 | 3300005366 | Bacteria | 32519 |
| 63 | Ga0070659_100040361 | 3300005366 | Bacteria | 3646 |
| 64 | Ga0070667_100467059 | 3300005367 | Bacteria | 1154 |
| 65 | Ga0070700_100311417 | 3300005441 | Bacteria | 1153 |
| 66 | Ga0070700_100745457 | 3300005441 | Bacteria | 783 |
| 67 | Ga0070663_100014280 | 3300005455 | Bacteria | 5094 |
| 68 | Ga0070678_100007878 | 3300005456 | Bacteria | 6340 |
| 69 | Ga0070662_100000468 | 3300005457 | Bacteria | 24024 |
| 70 | Ga0070681_10000627 | 3300005458 | Bacteria | 28983 |
| 71 | Ga0070681_10125196 | 3300005458 | Bacteria | 2502 |
| 72 | Ga0068867_100004302 | 3300005459 | Bacteria | 10024 |
| 73 | Ga0068867_100977383 | 3300005459 | Bacteria | 766 |
| 74 | Ga0070707_100133283 | 3300005468 | Bacteria | 2416 |
| 75 | Ga0070707_100309700 | 3300005468 | Bacteria | 1535 |
| 76 | Ga0070698_100229296 | 3300005471 | Bacteria | 1790 |
| 77 | Ga0070699_100050734 | 3300005518 | Bacteria | 3592 |
| 78 | Ga0070679_100006243 | 3300005530 | Bacteria | 11102 |
| 79 | Ga0070679_100040127 | 3300005530 | Bacteria | 4657 |
| 80 | Ga0070679_100141289 | 3300005530 | Bacteria | 2387 |
| 81 | Ga0070684_100423450 | 3300005535 | Bacteria | 1229 |
| 82 | Ga0070684_100991513 | 3300005535 | Bacteria | 788 |
| 83 | Ga0068853_100039336 | 3300005539 | Bacteria | 4033 |
| 84 | Ga0068853_100231655 | 3300005539 | Bacteria | 1690 |
| 85 | Ga0068853_100428574 | 3300005539 | Bacteria | 1241 |
| 86 | Ga0070672_100191686 | 3300005543 | Bacteria | 1707 |
| 87 | Ga0070693_100597344 | 3300005547 | Bacteria | 796 |
| 88 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 89 | Ga0070704_100000050 | 3300005549 | Bacteria | 38334 |
| 90 | Ga0070704_100998476 | 3300005549 | Bacteria | 757 |
| 91 | Ga0068855_100000958 | 3300005563 | Bacteria | 35849 |
| 92 | Ga0068855_100008698 | 3300005563 | Bacteria | 12273 |
| 93 | Ga0068855_100019618 | 3300005563 | Bacteria | 8121 |
| 94 | Ga0068855_100091183 | 3300005563 | Bacteria | 3516 |
| 95 | Ga0068855_100109018 | 3300005563 | Bacteria | 3180 |
| 96 | Ga0068855_100381016 | 3300005563 | Bacteria | 1549 |
| 97 | Ga0068854_100117651 | 3300005578 | Bacteria | 2013 |
| 98 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 99 | Ga0068856_100050674 | 3300005614 | Bacteria | 4093 |
| 100 | Ga0068852_100000720 | 3300005616 | Bacteria | 21705 |
| 101 | Ga0068852_100386360 | 3300005616 | Bacteria | 1374 |
| 102 | Ga0068864_100079743 | 3300005618 | Bacteria | 2867 |
| 103 | Ga0068866_10002584 | 3300005718 | Bacteria | 7472 |
| 104 | Ga0068866_10172763 | 3300005718 | Bacteria | 1270 |
| 105 | Ga0068866_10208103 | 3300005718 | Bacteria | 1173 |
| 106 | Ga0068861_100205966 | 3300005719 | Unclassified | 1654 |
| 107 | Ga0068861_100546056 | 3300005719 | Bacteria | 1055 |
| 108 | Ga0068863_100340770 | 3300005841 | Bacteria | 1458 |
| 109 | Ga0068858_100351757 | 3300005842 | Bacteria | 1411 |
| 110 | Ga0068860_101546838 | 3300005843 | Bacteria | 685 |
| 111 | Ga0075366_10014581 | 3300006195 | Bacteria | 4490 |
| 112 | Ga0075366_10042954 | 3300006195 | Bacteria | 2677 |
| 113 | Ga0097621_100000285 | 3300006237 | Bacteria | 34046 |
| 114 | Ga0097621_100340497 | 3300006237 | Bacteria | 1332 |
| 115 | Ga0097621_100612460 | 3300006237 | Bacteria | 996 |
| 116 | Ga0068871_100000080 | 3300006358 | Bacteria | 53930 |
| 117 | Ga0075430_100047773 | 3300006846 | Bacteria | 3614 |
| 118 | Ga0075431_100008882 | 3300006847 | Bacteria | 10068 |
| 119 | Ga0075431_100551069 | 3300006847 | Bacteria | 1140 |
| 120 | Ga0075434_100000318 | 3300006871 | Bacteria | 34363 |
| 121 | Ga0075429_100055559 | 3300006880 | Bacteria | 3445 |
| 122 | Ga0068865_100000218 | 3300006881 | Bacteria | 31890 |
| 123 | Ga0075436_100015330 | 3300006914 | Bacteria | 5252 |
| 124 | Ga0075436_100019266 | 3300006914 | Bacteria | 4676 |
| 125 | Ga0075435_100003168 | 3300007076 | Bacteria | 11124 |
| 126 | Ga0105244_10042625 | 3300009036 | Bacteria | 2345 |
| 127 | Ga0105240_10048169 | 3300009093 | Bacteria | 5388 |
| 128 | Ga0105240_10097171 | 3300009093 | Bacteria | 3589 |
| 129 | Ga0105240_10152098 | 3300009093 | Bacteria | 2755 |
| 130 | Ga0105240_10186200 | 3300009093 | Bacteria | 2445 |
| 131 | Ga0105240_10191749 | 3300009093 | Bacteria | 2403 |
| 132 | Ga0105240_10216578 | 3300009093 | Bacteria | 2234 |
| 133 | Ga0105240_10310454 | 3300009093 | Bacteria | 1801 |
| 134 | Ga0105240_10397261 | 3300009093 | Bacteria | 1554 |
| 135 | Ga0105240_10643183 | 3300009093 | Bacteria | 1163 |
| 136 | Ga0105240_10675164 | 3300009093 | Bacteria | 1130 |
| 137 | Ga0105240_10901263 | 3300009093 | Bacteria | 951 |
| 138 | Ga0105240_10996881 | 3300009093 | Bacteria | 896 |
| 139 | Ga0111539_10014062 | 3300009094 | Bacteria | 10002 |
| 140 | Ga0111539_11293396 | 3300009094 | Bacteria | 846 |
| 141 | Ga0105243_10000046 | 3300009148 | Bacteria | 155277 |
| 142 | Ga0105243_10314960 | 3300009148 | Bacteria | 1423 |
| 143 | Ga0105241_10000999 | 3300009174 | Bacteria | 21432 |
| 144 | Ga0105241_10474511 | 3300009174 | Bacteria | 1111 |
| 145 | Ga0105242_10002835 | 3300009176 | Bacteria | 13581 |
| 146 | Ga0105242_10349946 | 3300009176 | Unclassified | 1364 |
| 147 | Ga0105237_10000088 | 3300009545 | Bacteria | 124518 |
| 148 | Ga0105237_10002840 | 3300009545 | Bacteria | 21062 |
| 149 | Ga0105237_10003145 | 3300009545 | Bacteria | 19862 |
| 150 | Ga0105237_10004869 | 3300009545 | Bacteria | 15388 |
| 151 | Ga0105237_10023283 | 3300009545 | Bacteria | 6348 |
| 152 | Ga0105237_10232232 | 3300009545 | Bacteria | 1845 |
| 153 | Ga0105237_10410378 | 3300009545 | Bacteria | 1359 |
| 154 | Ga0105238_10003441 | 3300009551 | Bacteria | 15759 |
| 155 | Ga0105238_10081249 | 3300009551 | Bacteria | 3230 |
| 156 | Ga0105238_10476982 | 3300009551 | Bacteria | 1246 |
| 157 | Ga0105249_10006600 | 3300009553 | Bacteria | 10096 |
| 158 | Ga0105249_11222409 | 3300009553 | Bacteria | 822 |
| 159 | Ga0105239_10000008 | 3300010375 | Bacteria | 376925 |
| 160 | Ga0105239_10000115 | 3300010375 | Bacteria | 113217 |
| 161 | Ga0105239_10002115 | 3300010375 | Bacteria | 25648 |
| 162 | Ga0105239_10002395 | 3300010375 | Bacteria | 23910 |
| 163 | Ga0105239_10008252 | 3300010375 | Bacteria | 11878 |
| 164 | Ga0105239_10014398 | 3300010375 | Bacteria | 8776 |
| 165 | Ga0105239_10239007 | 3300010375 | Bacteria | 2039 |
| 166 | Ga0105239_10674133 | 3300010375 | Bacteria | 1181 |
| 167 | Ga0105239_10680154 | 3300010375 | Bacteria | 1176 |
| 168 | Ga0105246_10302210 | 3300011119 | Bacteria | 1292 |
| 169 | Ga0105246_10640219 | 3300011119 | Bacteria | 924 |
| 170 | Ga0157373_10000376 | 3300013100 | Bacteria | 35743 |
| 171 | Ga0157373_10000486 | 3300013100 | Bacteria | 31473 |
| 172 | Ga0157373_10000546 | 3300013100 | Bacteria | 29458 |
| 173 | Ga0157373_10042194 | 3300013100 | Bacteria | 3261 |
| 174 | Ga0157373_10405367 | 3300013100 | Bacteria | 978 |
| 175 | Ga0157371_10000151 | 3300013102 | Bacteria | 101401 |
| 176 | Ga0157371_10000888 | 3300013102 | Bacteria | 33749 |
| 177 | Ga0157371_10001401 | 3300013102 | Bacteria | 25151 |
| 178 | Ga0157371_10001845 | 3300013102 | Bacteria | 21336 |
| 179 | Ga0157371_10005485 | 3300013102 | Bacteria | 10684 |
| 180 | Ga0157371_10023303 | 3300013102 | Bacteria | 4527 |
| 181 | Ga0157371_10366364 | 3300013102 | Bacteria | 1051 |
| 182 | Ga0157370_10000597 | 3300013104 | Bacteria | 45043 |
| 183 | Ga0157370_10006731 | 3300013104 | Bacteria | 12608 |
| 184 | Ga0157370_10017828 | 3300013104 | Bacteria | 7155 |
| 185 | Ga0157370_10069775 | 3300013104 | Bacteria | 3319 |
| 186 | Ga0157370_10070205 | 3300013104 | Bacteria | 3307 |
| 187 | Ga0157370_10089848 | 3300013104 | Bacteria | 2885 |
| 188 | Ga0157370_10110214 | 3300013104 | Bacteria | 2573 |
| 189 | Ga0157370_10136766 | 3300013104 | Bacteria | 2283 |
| 190 | Ga0157370_10263023 | 3300013104 | Bacteria | 1594 |
| 191 | Ga0157370_10409702 | 3300013104 | Bacteria | 1247 |
| 192 | Ga0157370_10486180 | 3300013104 | Bacteria | 1134 |
| 193 | Ga0157370_10501905 | 3300013104 | Bacteria | 1114 |
| 194 | Ga0157369_10000101 | 3300013105 | Bacteria | 118683 |
| 195 | Ga0157369_10021519 | 3300013105 | Bacteria | 7214 |
| 196 | Ga0157369_10096977 | 3300013105 | Bacteria | 3145 |
| 197 | Ga0157369_10101557 | 3300013105 | Bacteria | 3065 |
| 198 | Ga0157369_10131283 | 3300013105 | Bacteria | 2654 |
| 199 | Ga0157369_10708961 | 3300013105 | Bacteria | 1036 |
| 200 | Ga0157369_10742467 | 3300013105 | Bacteria | 1010 |
| 201 | Ga0157374_10000741 | 3300013296 | Bacteria | 28443 |
| 202 | Ga0157374_10001208 | 3300013296 | Bacteria | 22108 |
| 203 | Ga0157374_10038994 | 3300013296 | Bacteria | 4370 |
| 204 | Ga0157374_10223725 | 3300013296 | Bacteria | 1847 |
| 205 | Ga0157374_10302577 | 3300013296 | Bacteria | 1582 |
| 206 | Ga0157378_10017834 | 3300013297 | Bacteria | 6232 |
| 207 | Ga0157378_10222586 | 3300013297 | Bacteria | 1794 |
| 208 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 209 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 210 | Ga0163162_10006625 | 3300013306 | Bacteria | 11224 |
| 211 | Ga0163162_10025616 | 3300013306 | Bacteria | 5830 |
| 212 | Ga0163162_10228148 | 3300013306 | Bacteria | 1992 |
| 213 | Ga0157372_10000041 | 3300013307 | Bacteria | 158494 |
| 214 | Ga0157372_10000199 | 3300013307 | Bacteria | 66101 |
| 215 | Ga0157372_10000538 | 3300013307 | Bacteria | 41695 |
| 216 | Ga0157372_10007865 | 3300013307 | Bacteria | 11331 |
| 217 | Ga0157375_10064342 | 3300013308 | Bacteria | 3651 |
| 218 | Ga0157375_10156528 | 3300013308 | Bacteria | 2418 |
| 219 | Ga0157375_10206292 | 3300013308 | Bacteria | 2122 |
| 220 | Ga0157375_10251304 | 3300013308 | Bacteria | 1929 |
| 221 | Ga0157375_11170978 | 3300013308 | Bacteria | 901 |
| 222 | Ga0163163_10207919 | 3300014325 | Bacteria | 2006 |
| 223 | Ga0163163_10461653 | 3300014325 | Bacteria | 1330 |
| 224 | Ga0163163_10664547 | 3300014325 | Bacteria | 1105 |
| 225 | Ga0157380_10039114 | 3300014326 | Bacteria | 3687 |
| 226 | Ga0182008_10000020 | 3300014497 | Bacteria | 228333 |
| 227 | Ga0182008_10000296 | 3300014497 | Bacteria | 39012 |
| 228 | Ga0182008_10000342 | 3300014497 | Bacteria | 36331 |
| 229 | Ga0182008_10138260 | 3300014497 | Bacteria | 1217 |
| 230 | Ga0182008_10247581 | 3300014497 | Bacteria | 919 |
| 231 | Ga0157379_10086604 | 3300014968 | Bacteria | 2809 |
| 232 | Ga0157376_10090563 | 3300014969 | Bacteria | 2647 |
| 233 | Ga0157376_10637486 | 3300014969 | Bacteria | 1065 |
| 234 | Ga0182006_1000242 | 3300015261 | Bacteria | 50864 |
| 235 | Ga0182006_1000310 | 3300015261 | Bacteria | 42614 |
| 236 | Ga0182006_1000735 | 3300015261 | Bacteria | 22520 |
| 237 | Ga0182006_1005572 | 3300015261 | Bacteria | 5979 |
| 238 | Ga0182006_1022335 | 3300015261 | Bacteria | 2632 |
| 239 | Ga0182007_10008621 | 3300015262 | Bacteria | 4173 |
| 240 | Ga0182007_10062468 | 3300015262 | Bacteria | 1221 |
| 241 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 242 | Ga0163161_10000330 | 3300017792 | Bacteria | 40454 |
| 243 | Ga0163161_10000565 | 3300017792 | Bacteria | 29834 |
| 244 | Ga0163161_10002836 | 3300017792 | Bacteria | 12297 |
| 245 | Ga0163161_10062000 | 3300017792 | Bacteria | 2723 |
| 246 | Ga0163161_10067561 | 3300017792 | Bacteria | 2611 |
| 247 | Ga0163161_10073200 | 3300017792 | Bacteria | 2510 |
| 248 | Ga0163161_10173456 | 3300017792 | Bacteria | 1650 |
| 249 | Ga0206351_10221156 | 3300020077 | Bacteria | 1747 |
| 250 | Ga0213872_10002511 | 3300021361 | Bacteria | 10719 |
| 251 | Ga0213876_10002643 | 3300021384 | Bacteria | 10472 |
| 252 | Ga0209563_106202 | 3300025230 | Bacteria | 2075 |
| 253 | Ga0207427_100072 | 3300025231 | Bacteria | 158364 |
| 254 | Ga0209437_100026 | 3300025233 | Bacteria | 542698 |
| 255 | Ga0209437_100144 | 3300025233 | Bacteria | 164794 |
| 256 | Ga0207425_1000051 | 3300025245 | Bacteria | 166795 |
| 257 | Ga0209026_1000246 | 3300025250 | Bacteria | 69164 |
| 258 | Ga0209026_1001159 | 3300025250 | Bacteria | 12323 |
| 259 | Ga0209026_1003618 | 3300025250 | Bacteria | 4967 |
| 260 | Ga0209129_1000121 | 3300025258 | Bacteria | 135404 |
| 261 | Ga0209129_1012439 | 3300025258 | Bacteria | 1952 |
| 262 | Ga0209233_1000111 | 3300025261 | Bacteria | 260262 |
| 263 | Ga0209233_1002603 | 3300025261 | Bacteria | 6554 |
| 264 | Ga0209233_1012503 | 3300025261 | Bacteria | 2463 |
| 265 | Ga0209455_1002153 | 3300025272 | Bacteria | 7807 |
| 266 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 267 | Ga0209025_1000160 | 3300025294 | Bacteria | 166795 |
| 268 | Ga0209758_1000147 | 3300025297 | Bacteria | 166795 |
| 269 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 270 | Ga0209051_1086543 | 3300025303 | Bacteria | 886 |
| 271 | Ga0207642_10018419 | 3300025899 | Bacteria | 2680 |
| 272 | Ga0207642_10166460 | 3300025899 | Bacteria | 1189 |
| 273 | Ga0207647_10000049 | 3300025904 | Bacteria | 88392 |
| 274 | Ga0207647_10000103 | 3300025904 | Bacteria | 65792 |
| 275 | Ga0207647_10116372 | 3300025904 | Bacteria | 1578 |
| 276 | Ga0207645_10000398 | 3300025907 | Bacteria | 35913 |
| 277 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 278 | Ga0207705_10049489 | 3300025909 | Bacteria | 3024 |
| 279 | Ga0207705_10229116 | 3300025909 | Bacteria | 1413 |
| 280 | Ga0207684_10395995 | 3300025910 | Bacteria | 1187 |
| 281 | Ga0207654_10075439 | 3300025911 | Bacteria | 2015 |
| 282 | Ga0207707_10010987 | 3300025912 | Bacteria | 7877 |
| 283 | Ga0207695_10007414 | 3300025913 | Bacteria | 13973 |
| 284 | Ga0207695_10015443 | 3300025913 | Bacteria | 8988 |
| 285 | Ga0207695_10092143 | 3300025913 | Bacteria | 3041 |
| 286 | Ga0207695_10097954 | 3300025913 | Bacteria | 2932 |
| 287 | Ga0207695_10185343 | 3300025913 | Bacteria | 2000 |
| 288 | Ga0207695_10383123 | 3300025913 | Bacteria | 1292 |
| 289 | Ga0207695_10416484 | 3300025913 | Bacteria | 1228 |
| 290 | Ga0207671_10000744 | 3300025914 | Bacteria | 41309 |
| 291 | Ga0207671_10004017 | 3300025914 | Bacteria | 14293 |
| 292 | Ga0207671_10006480 | 3300025914 | Bacteria | 10419 |
| 293 | Ga0207671_10007251 | 3300025914 | Bacteria | 9654 |
| 294 | Ga0207671_10009778 | 3300025914 | Bacteria | 7981 |
| 295 | Ga0207671_10104465 | 3300025914 | Bacteria | 2149 |
| 296 | Ga0207671_10266393 | 3300025914 | Bacteria | 1349 |
| 297 | Ga0207660_10205501 | 3300025917 | Bacteria | 1540 |
| 298 | Ga0207660_10346178 | 3300025917 | Bacteria | 1191 |
| 299 | Ga0207657_10076595 | 3300025919 | Bacteria | 2821 |
| 300 | Ga0207657_10225709 | 3300025919 | Bacteria | 1499 |
| 301 | Ga0207652_10004777 | 3300025921 | Bacteria | 10982 |
| 302 | Ga0207652_10027991 | 3300025921 | Bacteria | 4700 |
| 303 | Ga0207646_10097715 | 3300025922 | Bacteria | 2631 |
| 304 | Ga0207646_10785375 | 3300025922 | Bacteria | 849 |
| 305 | Ga0207694_10024569 | 3300025924 | Bacteria | 4577 |
| 306 | Ga0207650_10056844 | 3300025925 | Bacteria | 2908 |
| 307 | Ga0207650_10189142 | 3300025925 | Bacteria | 1644 |
| 308 | Ga0207644_10003140 | 3300025931 | Bacteria | 10640 |
| 309 | Ga0207690_10000049 | 3300025932 | Bacteria | 113589 |
| 310 | Ga0207690_10004182 | 3300025932 | Bacteria | 8526 |
| 311 | Ga0207706_10000111 | 3300025933 | Bacteria | 87282 |
| 312 | Ga0207706_10108611 | 3300025933 | Bacteria | 2441 |
| 313 | Ga0207686_10241814 | 3300025934 | Unclassified | 1314 |
| 314 | Ga0207709_10000020 | 3300025935 | Bacteria | 392366 |
| 315 | Ga0207709_10110310 | 3300025935 | Bacteria | 1838 |
| 316 | Ga0207669_10774433 | 3300025937 | Bacteria | 794 |
| 317 | Ga0207704_10000065 | 3300025938 | Bacteria | 69867 |
| 318 | Ga0207667_10000477 | 3300025949 | Bacteria | 53347 |
| 319 | Ga0207667_10010697 | 3300025949 | Bacteria | 10708 |
| 320 | Ga0207667_10021217 | 3300025949 | Bacteria | 7200 |
| 321 | Ga0207667_10612805 | 3300025949 | Bacteria | 1097 |
| 322 | Ga0207667_10733555 | 3300025949 | Bacteria | 988 |
| 323 | Ga0207651_10066219 | 3300025960 | Bacteria | 2537 |
| 324 | Ga0207712_10078204 | 3300025961 | Bacteria | 2400 |
| 325 | Ga0207668_10447831 | 3300025972 | Unclassified | 1101 |
| 326 | Ga0207640_10035481 | 3300025981 | Bacteria | 3122 |
| 327 | Ga0207677_10049549 | 3300026023 | Bacteria | 2835 |
| 328 | Ga0207703_10317410 | 3300026035 | Bacteria | 1426 |
| 329 | Ga0207639_10007063 | 3300026041 | Bacteria | 7658 |
| 330 | Ga0207639_10156388 | 3300026041 | Bacteria | 1916 |
| 331 | Ga0207639_10369873 | 3300026041 | Bacteria | 1285 |
| 332 | Ga0207678_10025963 | 3300026067 | Bacteria | 5112 |
| 333 | Ga0207708_10597297 | 3300026075 | Unclassified | 935 |
| 334 | Ga0207708_10690005 | 3300026075 | Bacteria | 872 |
| 335 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 336 | Ga0207702_10169323 | 3300026078 | Bacteria | 2002 |
| 337 | Ga0207702_10364406 | 3300026078 | Bacteria | 1386 |
| 338 | Ga0207641_10365866 | 3300026088 | Bacteria | 1378 |
| 339 | Ga0207648_10001417 | 3300026089 | Bacteria | 26440 |
| 340 | Ga0207648_10031033 | 3300026089 | Bacteria | 4727 |
| 341 | Ga0207648_10253273 | 3300026089 | Bacteria | 1570 |
| 342 | Ga0207648_11010143 | 3300026089 | Bacteria | 779 |
| 343 | Ga0207676_10035984 | 3300026095 | Unclassified | 3763 |
| 344 | Ga0207674_10084236 | 3300026116 | Bacteria | 3178 |
| 345 | Ga0207675_100438723 | 3300026118 | Bacteria | 1292 |
| 346 | Ga0207675_100749241 | 3300026118 | Bacteria | 988 |
| 347 | Ga0207675_101141607 | 3300026118 | Unclassified | 799 |
| 348 | Ga0207683_10008658 | 3300026121 | Bacteria | 8702 |
| 349 | Ga0207698_10126567 | 3300026142 | Bacteria | 2174 |
| 350 | Ga0207698_10162949 | 3300026142 | Bacteria | 1953 |
| 351 | Ga0207698_10191445 | 3300026142 | Bacteria | 1822 |
| 352 | Ga0209969_1044390 | 3300027360 | Bacteria | 693 |
| 353 | Ga0207428_10074681 | 3300027907 | Bacteria | 2658 |
| 354 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 355 | Ga0268265_10017212 | 3300028380 | Bacteria | 4983 |
| 356 | Ga0268264_10399221 | 3300028381 | Bacteria | 1321 |
| 357 | Ga0268264_11186022 | 3300028381 | Bacteria | 773 |
| 358 | Ga0307517_10001388 | 3300028786 | Bacteria | 40654 |
| 359 | Ga0307515_10016181 | 3300028794 | Bacteria | 13677 |
| 360 | Ga0307515_10319199 | 3300028794 | Bacteria | 1221 |
| 361 | Ga0265338_10130761 | 3300028800 | Bacteria | 1983 |
| 362 | Ga0316177_1061403 | 3300030731 | Bacteria | 896 |
| 363 | Ga0316177_1071693 | 3300030731 | Bacteria | 4201 |
| 364 | Ga0316176_1096751 | 3300030732 | Bacteria | 6470 |
| 365 | Ga0316183_1100732 | 3300030742 | Bacteria | 40906 |
| 366 | Ga0316181_1213886 | 3300030744 | Bacteria | 3041 |
| 367 | Ga0316181_1231306 | 3300030744 | Bacteria | 13138 |
| 368 | Ga0265327_10086159 | 3300031251 | Bacteria | 1541 |
| 369 | Ga0265327_10193094 | 3300031251 | Bacteria | 926 |
| 370 | Ga0307509_10050400 | 3300031507 | Bacteria | 4458 |
| 371 | Ga0307408_100000209 | 3300031548 | Bacteria | 62437 |
| 372 | Ga0307408_100000393 | 3300031548 | Bacteria | 39808 |
| 373 | Ga0307408_100000487 | 3300031548 | Bacteria | 34716 |
| 374 | Ga0265313_10116255 | 3300031595 | Bacteria | 1171 |
| 375 | Ga0307405_10012446 | 3300031731 | Bacteria | 4504 |
| 376 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 377 | Ga0307412_10000724 | 3300031911 | Bacteria | 19071 |
| 378 | Ga0307412_10083081 | 3300031911 | Bacteria | 2219 |
| 379 | Ga0307412_10149339 | 3300031911 | Bacteria | 1722 |
| 380 | Ga0307412_10286128 | 3300031911 | Unclassified | 1296 |
| 381 | Ga0307409_100713620 | 3300031995 | Bacteria | 1003 |
| 382 | Ga0307416_100490311 | 3300032002 | Bacteria | 1291 |
| 383 | Ga0307414_10001886 | 3300032004 | Bacteria | 10825 |
| 384 | Ga0307414_10013334 | 3300032004 | Bacteria | 4890 |
| 385 | Ga0307414_10019675 | 3300032004 | Bacteria | 4190 |
| 386 | Ga0307414_10052108 | 3300032004 | Bacteria | 2846 |
| 387 | Ga0307414_10058710 | 3300032004 | Bacteria | 2712 |
| 388 | Ga0307414_10060303 | 3300032004 | Bacteria | 2682 |
| 389 | Ga0307414_10068665 | 3300032004 | Bacteria | 2544 |
| 390 | Ga0307414_10098407 | 3300032004 | Bacteria | 2194 |
| 391 | Ga0307414_10192770 | 3300032004 | Bacteria | 1650 |
| 392 | Ga0307414_10209358 | 3300032004 | Bacteria | 1592 |
| 393 | Ga0307510_10000419 | 3300033180 | Bacteria | 40732 |
| 394 | Ga0373941_0106381 | 3300035115 | Unclassified | 983 |
| 395 | Ga0373954_0000087 | 3300035118 | Bacteria | 31710 |
| 396 | Ga0373955_0032403 | 3300035172 | Bacteria | 2743 |
| 397 | Ga0373942_0001205 | 3300035207 | Bacteria | 6822 |
| 398 | Ga0373924_0248595 | 3300035410 | Bacteria | 787 |
| 399 | Ga0373931_0007503 | 3300035691 | Bacteria | 5135 |
| 400 | Ga0373931_0235284 | 3300035691 | Bacteria | 1108 |
| 401 | Ga0373933_0107137 | 3300035724 | Bacteria | 1739 |
| 402 | Ga0373937_0000296 | 3300036401 | Bacteria | 47231 |
| 403 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 404 | Ga0395899_0000237 | 3300037312 | Bacteria | 74249 |
| 405 | Ga0395900_0001123 | 3300037418 | Bacteria | 33875 |
| 406 | Ga0395900_0001352 | 3300037418 | Bacteria | 29621 |
| 407 | Ga0395900_0004216 | 3300037418 | Bacteria | 15260 |
| 408 | Ga0395900_0700686 | 3300037418 | Bacteria | 946 |
| 409 | Ga0395898_0022388 | 3300037466 | Bacteria | 6400 |
| 410 | Ga0395898_0763171 | 3300037466 | Bacteria | 908 |
| 411 | Ga0395905_0000246 | 3300037471 | Bacteria | 81356 |
| 412 | Ga0395905_0000347 | 3300037471 | Bacteria | 65943 |
| 413 | Ga0395901_0000184 | 3300038443 | Bacteria | 81257 |
| 414 | Ga0395901_0109857 | 3300038443 | Bacteria | 2895 |
| 415 | Ga0395901_0134229 | 3300038443 | Bacteria | 2601 |
| 416 | Ga0400489_23297 | 3300039093 | Bacteria | 1043 |
| 417 | Ga0436365_0017022 | 3300039437 | Bacteria | 19896 |
| 418 | Ga0436365_1865498 | 3300039437 | Bacteria | 1040 |
| 419 | Ga0436365_1931949 | 3300039437 | Bacteria | 26658 |
| 420 | Ga0436361_1055999 | 3300039447 | Bacteria | 7793 |
| 421 | Ga0451793_0339311 | 3300041452 | Bacteria | 932 |
| 422 | Ga0451802_1573306 | 3300041460 | Bacteria | 1073 |
| 423 | Ga0451835_0168801 | 3300041492 | Unclassified | 1461 |
| 424 | Ga0451843_0248749 | 3300041509 | Bacteria | 1120 |
| 425 | Ga0451853_0991347 | 3300041512 | Bacteria | 784 |
| 426 | Ga0439448_0002050 | 3300042005 | Bacteria | 5402 |
| 427 | Ga0439457_024042 | 3300042014 | Bacteria | 1348 |
| 428 | Ga0466969_0032983 | 3300044656 | Bacteria | 2632 |
| 429 | Ga0466966_0010043 | 3300044684 | Bacteria | 6274 |
| 430 | Ga0466961_0037243 | 3300044693 | Bacteria | 3121 |
| 431 | Ga0466964_0035307 | 3300044706 | Bacteria | 1998 |
| 432 | Ga0466968_0113713 | 3300044735 | Bacteria | 1219 |
| 433 | Ga0466970_0285335 | 3300044765 | Bacteria | 929 |
| 434 | Ga0451576_0247853 | 3300045051 | Bacteria | 1861 |
| 435 | Ga0451576_1388416 | 3300045051 | Unclassified | 731 |
| 436 | Ga0466958_0027342 | 3300045836 | Bacteria | 3377 |
| 437 | Ga0466967_0000469 | 3300045976 | Bacteria | 19507 |
| 438 | Ga0495650_0000098 | 3300046471 | Bacteria | 215716 |
| 439 | Ga0495605_0017082 | 3300046474 | Unclassified | 3917 |
| 440 | Ga0495585_0000308 | 3300046492 | Bacteria | 48809 |
| 441 | Ga0495583_0032516 | 3300046506 | Bacteria | 2518 |
| 442 | Ga0495583_0044858 | 3300046506 | Bacteria | 2048 |
| 443 | Ga0495606_0006041 | 3300046507 | Bacteria | 11328 |
| 444 | Ga0495606_0020092 | 3300046507 | Bacteria | 4938 |
| 445 | Ga0495606_0035610 | 3300046507 | Bacteria | 3401 |
| 446 | Ga0495606_0106567 | 3300046507 | Bacteria | 1697 |
| 447 | Ga0495610_0000054 | 3300046512 | Bacteria | 140031 |
| 448 | Ga0495616_0000433 | 3300046513 | Bacteria | 31968 |
| 449 | Ga0495616_0006824 | 3300046513 | Bacteria | 6878 |
| 450 | Ga0495632_0045318 | 3300046519 | Bacteria | 2191 |
| 451 | Ga0495643_0035714 | 3300046522 | Bacteria | 2735 |
| 452 | Ga0495648_0041623 | 3300046524 | Bacteria | 2899 |
| 453 | Ga0495642_0285348 | 3300046528 | Bacteria | 723 |
| 454 | Ga0495609_0020070 | 3300046538 | Bacteria | 3089 |
| 455 | Ga0495633_0011309 | 3300046558 | Bacteria | 4818 |
| 456 | Ga0495668_0000963 | 3300046616 | Bacteria | 31968 |
| 457 | Ga0495668_0114690 | 3300046616 | Bacteria | 1474 |
| 458 | Ga0495625_0000183 | 3300046660 | Bacteria | 98174 |
| 459 | Ga0495625_0021304 | 3300046660 | Bacteria | 4993 |
| 460 | Ga0495625_0075871 | 3300046660 | Bacteria | 2351 |
| 461 | Ga0495625_0144600 | 3300046660 | Bacteria | 1602 |
| 462 | Ga0495661_0003387 | 3300046665 | Bacteria | 11796 |
| 463 | Ga0495661_0003737 | 3300046665 | Bacteria | 11149 |
| 464 | Ga0495661_0045590 | 3300046665 | Bacteria | 2680 |
| 465 | Ga0495671_0062011 | 3300046692 | Bacteria | 1843 |
| 466 | Ga0495649_0000046 | 3300046694 | Bacteria | 120254 |
| 467 | Ga0495649_0067759 | 3300046694 | Bacteria | 1915 |
| 468 | Ga0495660_0002367 | 3300046810 | Bacteria | 12053 |
| 469 | Ga0495672_0006319 | 3300047320 | Bacteria | 9212 |
| 470 | Ga0495683_0010104 | 3300047323 | Bacteria | 5001 |
| 471 | Ga0495687_007696 | 3300047443 | Bacteria | 6290 |
| 472 | Ga0495686_0001597 | 3300047472 | Bacteria | 23929 |
| 473 | Ga0495686_0015329 | 3300047472 | Bacteria | 5239 |
| 474 | Ga0495686_0030576 | 3300047472 | Bacteria | 3497 |
| 475 | Ga0496116_0004756 | 3300048919 | Bacteria | 12822 |
| 476 | Ga0496117_0000995 | 3300048920 | Bacteria | 43366 |
| 477 | Ga0496122_0000817 | 3300048925 | Bacteria | 59596 |
| 478 | Ga0496122_0060092 | 3300048925 | Bacteria | 2801 |
| 479 | Ga0496123_0008229 | 3300048926 | Bacteria | 9615 |
| 480 | Ga0496123_0027067 | 3300048926 | Bacteria | 4279 |
| 481 | Ga0496125_0304610 | 3300048928 | Bacteria | 974 |
| 482 | Ga0495678_006015 | 3300049459 | Bacteria | 6543 |
| 483 | Ga0501031_0021291 | 3300049568 | Bacteria | 4227 |
| 484 | Ga0501033_0068767 | 3300049570 | Bacteria | 2603 |
| 485 | Ga0501033_0107917 | 3300049570 | Bacteria | 2028 |
| 486 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 487 | Ga0501034_0004775 | 3300049571 | Bacteria | 15000 |
| 488 | Ga0501034_0013117 | 3300049571 | Bacteria | 8540 |
| 489 | Ga0501034_0022667 | 3300049571 | Bacteria | 6396 |
| 490 | Ga0501034_0345596 | 3300049571 | Bacteria | 1417 |
| 491 | Ga0501036_0000813 | 3300049572 | Bacteria | 23193 |
| 492 | Ga0501036_0074613 | 3300049572 | Bacteria | 2869 |
| 493 | Ga0501037_0071865 | 3300049573 | Bacteria | 2517 |
| 494 | Ga0501038_0003073 | 3300049574 | Bacteria | 15555 |
| 495 | Ga0501038_0065228 | 3300049574 | Bacteria | 3103 |
| 496 | Ga0501038_0334181 | 3300049574 | Bacteria | 1183 |
| 497 | Ga0501039_0009779 | 3300049575 | Bacteria | 7306 |
| 498 | Ga0501039_0097242 | 3300049575 | Bacteria | 2296 |
| 499 | Ga0501039_0437114 | 3300049575 | Bacteria | 1028 |
| 500 | Ga0501040_0050250 | 3300049576 | Bacteria | 2851 |
| 501 | Ga0501041_0001139 | 3300049577 | Bacteria | 14553 |
| 502 | Ga0501041_0012717 | 3300049577 | Bacteria | 4987 |
| 503 | Ga0501043_0025429 | 3300049579 | Bacteria | 4646 |
| 504 | Ga0501043_0447510 | 3300049579 | Bacteria | 971 |
| 505 | Ga0501046_0011178 | 3300049580 | Bacteria | 7691 |
| 506 | Ga0501047_0550726 | 3300049581 | Bacteria | 978 |
| 507 | Ga0501048_0040000 | 3300049582 | Bacteria | 3361 |
| 508 | Ga0501048_0108631 | 3300049582 | Bacteria | 1958 |
| 509 | Ga0501069_0266341 | 3300049585 | Bacteria | 1001 |
| 510 | Ga0501070_0059508 | 3300049586 | Bacteria | 3167 |
| 511 | Ga0501071_0007860 | 3300049587 | Bacteria | 7034 |
| 512 | Ga0501071_0589265 | 3300049587 | Bacteria | 855 |
| 513 | Ga0501072_0013016 | 3300049588 | Bacteria | 6367 |
| 514 | Ga0501073_0474445 | 3300049589 | Bacteria | 865 |
| 515 | Ga0501074_0047295 | 3300049590 | Bacteria | 3110 |
| 516 | Ga0501075_0090559 | 3300049591 | Bacteria | 2320 |
| 517 | Ga0501076_0002359 | 3300049592 | Bacteria | 12925 |
| 518 | Ga0501077_0000739 | 3300049593 | Bacteria | 19791 |
| 519 | Ga0501198_001244 | 3300049649 | Bacteria | 3288 |
| 520 | Ga0501223_001575 | 3300049663 | Bacteria | 5252 |
| 521 | Ga0501243_016482 | 3300049675 | Bacteria | 1193 |
| 522 | Ga0501252_006249 | 3300049682 | Bacteria | 1319 |
| 523 | Ga0501079_0003530 | 3300049741 | Bacteria | 11495 |
| 524 | Ga0501079_0472761 | 3300049741 | Bacteria | 985 |
| 525 | Ga0501080_0009560 | 3300049742 | Bacteria | 8851 |
| 526 | Ga0501081_0044098 | 3300049743 | Bacteria | 3060 |
| 527 | Ga0501081_0455488 | 3300049743 | Bacteria | 951 |
| 528 | Ga0501083_0392857 | 3300049744 | Bacteria | 902 |
| 529 | Ga0501241_002477 | 3300049758 | Bacteria | 3570 |
| 530 | Ga0501241_016529 | 3300049758 | Bacteria | 1346 |
| 531 | Ga0501035_0088519 | 3300049822 | Bacteria | 2728 |
| 532 | Ga0501044_0014346 | 3300049823 | Bacteria | 8555 |
| 533 | Ga0501045_0030748 | 3300049824 | Bacteria | 3887 |
| 534 | Ga0501045_0073748 | 3300049824 | Bacteria | 2513 |
| 535 | nmdc:mga0k408_16491_c1 | 3300050493 | Bacteria | 4100 |
| 536 | nmdc:mga0k408_671_c1 | 3300050493 | Bacteria | 13349 |
| 537 | nmdc:mga09592_310251_c1 | 3300050508 | Bacteria | 1367 |
| 538 | nmdc:mga0qj67_23955_c1 | 3300050509 | Bacteria | 4701 |
| 539 | nmdc:mga0qj67_515449_c1 | 3300050509 | Bacteria | 961 |
| 540 | nmdc:mga06r32_513442_c1 | 3300050510 | Bacteria | 1174 |
| 541 | nmdc:mga08y16_15272_c1 | 3300050511 | Bacteria | 8078 |
| 542 | nmdc:mga08y16_627299_c1 | 3300050511 | Bacteria | 1081 |
| 543 | nmdc:mga0n895_4843_c1 | 3300050512 | Bacteria | 11156 |
| 544 | nmdc:mga0rr50_4012_c1 | 3300050513 | Bacteria | 8584 |
| 545 | nmdc:mga08x19_23291_c1 | 3300050514 | Bacteria | 3841 |
| 546 | nmdc:mga08x19_3855_c1 | 3300050514 | Bacteria | 8926 |
| 547 | Ga0500635_0002410 | 3300053080 | Bacteria | 4631 |
| 548 | Ga0500651_0001978 | 3300053093 | Bacteria | 10625 |
| 549 | Ga0500608_000417 | 3300053122 | Bacteria | 16208 |
| 550 | Ga0500642_0092787 | 3300053130 | Bacteria | 1397 |
| 551 | Ga0500624_000230 | 3300053157 | Bacteria | 20306 |
| 552 | Ga0501084_0074508 | 3300054114 | Bacteria | 2842 |
| 553 | Ga0587073_0024615 | 3300059492 | Bacteria | 1190 |
| 554 | Ga0501082_0963381 | 3300060353 | Bacteria | 746 |
| 555 | Ga0530510_0000675 | 3300061734 | Bacteria | 21957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100413117 | Ga0070680_1004131172 | 180 |
| 2 | 3300005458 | Ga0070681_10000627 | Ga0070681_1000062723 | 180 |
| 3 | 3300005530 | Ga0070679_100040127 | Ga0070679_1000401278 | 180 |
| 4 | 3300025912 | Ga0207707_10010987 | Ga0207707_100109873 | 180 |
| 5 | 3300025917 | Ga0207660_10346178 | Ga0207660_103461782 | 180 |
| 6 | 3300025921 | Ga0207652_10027991 | Ga0207652_100279912 | 180 |
| 7 | 3300049592 | Ga0501076_0002359 | Ga0501076_0002359_960_1511 | 180 |
| 8 | 3300049585 | Ga0501069_0266341 | Ga0501069_0266341_81_668 | 181 |
| 9 | 3300049568 | Ga0501031_0021291 | Ga0501031_0021291_2836_3411 | 182 |
| 10 | 3300049570 | Ga0501033_0068767 | Ga0501033_0068767_768_1343 | 182 |
| 11 | 3300049571 | Ga0501034_0345596 | Ga0501034_0345596_40_615 | 182 |
| 12 | 3300049572 | Ga0501036_0000813 | Ga0501036_0000813_8800_9375 | 182 |
| 13 | 3300049572 | Ga0501036_0074613 | Ga0501036_0074613_466_1026 | 182 |
| 14 | 3300049573 | Ga0501037_0071865 | Ga0501037_0071865_1824_2399 | 182 |
| 15 | 3300049574 | Ga0501038_0003073 | Ga0501038_0003073_13724_14299 | 182 |
| 16 | 3300049574 | Ga0501038_0334181 | Ga0501038_0334181_456_1016 | 182 |
| 17 | 3300049575 | Ga0501039_0009779 | Ga0501039_0009779_1173_1748 | 182 |
| 18 | 3300049575 | Ga0501039_0097242 | Ga0501039_0097242_98_658 | 182 |
| 19 | 3300049575 | Ga0501039_0437114 | Ga0501039_0437114_227_790 | 182 |
| 20 | 3300049576 | Ga0501040_0050250 | Ga0501040_0050250_1620_2195 | 182 |
| 21 | 3300049577 | Ga0501041_0001139 | Ga0501041_0001139_5941_6516 | 182 |
| 22 | 3300049577 | Ga0501041_0012717 | Ga0501041_0012717_3220_3780 | 182 |
| 23 | 3300049579 | Ga0501043_0025429 | Ga0501043_0025429_2307_2882 | 182 |
| 24 | 3300049579 | Ga0501043_0447510 | Ga0501043_0447510_375_935 | 182 |
| 25 | 3300049580 | Ga0501046_0011178 | Ga0501046_0011178_1562_2137 | 182 |
| 26 | 3300049582 | Ga0501048_0040000 | Ga0501048_0040000_576_1136 | 182 |
| 27 | 3300049582 | Ga0501048_0108631 | Ga0501048_0108631_797_1372 | 182 |
| 28 | 3300049586 | Ga0501070_0059508 | Ga0501070_0059508_777_1352 | 182 |
| 29 | 3300049587 | Ga0501071_0007860 | Ga0501071_0007860_5247_5822 | 182 |
| 30 | 3300049587 | Ga0501071_0589265 | Ga0501071_0589265_33_593 | 182 |
| 31 | 3300049588 | Ga0501072_0013016 | Ga0501072_0013016_995_1570 | 182 |
| 32 | 3300049589 | Ga0501073_0474445 | Ga0501073_0474445_107_682 | 182 |
| 33 | 3300049590 | Ga0501074_0047295 | Ga0501074_0047295_1592_2167 | 182 |
| 34 | 3300049591 | Ga0501075_0090559 | Ga0501075_0090559_743_1318 | 182 |
| 35 | 3300049593 | Ga0501077_0000739 | Ga0501077_0000739_5697_6272 | 182 |
| 36 | 3300049741 | Ga0501079_0003530 | Ga0501079_0003530_1004_1579 | 182 |
| 37 | 3300049742 | Ga0501080_0009560 | Ga0501080_0009560_5221_5796 | 182 |
| 38 | 3300049743 | Ga0501081_0044098 | Ga0501081_0044098_1828_2403 | 182 |
| 39 | 3300049744 | Ga0501083_0392857 | Ga0501083_0392857_127_702 | 182 |
| 40 | 3300049822 | Ga0501035_0088519 | Ga0501035_0088519_714_1289 | 182 |
| 41 | 3300049824 | Ga0501045_0030748 | Ga0501045_0030748_2496_3056 | 182 |
| 42 | 3300049824 | Ga0501045_0073748 | Ga0501045_0073748_715_1290 | 182 |
| 43 | 3300054114 | Ga0501084_0074508 | Ga0501084_0074508_1554_2129 | 182 |
| 44 | 3300061734 | Ga0530510_0000675 | Ga0530510_0000675_12369_12944 | 182 |
| 45 | 3300045051 | Ga0451576_1388416 | Ga0451576_1388416_158_715 | 185 |
| 46 | 3300009551 | Ga0105238_10476982 | Ga0105238_104769822 | 186 |
| 47 | 3300044706 | Ga0466964_0035307 | Ga0466964_0035307_156_731 | 186 |
| 48 | 3300045976 | Ga0466967_0000469 | Ga0466967_0000469_13540_14115 | 186 |
| 49 | 3300060353 | Ga0501082_0963381 | Ga0501082_0963381_41_616 | 186 |
| 50 | 3300005468 | Ga0070707_100133283 | Ga0070707_1001332832 | 187 |
| 51 | 3300005518 | Ga0070699_100050734 | Ga0070699_1000507344 | 187 |
| 52 | 3300005549 | Ga0070704_100000050 | Ga0070704_10000005024 | 187 |
| 53 | 3300005842 | Ga0068858_100351757 | Ga0068858_1003517573 | 187 |
| 54 | 3300006237 | Ga0097621_100612460 | Ga0097621_1006124602 | 187 |
| 55 | 3300006847 | Ga0075431_100551069 | Ga0075431_1005510691 | 187 |
| 56 | 3300009094 | Ga0111539_11293396 | Ga0111539_112933962 | 187 |
| 57 | 3300014325 | Ga0163163_10207919 | Ga0163163_102079192 | 187 |
| 58 | 3300014968 | Ga0157379_10086604 | Ga0157379_100866045 | 187 |
| 59 | 3300025922 | Ga0207646_10097715 | Ga0207646_100977152 | 187 |
| 60 | 3300026035 | Ga0207703_10317410 | Ga0207703_103174101 | 187 |
| 61 | 3300027360 | Ga0209969_1044390 | Ga0209969_10443901 | 187 |
| 62 | 3300028380 | Ga0268265_10017212 | Ga0268265_100172124 | 187 |
| 63 | 3300032002 | Ga0307416_100490311 | Ga0307416_1004903112 | 187 |
| 64 | 3300035118 | Ga0373954_0000087 | Ga0373954_0000087_8688_9266 | 187 |
| 65 | 3300035172 | Ga0373955_0032403 | Ga0373955_0032403_1174_1752 | 187 |
| 66 | 3300035410 | Ga0373924_0248595 | Ga0373924_0248595_66_644 | 187 |
| 67 | 3300035691 | Ga0373931_0235284 | Ga0373931_0235284_129_707 | 187 |
| 68 | 3300035724 | Ga0373933_0107137 | Ga0373933_0107137_418_996 | 187 |
| 69 | 3300036401 | Ga0373937_0000296 | Ga0373937_0000296_8128_8706 | 187 |
| 70 | 3300045051 | Ga0451576_0247853 | Ga0451576_0247853_456_1034 | 187 |
| 71 | 3300049741 | Ga0501079_0472761 | Ga0501079_0472761_247_819 | 187 |
| 72 | 3300049743 | Ga0501081_0455488 | Ga0501081_0455488_108_680 | 187 |
| 73 | 3300050508 | nmdc:mga09592_310251_c1 | nmdc:mga09592_310251_c1_537_1109 | 187 |
| 74 | 3300050510 | nmdc:mga06r32_513442_c1 | nmdc:mga06r32_513442_c1_522_1094 | 187 |
| 75 | iso_pu_bacteria | 2883291878 | 2883294564 | 187 |
| 76 | 3300006846 | Ga0075430_100047773 | Ga0075430_1000477735 | 188 |
| 77 | 3300009094 | Ga0111539_10014062 | Ga0111539_100140626 | 188 |
| 78 | 3300027907 | Ga0207428_10074681 | Ga0207428_100746813 | 188 |
| 79 | 3300050509 | nmdc:mga0qj67_515449_c1 | nmdc:mga0qj67_515449_c1_134_703 | 188 |
| 80 | 3300050511 | nmdc:mga08y16_15272_c1 | nmdc:mga08y16_15272_c1_4287_4856 | 188 |
| 81 | 3300006871 | Ga0075434_100000318 | Ga0075434_10000031822 | 190 |
| 82 | 3300006914 | Ga0075436_100015330 | Ga0075436_1000153307 | 190 |
| 83 | 3300006914 | Ga0075436_100019266 | Ga0075436_1000192666 | 190 |
| 84 | 3300007076 | Ga0075435_100003168 | Ga0075435_1000031689 | 190 |
| 85 | 3300050512 | nmdc:mga0n895_4843_c1 | nmdc:mga0n895_4843_c1_8009_8599 | 190 |
| 86 | 3300050513 | nmdc:mga0rr50_4012_c1 | nmdc:mga0rr50_4012_c1_2666_3256 | 190 |
| 87 | 3300050514 | nmdc:mga08x19_23291_c1 | nmdc:mga08x19_23291_c1_987_1577 | 190 |
| 88 | 3300050514 | nmdc:mga08x19_3855_c1 | nmdc:mga08x19_3855_c1_7802_8392 | 190 |
| 89 | iso_pu_bacteria | 2887375801 | 2887381318 | 190 |
| 90 | 3300005468 | Ga0070707_100309700 | Ga0070707_1003097003 | 191 |
| 91 | 3300005471 | Ga0070698_100229296 | Ga0070698_1002292962 | 191 |
| 92 | 3300005549 | Ga0070704_100998476 | Ga0070704_1009984762 | 191 |
| 93 | 3300013297 | Ga0157378_10222586 | Ga0157378_102225862 | 191 |
| 94 | 3300025910 | Ga0207684_10395995 | Ga0207684_103959952 | 191 |
| 95 | 3300025922 | Ga0207646_10785375 | Ga0207646_107853752 | 191 |
| 96 | 3300035115 | Ga0373941_0106381 | Ga0373941_0106381_348_950 | 191 |
| 97 | 3300035691 | Ga0373931_0007503 | Ga0373931_0007503_2870_3472 | 191 |
| 98 | 3300005614 | Ga0068856_100050674 | Ga0068856_1000506742 | 192 |
| 99 | 3300026078 | Ga0207702_10169323 | Ga0207702_101693232 | 192 |
| 100 | 3300031251 | Ga0265327_10193094 | Ga0265327_101930941 | 192 |
| 101 | 3300035207 | Ga0373942_0001205 | Ga0373942_0001205_1647_2252 | 194 |
| 102 | 3300026116 | Ga0207674_10084236 | Ga0207674_100842364 | 195 |
| 103 | 3300025913 | Ga0207695_10185343 | Ga0207695_101853431 | 196 |
| 104 | 2162886007 | SwRhRL2b_contig_677025 | SwRhRL2b_0927.00000890 | 197 |
| 105 | 3300002459 | JGI24751J29686_10000772 | JGI24751J29686_100007726 | 197 |
| 106 | 3300005331 | Ga0070670_100008042 | Ga0070670_1000080422 | 197 |
| 107 | 3300005331 | Ga0070670_100193626 | Ga0070670_1001936263 | 197 |
| 108 | 3300005331 | Ga0070670_100465243 | Ga0070670_1004652431 | 197 |
| 109 | 3300005340 | Ga0070689_100327777 | Ga0070689_1003277772 | 197 |
| 110 | 3300005340 | Ga0070689_100677490 | Ga0070689_1006774902 | 197 |
| 111 | 3300005356 | Ga0070674_100016874 | Ga0070674_1000168742 | 197 |
| 112 | 3300005365 | Ga0070688_100335239 | Ga0070688_1003352392 | 197 |
| 113 | 3300005441 | Ga0070700_100311417 | Ga0070700_1003114171 | 197 |
| 114 | 3300005441 | Ga0070700_100745457 | Ga0070700_1007454571 | 197 |
| 115 | 3300005459 | Ga0068867_100977383 | Ga0068867_1009773831 | 197 |
| 116 | 3300005535 | Ga0070684_100991513 | Ga0070684_1009915131 | 197 |
| 117 | 3300005539 | Ga0068853_100428574 | Ga0068853_1004285742 | 197 |
| 118 | 3300005547 | Ga0070693_100597344 | Ga0070693_1005973441 | 197 |
| 119 | 3300005618 | Ga0068864_100079743 | Ga0068864_1000797433 | 197 |
| 120 | 3300005718 | Ga0068866_10172763 | Ga0068866_101727632 | 197 |
| 121 | 3300005719 | Ga0068861_100546056 | Ga0068861_1005460562 | 197 |
| 122 | 3300005841 | Ga0068863_100340770 | Ga0068863_1003407702 | 197 |
| 123 | 3300005843 | Ga0068860_101546838 | Ga0068860_1015468381 | 197 |
| 124 | 3300006237 | Ga0097621_100340497 | Ga0097621_1003404973 | 197 |
| 125 | 3300009093 | Ga0105240_10191749 | Ga0105240_101917492 | 197 |
| 126 | 3300009148 | Ga0105243_10314960 | Ga0105243_103149602 | 197 |
| 127 | 3300009176 | Ga0105242_10349946 | Ga0105242_103499461 | 197 |
| 128 | 3300009553 | Ga0105249_10006600 | Ga0105249_100066005 | 197 |
| 129 | 3300009553 | Ga0105249_11222409 | Ga0105249_112224092 | 197 |
| 130 | 3300011119 | Ga0105246_10640219 | Ga0105246_106402191 | 197 |
| 131 | 3300013105 | Ga0157369_10096977 | Ga0157369_100969772 | 197 |
| 132 | 3300013296 | Ga0157374_10223725 | Ga0157374_102237254 | 197 |
| 133 | 3300014325 | Ga0163163_10461653 | Ga0163163_104616532 | 197 |
| 134 | 3300014325 | Ga0163163_10664547 | Ga0163163_106645471 | 197 |
| 135 | 3300014326 | Ga0157380_10039114 | Ga0157380_100391144 | 197 |
| 136 | 3300017792 | Ga0163161_10062000 | Ga0163161_100620003 | 197 |
| 137 | 3300025899 | Ga0207642_10166460 | Ga0207642_101664602 | 197 |
| 138 | 3300025925 | Ga0207650_10056844 | Ga0207650_100568442 | 197 |
| 139 | 3300025925 | Ga0207650_10189142 | Ga0207650_101891422 | 197 |
| 140 | 3300025935 | Ga0207709_10110310 | Ga0207709_101103102 | 197 |
| 141 | 3300025961 | Ga0207712_10078204 | Ga0207712_100782042 | 197 |
| 142 | 3300026041 | Ga0207639_10369873 | Ga0207639_103698732 | 197 |
| 143 | 3300026075 | Ga0207708_10597297 | Ga0207708_105972972 | 197 |
| 144 | 3300026075 | Ga0207708_10690005 | Ga0207708_106900052 | 197 |
| 145 | 3300026088 | Ga0207641_10365866 | Ga0207641_103658662 | 197 |
| 146 | 3300026089 | Ga0207648_10031033 | Ga0207648_100310333 | 197 |
| 147 | 3300026089 | Ga0207648_10253273 | Ga0207648_102532732 | 197 |
| 148 | 3300026089 | Ga0207648_11010143 | Ga0207648_110101431 | 197 |
| 149 | 3300026095 | Ga0207676_10035984 | Ga0207676_100359842 | 197 |
| 150 | 3300026118 | Ga0207675_100438723 | Ga0207675_1004387232 | 197 |
| 151 | 3300026118 | Ga0207675_100749241 | Ga0207675_1007492411 | 197 |
| 152 | 3300026142 | Ga0207698_10191445 | Ga0207698_101914453 | 197 |
| 153 | 3300028381 | Ga0268264_10399221 | Ga0268264_103992212 | 197 |
| 154 | 3300028381 | Ga0268264_11186022 | Ga0268264_111860222 | 197 |
| 155 | 3300039437 | Ga0436365_0017022 | Ga0436365_0017022_18078_18674 | 197 |
| 156 | 3300039437 | Ga0436365_1865498 | Ga0436365_1865498_31_627 | 197 |
| 157 | 3300041509 | Ga0451843_0248749 | Ga0451843_0248749_344_940 | 197 |
| 158 | 3300041512 | Ga0451853_0991347 | Ga0451853_0991347_26_622 | 197 |
| 159 | 3300044765 | Ga0466970_0285335 | Ga0466970_0285335_52_648 | 197 |
| 160 | 3300046522 | Ga0495643_0035714 | Ga0495643_0035714_1864_2466 | 197 |
| 161 | 3300046616 | Ga0495668_0000963 | Ga0495668_0000963_25458_26054 | 197 |
| 162 | 3300047320 | Ga0495672_0006319 | Ga0495672_0006319_4468_5067 | 197 |
| 163 | 3300049570 | Ga0501033_0107917 | Ga0501033_0107917_242_838 | 197 |
| 164 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_275402_275995 | 197 |
| 165 | 3300049571 | Ga0501034_0013117 | Ga0501034_0013117_7270_7866 | 197 |
| 166 | 3300049571 | Ga0501034_0022667 | Ga0501034_0022667_423_1019 | 197 |
| 167 | 3300049581 | Ga0501047_0550726 | Ga0501047_0550726_237_833 | 197 |
| 168 | 3300049823 | Ga0501044_0014346 | Ga0501044_0014346_745_1341 | 197 |
| 169 | 3300050511 | nmdc:mga08y16_627299_c1 | nmdc:mga08y16_627299_c1_168_764 | 197 |
| 170 | 3300005329 | Ga0070683_100008086 | Ga0070683_1000080869 | 198 |
| 171 | 3300003322 | rootL2_10020975 | rootL2_100209756 | 200 |
| 172 | 3300005719 | Ga0068861_100205966 | Ga0068861_1002059662 | 201 |
| 173 | 3300049571 | Ga0501034_0004775 | Ga0501034_0004775_7761_8396 | 201 |
| 174 | 3300005289 | Ga0065704_10166991 | Ga0065704_101669912 | 203 |
| 175 | 3300005535 | Ga0070684_100423450 | Ga0070684_1004234502 | 203 |
| 176 | 3300028794 | Ga0307515_10016181 | Ga0307515_1001618110 | 203 |
| 177 | 3300005289 | Ga0065704_10099903 | Ga0065704_100999033 | 204 |
| 178 | 3300025934 | Ga0207686_10241814 | Ga0207686_102418142 | 204 |
| 179 | 3300025972 | Ga0207668_10447831 | Ga0207668_104478312 | 204 |
| 180 | 3300026118 | Ga0207675_101141607 | Ga0207675_1011416071 | 204 |
| 181 | iso_pu_bacteria | 2721755487 | 2722731230 | 204 |
| 182 | iso_pu_bacteria | 2896344016 | 2896347310 | 204 |
| 183 | iso_pu_bacteria | 2902048731 | 2902052092 | 204 |
| 184 | iso_pu_bacteria | 2904780799 | 2904782306 | 204 |
| 185 | iso_pu_bacteria | 2919177583 | 2919178497 | 204 |
| 186 | 3300039093 | Ga0400489_23297 | Ga0400489_23297_18_647 | 205 |
| 187 | iso_pu_bacteria | 2585427687 | 2586206413 | 205 |
| 188 | iso_pu_bacteria | 2599185184 | 2599481747 | 205 |
| 189 | iso_pu_bacteria | 2738541284 | 2738761377 | 205 |
| 190 | iso_pu_bacteria | 2738541302 | 2738852877 | 205 |
| 191 | iso_pu_bacteria | 2738543023 | 2739304347 | 205 |
| 192 | iso_pu_bacteria | 2739367651 | 2739586821 | 205 |
| 193 | iso_pu_bacteria | 2739367656 | 2739615138 | 205 |
| 194 | iso_pu_bacteria | 2739367663 | 2739645725 | 205 |
| 195 | iso_pu_bacteria | 2775506987 | 2776616011 | 205 |
| 196 | iso_pu_bacteria | 2818991437 | 2819547243 | 205 |
| 197 | iso_pu_bacteria | 2842722452 | 2842726988 | 205 |
| 198 | iso_pu_bacteria | 2842909656 | 2842911010 | 205 |
| 199 | iso_pu_bacteria | 2849281842 | 2849283870 | 205 |
| 200 | iso_pu_bacteria | 2852623160 | 2852627100 | 205 |
| 201 | iso_pu_bacteria | 2857627736 | 2857627927 | 205 |
| 202 | iso_pu_bacteria | 2884933994 | 2884935166 | 205 |
| 203 | iso_pu_bacteria | 2896317667 | 2896320285 | 205 |
| 204 | iso_pu_bacteria | 2904445276 | 2904447724 | 205 |
| 205 | iso_pu_bacteria | 2919437846 | 2919439401 | 205 |
| 206 | iso_pu_bacteria | 2928078545 | 2928082020 | 205 |
| 207 | iso_pu_bacteria | 2928147474 | 2928152040 | 205 |
| 208 | iso_pu_bacteria | 2932082852 | 2932088075 | 205 |
| 209 | iso_pu_bacteria | 2954016120 | 2954020358 | 205 |
| 210 | iso_pu_bacteria | 3003233435 | 3003235904 | 205 |
| 211 | iso_pu_bacteria | 8055588893 | 8055591401 | 205 |
| 212 | 3300009545 | Ga0105237_10004869 | Ga0105237_1000486910 | 206 |
| 213 | 3300021384 | Ga0213876_10002643 | Ga0213876_100026439 | 206 |
| 214 | 3300025914 | Ga0207671_10007251 | Ga0207671_1000725110 | 206 |
| 215 | 3300031251 | Ga0265327_10086159 | Ga0265327_100861592 | 206 |
| 216 | 3300039437 | Ga0436365_1931949 | Ga0436365_1931949_17134_17772 | 206 |
| 217 | 3300041492 | Ga0451835_0168801 | Ga0451835_0168801_61_711 | 206 |
| 218 | iso_pu_bacteria | 2738541283 | 2738755961 | 206 |
| 219 | iso_pu_bacteria | 2852627209 | 2852628202 | 206 |
| 220 | iso_pu_bacteria | 2919186247 | 2919188562 | 206 |
| 221 | iso_pu_bacteria | 2939664404 | 2939667283 | 206 |
| 222 | 3300001904 | JGI24736J21556_1000812 | JGI24736J21556_10008123 | 207 |
| 223 | 3300001904 | JGI24736J21556_1001942 | JGI24736J21556_10019425 | 207 |
| 224 | 3300001979 | JGI24740J21852_10012653 | JGI24740J21852_100126533 | 207 |
| 225 | 3300001989 | JGI24739J22299_10001457 | JGI24739J22299_100014571 | 207 |
| 226 | 3300001990 | JGI24737J22298_10000852 | JGI24737J22298_100008529 | 207 |
| 227 | 3300001990 | JGI24737J22298_10001745 | JGI24737J22298_100017452 | 207 |
| 228 | 3300001990 | JGI24737J22298_10002702 | JGI24737J22298_100027022 | 207 |
| 229 | 3300001990 | JGI24737J22298_10015372 | JGI24737J22298_100153722 | 207 |
| 230 | 3300001990 | JGI24737J22298_10024646 | JGI24737J22298_100246462 | 207 |
| 231 | 3300002067 | JGI24735J21928_10000027 | JGI24735J21928_1000002738 | 207 |
| 232 | 3300002067 | JGI24735J21928_10015914 | JGI24735J21928_100159142 | 207 |
| 233 | 3300002772 | JGI25164J39214_1001144 | JGI25164J39214_10011444 | 207 |
| 234 | 3300003214 | JGI25165J46597_1001050 | JGI25165J46597_10010503 | 207 |
| 235 | 3300003214 | JGI25165J46597_1008856 | JGI25165J46597_10088562 | 207 |
| 236 | 3300003316 | rootH1_10031584 | rootH1_1003158412 | 207 |
| 237 | 3300003320 | rootH2_10001273 | rootH2_10001273155 | 207 |
| 238 | 3300003320 | rootH2_10114261 | rootH2_101142611 | 207 |
| 239 | 3300003323 | rootH1_10024310 | rootH1_1002431039 | 207 |
| 240 | 3300003323 | rootH1_10083498 | rootH1_100834983 | 207 |
| 241 | 3300003323 | rootH1_10124986 | rootH1_101249862 | 207 |
| 242 | 3300004799 | Ga0058863_11920979 | Ga0058863_119209792 | 207 |
| 243 | 3300004803 | Ga0058862_12833523 | Ga0058862_128335233 | 207 |
| 244 | 3300005288 | Ga0065714_10002980 | Ga0065714_100029805 | 207 |
| 245 | 3300005327 | Ga0070658_10111073 | Ga0070658_101110732 | 207 |
| 246 | 3300005327 | Ga0070658_10226211 | Ga0070658_102262112 | 207 |
| 247 | 3300005327 | Ga0070658_10259587 | Ga0070658_102595872 | 207 |
| 248 | 3300005328 | Ga0070676_10014740 | Ga0070676_100147403 | 207 |
| 249 | 3300005336 | Ga0070680_100247464 | Ga0070680_1002474642 | 207 |
| 250 | 3300005338 | Ga0068868_100047960 | Ga0068868_1000479602 | 207 |
| 251 | 3300005339 | Ga0070660_100049784 | Ga0070660_1000497843 | 207 |
| 252 | 3300005339 | Ga0070660_100363636 | Ga0070660_1003636361 | 207 |
| 253 | 3300005364 | Ga0070673_100026225 | Ga0070673_1000262253 | 207 |
| 254 | 3300005366 | Ga0070659_100000412 | Ga0070659_1000004129 | 207 |
| 255 | 3300005366 | Ga0070659_100040361 | Ga0070659_1000403613 | 207 |
| 256 | 3300005367 | Ga0070667_100467059 | Ga0070667_1004670592 | 207 |
| 257 | 3300005455 | Ga0070663_100014280 | Ga0070663_1000142804 | 207 |
| 258 | 3300005456 | Ga0070678_100007878 | Ga0070678_1000078783 | 207 |
| 259 | 3300005457 | Ga0070662_100000468 | Ga0070662_10000046813 | 207 |
| 260 | 3300005458 | Ga0070681_10125196 | Ga0070681_101251964 | 207 |
| 261 | 3300005459 | Ga0068867_100004302 | Ga0068867_1000043023 | 207 |
| 262 | 3300005530 | Ga0070679_100006243 | Ga0070679_1000062437 | 207 |
| 263 | 3300005530 | Ga0070679_100141289 | Ga0070679_1001412892 | 207 |
| 264 | 3300005539 | Ga0068853_100039336 | Ga0068853_1000393363 | 207 |
| 265 | 3300005539 | Ga0068853_100231655 | Ga0068853_1002316552 | 207 |
| 266 | 3300005543 | Ga0070672_100191686 | Ga0070672_1001916861 | 207 |
| 267 | 3300005548 | Ga0070665_100000118 | Ga0070665_100000118146 | 207 |
| 268 | 3300005563 | Ga0068855_100000958 | Ga0068855_1000009584 | 207 |
| 269 | 3300005563 | Ga0068855_100008698 | Ga0068855_1000086988 | 207 |
| 270 | 3300005563 | Ga0068855_100019618 | Ga0068855_1000196183 | 207 |
| 271 | 3300005563 | Ga0068855_100091183 | Ga0068855_1000911832 | 207 |
| 272 | 3300005563 | Ga0068855_100109018 | Ga0068855_1001090182 | 207 |
| 273 | 3300005563 | Ga0068855_100381016 | Ga0068855_1003810163 | 207 |
| 274 | 3300005578 | Ga0068854_100117651 | Ga0068854_1001176511 | 207 |
| 275 | 3300005614 | Ga0068856_100000006 | Ga0068856_10000000644 | 207 |
| 276 | 3300005616 | Ga0068852_100000720 | Ga0068852_10000072011 | 207 |
| 277 | 3300005616 | Ga0068852_100386360 | Ga0068852_1003863602 | 207 |
| 278 | 3300005718 | Ga0068866_10002584 | Ga0068866_100025843 | 207 |
| 279 | 3300005718 | Ga0068866_10208103 | Ga0068866_102081032 | 207 |
| 280 | 3300006195 | Ga0075366_10014581 | Ga0075366_100145815 | 207 |
| 281 | 3300006195 | Ga0075366_10042954 | Ga0075366_100429542 | 207 |
| 282 | 3300006237 | Ga0097621_100000285 | Ga0097621_10000028515 | 207 |
| 283 | 3300006358 | Ga0068871_100000080 | Ga0068871_10000008042 | 207 |
| 284 | 3300006881 | Ga0068865_100000218 | Ga0068865_10000021819 | 207 |
| 285 | 3300009093 | Ga0105240_10048169 | Ga0105240_100481695 | 207 |
| 286 | 3300009093 | Ga0105240_10097171 | Ga0105240_100971713 | 207 |
| 287 | 3300009093 | Ga0105240_10152098 | Ga0105240_101520982 | 207 |
| 288 | 3300009093 | Ga0105240_10186200 | Ga0105240_101862003 | 207 |
| 289 | 3300009093 | Ga0105240_10216578 | Ga0105240_102165782 | 207 |
| 290 | 3300009093 | Ga0105240_10310454 | Ga0105240_103104543 | 207 |
| 291 | 3300009093 | Ga0105240_10397261 | Ga0105240_103972612 | 207 |
| 292 | 3300009093 | Ga0105240_10675164 | Ga0105240_106751642 | 207 |
| 293 | 3300009093 | Ga0105240_10901263 | Ga0105240_109012632 | 207 |
| 294 | 3300009093 | Ga0105240_10996881 | Ga0105240_109968812 | 207 |
| 295 | 3300009174 | Ga0105241_10000999 | Ga0105241_100009993 | 207 |
| 296 | 3300009174 | Ga0105241_10474511 | Ga0105241_104745111 | 207 |
| 297 | 3300009176 | Ga0105242_10002835 | Ga0105242_100028354 | 207 |
| 298 | 3300009545 | Ga0105237_10002840 | Ga0105237_1000284012 | 207 |
| 299 | 3300009545 | Ga0105237_10003145 | Ga0105237_1000314510 | 207 |
| 300 | 3300009545 | Ga0105237_10023283 | Ga0105237_100232832 | 207 |
| 301 | 3300009545 | Ga0105237_10232232 | Ga0105237_102322322 | 207 |
| 302 | 3300009545 | Ga0105237_10410378 | Ga0105237_104103782 | 207 |
| 303 | 3300009551 | Ga0105238_10003441 | Ga0105238_100034418 | 207 |
| 304 | 3300009551 | Ga0105238_10081249 | Ga0105238_100812495 | 207 |
| 305 | 3300010375 | Ga0105239_10000115 | Ga0105239_1000011579 | 207 |
| 306 | 3300010375 | Ga0105239_10002115 | Ga0105239_1000211513 | 207 |
| 307 | 3300010375 | Ga0105239_10002395 | Ga0105239_1000239514 | 207 |
| 308 | 3300010375 | Ga0105239_10008252 | Ga0105239_100082529 | 207 |
| 309 | 3300010375 | Ga0105239_10014398 | Ga0105239_100143983 | 207 |
| 310 | 3300010375 | Ga0105239_10239007 | Ga0105239_102390073 | 207 |
| 311 | 3300010375 | Ga0105239_10674133 | Ga0105239_106741331 | 207 |
| 312 | 3300010375 | Ga0105239_10680154 | Ga0105239_106801542 | 207 |
| 313 | 3300011119 | Ga0105246_10302210 | Ga0105246_103022102 | 207 |
| 314 | 3300013100 | Ga0157373_10000486 | Ga0157373_1000048625 | 207 |
| 315 | 3300013102 | Ga0157371_10001401 | Ga0157371_100014019 | 207 |
| 316 | 3300013102 | Ga0157371_10005485 | Ga0157371_100054857 | 207 |
| 317 | 3300013104 | Ga0157370_10089848 | Ga0157370_100898483 | 207 |
| 318 | 3300013104 | Ga0157370_10409702 | Ga0157370_104097022 | 207 |
| 319 | 3300013104 | Ga0157370_10486180 | Ga0157370_104861802 | 207 |
| 320 | 3300013104 | Ga0157370_10501905 | Ga0157370_105019052 | 207 |
| 321 | 3300013105 | Ga0157369_10000101 | Ga0157369_1000010149 | 207 |
| 322 | 3300013105 | Ga0157369_10101557 | Ga0157369_101015572 | 207 |
| 323 | 3300013105 | Ga0157369_10131283 | Ga0157369_101312834 | 207 |
| 324 | 3300013105 | Ga0157369_10708961 | Ga0157369_107089612 | 207 |
| 325 | 3300013105 | Ga0157369_10742467 | Ga0157369_107424672 | 207 |
| 326 | 3300013296 | Ga0157374_10000741 | Ga0157374_1000074116 | 207 |
| 327 | 3300013296 | Ga0157374_10001208 | Ga0157374_1000120811 | 207 |
| 328 | 3300013296 | Ga0157374_10038994 | Ga0157374_100389943 | 207 |
| 329 | 3300013296 | Ga0157374_10302577 | Ga0157374_103025772 | 207 |
| 330 | 3300013297 | Ga0157378_10017834 | Ga0157378_100178343 | 207 |
| 331 | 3300013306 | Ga0163162_10000012 | Ga0163162_10000012157 | 207 |
| 332 | 3300013306 | Ga0163162_10006625 | Ga0163162_100066255 | 207 |
| 333 | 3300013306 | Ga0163162_10025616 | Ga0163162_100256163 | 207 |
| 334 | 3300013306 | Ga0163162_10228148 | Ga0163162_102281484 | 207 |
| 335 | 3300013307 | Ga0157372_10000041 | Ga0157372_1000004146 | 207 |
| 336 | 3300013307 | Ga0157372_10000199 | Ga0157372_100001999 | 207 |
| 337 | 3300013307 | Ga0157372_10000538 | Ga0157372_100005381 | 207 |
| 338 | 3300013308 | Ga0157375_10251304 | Ga0157375_102513042 | 207 |
| 339 | 3300013308 | Ga0157375_11170978 | Ga0157375_111709781 | 207 |
| 340 | 3300014969 | Ga0157376_10090563 | Ga0157376_100905633 | 207 |
| 341 | 3300014969 | Ga0157376_10637486 | Ga0157376_106374862 | 207 |
| 342 | 3300017792 | Ga0163161_10073200 | Ga0163161_100732003 | 207 |
| 343 | 3300021361 | Ga0213872_10002511 | Ga0213872_1000251110 | 207 |
| 344 | 3300025230 | Ga0209563_106202 | Ga0209563_1062023 | 207 |
| 345 | 3300025231 | Ga0207427_100072 | Ga0207427_10007258 | 207 |
| 346 | 3300025233 | Ga0209437_100026 | Ga0209437_100026284 | 207 |
| 347 | 3300025233 | Ga0209437_100144 | Ga0209437_100144143 | 207 |
| 348 | 3300025250 | Ga0209026_1001159 | Ga0209026_10011598 | 207 |
| 349 | 3300025250 | Ga0209026_1003618 | Ga0209026_10036183 | 207 |
| 350 | 3300025258 | Ga0209129_1012439 | Ga0209129_10124393 | 207 |
| 351 | 3300025261 | Ga0209233_1000111 | Ga0209233_1000111178 | 207 |
| 352 | 3300025261 | Ga0209233_1002603 | Ga0209233_10026034 | 207 |
| 353 | 3300025261 | Ga0209233_1012503 | Ga0209233_10125034 | 207 |
| 354 | 3300025272 | Ga0209455_1002153 | Ga0209455_10021534 | 207 |
| 355 | 3300025899 | Ga0207642_10018419 | Ga0207642_100184194 | 207 |
| 356 | 3300025904 | Ga0207647_10000049 | Ga0207647_1000004967 | 207 |
| 357 | 3300025904 | Ga0207647_10000103 | Ga0207647_1000010352 | 207 |
| 358 | 3300025904 | Ga0207647_10116372 | Ga0207647_101163722 | 207 |
| 359 | 3300025907 | Ga0207645_10000398 | Ga0207645_1000039812 | 207 |
| 360 | 3300025909 | Ga0207705_10000026 | Ga0207705_1000002657 | 207 |
| 361 | 3300025909 | Ga0207705_10049489 | Ga0207705_100494891 | 207 |
| 362 | 3300025909 | Ga0207705_10229116 | Ga0207705_102291162 | 207 |
| 363 | 3300025911 | Ga0207654_10075439 | Ga0207654_100754392 | 207 |
| 364 | 3300025913 | Ga0207695_10007414 | Ga0207695_1000741412 | 207 |
| 365 | 3300025913 | Ga0207695_10015443 | Ga0207695_100154433 | 207 |
| 366 | 3300025913 | Ga0207695_10092143 | Ga0207695_100921434 | 207 |
| 367 | 3300025913 | Ga0207695_10097954 | Ga0207695_100979544 | 207 |
| 368 | 3300025913 | Ga0207695_10383123 | Ga0207695_103831232 | 207 |
| 369 | 3300025914 | Ga0207671_10004017 | Ga0207671_1000401710 | 207 |
| 370 | 3300025914 | Ga0207671_10006480 | Ga0207671_100064802 | 207 |
| 371 | 3300025914 | Ga0207671_10009778 | Ga0207671_100097784 | 207 |
| 372 | 3300025914 | Ga0207671_10104465 | Ga0207671_101044652 | 207 |
| 373 | 3300025914 | Ga0207671_10266393 | Ga0207671_102663932 | 207 |
| 374 | 3300025917 | Ga0207660_10205501 | Ga0207660_102055012 | 207 |
| 375 | 3300025919 | Ga0207657_10076595 | Ga0207657_100765953 | 207 |
| 376 | 3300025919 | Ga0207657_10225709 | Ga0207657_102257091 | 207 |
| 377 | 3300025921 | Ga0207652_10004777 | Ga0207652_100047774 | 207 |
| 378 | 3300025924 | Ga0207694_10024569 | Ga0207694_100245694 | 207 |
| 379 | 3300025931 | Ga0207644_10003140 | Ga0207644_100031407 | 207 |
| 380 | 3300025932 | Ga0207690_10000049 | Ga0207690_1000004964 | 207 |
| 381 | 3300025932 | Ga0207690_10004182 | Ga0207690_100041826 | 207 |
| 382 | 3300025933 | Ga0207706_10000111 | Ga0207706_1000011166 | 207 |
| 383 | 3300025933 | Ga0207706_10108611 | Ga0207706_101086112 | 207 |
| 384 | 3300025937 | Ga0207669_10774433 | Ga0207669_107744332 | 207 |
| 385 | 3300025938 | Ga0207704_10000065 | Ga0207704_1000006526 | 207 |
| 386 | 3300025949 | Ga0207667_10000477 | Ga0207667_1000047725 | 207 |
| 387 | 3300025949 | Ga0207667_10010697 | Ga0207667_100106974 | 207 |
| 388 | 3300025949 | Ga0207667_10021217 | Ga0207667_100212175 | 207 |
| 389 | 3300025949 | Ga0207667_10612805 | Ga0207667_106128051 | 207 |
| 390 | 3300025949 | Ga0207667_10733555 | Ga0207667_107335552 | 207 |
| 391 | 3300025960 | Ga0207651_10066219 | Ga0207651_100662193 | 207 |
| 392 | 3300025981 | Ga0207640_10035481 | Ga0207640_100354811 | 207 |
| 393 | 3300026023 | Ga0207677_10049549 | Ga0207677_100495494 | 207 |
| 394 | 3300026041 | Ga0207639_10007063 | Ga0207639_100070633 | 207 |
| 395 | 3300026041 | Ga0207639_10156388 | Ga0207639_101563882 | 207 |
| 396 | 3300026067 | Ga0207678_10025963 | Ga0207678_100259634 | 207 |
| 397 | 3300026078 | Ga0207702_10000023 | Ga0207702_1000002328 | 207 |
| 398 | 3300026078 | Ga0207702_10364406 | Ga0207702_103644061 | 207 |
| 399 | 3300026089 | Ga0207648_10001417 | Ga0207648_1000141717 | 207 |
| 400 | 3300026121 | Ga0207683_10008658 | Ga0207683_100086583 | 207 |
| 401 | 3300026142 | Ga0207698_10126567 | Ga0207698_101265672 | 207 |
| 402 | 3300026142 | Ga0207698_10162949 | Ga0207698_101629493 | 207 |
| 403 | 3300028379 | Ga0268266_10000121 | Ga0268266_1000012111 | 207 |
| 404 | 3300028786 | Ga0307517_10001388 | Ga0307517_1000138815 | 207 |
| 405 | 3300028794 | Ga0307515_10319199 | Ga0307515_103191992 | 207 |
| 406 | 3300028800 | Ga0265338_10130761 | Ga0265338_101307613 | 207 |
| 407 | 3300031507 | Ga0307509_10050400 | Ga0307509_100504002 | 207 |
| 408 | 3300031595 | Ga0265313_10116255 | Ga0265313_101162552 | 207 |
| 409 | 3300031911 | Ga0307412_10083081 | Ga0307412_100830813 | 207 |
| 410 | 3300033180 | Ga0307510_10000419 | Ga0307510_1000041919 | 207 |
| 411 | 3300037312 | Ga0395899_0000024 | Ga0395899_0000024_178264_178902 | 207 |
| 412 | 3300037312 | Ga0395899_0000237 | Ga0395899_0000237_49201_49836 | 207 |
| 413 | 3300037418 | Ga0395900_0001123 | Ga0395900_0001123_29681_30319 | 207 |
| 414 | 3300037418 | Ga0395900_0001352 | Ga0395900_0001352_8271_8909 | 207 |
| 415 | 3300037418 | Ga0395900_0004216 | Ga0395900_0004216_112_750 | 207 |
| 416 | 3300037418 | Ga0395900_0700686 | Ga0395900_0700686_158_796 | 207 |
| 417 | 3300037466 | Ga0395898_0022388 | Ga0395898_0022388_4355_4993 | 207 |
| 418 | 3300037466 | Ga0395898_0763171 | Ga0395898_0763171_122_760 | 207 |
| 419 | 3300037471 | Ga0395905_0000246 | Ga0395905_0000246_72408_73046 | 207 |
| 420 | 3300037471 | Ga0395905_0000347 | Ga0395905_0000347_59098_59736 | 207 |
| 421 | 3300038443 | Ga0395901_0000184 | Ga0395901_0000184_72349_72987 | 207 |
| 422 | 3300038443 | Ga0395901_0109857 | Ga0395901_0109857_450_1088 | 207 |
| 423 | 3300038443 | Ga0395901_0134229 | Ga0395901_0134229_1791_2429 | 207 |
| 424 | 3300039447 | Ga0436361_1055999 | Ga0436361_1055999_1804_2442 | 207 |
| 425 | 3300041452 | Ga0451793_0339311 | Ga0451793_0339311_233_871 | 207 |
| 426 | 3300042005 | Ga0439448_0002050 | Ga0439448_0002050_1868_2506 | 207 |
| 427 | 3300044656 | Ga0466969_0032983 | Ga0466969_0032983_571_1209 | 207 |
| 428 | 3300044684 | Ga0466966_0010043 | Ga0466966_0010043_4759_5397 | 207 |
| 429 | 3300044693 | Ga0466961_0037243 | Ga0466961_0037243_2180_2818 | 207 |
| 430 | 3300044735 | Ga0466968_0113713 | Ga0466968_0113713_354_992 | 207 |
| 431 | 3300045836 | Ga0466958_0027342 | Ga0466958_0027342_1470_2108 | 207 |
| 432 | 3300046471 | Ga0495650_0000098 | Ga0495650_0000098_164023_164664 | 207 |
| 433 | 3300046474 | Ga0495605_0017082 | Ga0495605_0017082_2936_3574 | 207 |
| 434 | 3300046492 | Ga0495585_0000308 | Ga0495585_0000308_27131_27772 | 207 |
| 435 | 3300046506 | Ga0495583_0032516 | Ga0495583_0032516_475_1116 | 207 |
| 436 | 3300046506 | Ga0495583_0044858 | Ga0495583_0044858_698_1339 | 207 |
| 437 | 3300046507 | Ga0495606_0006041 | Ga0495606_0006041_7233_7874 | 207 |
| 438 | 3300046507 | Ga0495606_0106567 | Ga0495606_0106567_643_1287 | 207 |
| 439 | 3300046513 | Ga0495616_0000433 | Ga0495616_0000433_11065_11709 | 207 |
| 440 | 3300046513 | Ga0495616_0006824 | Ga0495616_0006824_3629_4270 | 207 |
| 441 | 3300046519 | Ga0495632_0045318 | Ga0495632_0045318_102_740 | 207 |
| 442 | 3300046524 | Ga0495648_0041623 | Ga0495648_0041623_68_712 | 207 |
| 443 | 3300046528 | Ga0495642_0285348 | Ga0495642_0285348_29_667 | 207 |
| 444 | 3300046616 | Ga0495668_0114690 | Ga0495668_0114690_283_921 | 207 |
| 445 | 3300046660 | Ga0495625_0000183 | Ga0495625_0000183_46636_47277 | 207 |
| 446 | 3300046660 | Ga0495625_0021304 | Ga0495625_0021304_1655_2299 | 207 |
| 447 | 3300046660 | Ga0495625_0075871 | Ga0495625_0075871_527_1171 | 207 |
| 448 | 3300046660 | Ga0495625_0144600 | Ga0495625_0144600_769_1407 | 207 |
| 449 | 3300046665 | Ga0495661_0003387 | Ga0495661_0003387_8809_9447 | 207 |
| 450 | 3300046665 | Ga0495661_0003737 | Ga0495661_0003737_7219_7860 | 207 |
| 451 | 3300046665 | Ga0495661_0045590 | Ga0495661_0045590_1604_2242 | 207 |
| 452 | 3300046692 | Ga0495671_0062011 | Ga0495671_0062011_939_1580 | 207 |
| 453 | 3300046694 | Ga0495649_0000046 | Ga0495649_0000046_46732_47373 | 207 |
| 454 | 3300046694 | Ga0495649_0067759 | Ga0495649_0067759_753_1391 | 207 |
| 455 | 3300046810 | Ga0495660_0002367 | Ga0495660_0002367_8549_9190 | 207 |
| 456 | 3300047323 | Ga0495683_0010104 | Ga0495683_0010104_410_1048 | 207 |
| 457 | 3300047443 | Ga0495687_007696 | Ga0495687_007696_2419_3057 | 207 |
| 458 | 3300047472 | Ga0495686_0001597 | Ga0495686_0001597_11167_11805 | 207 |
| 459 | 3300047472 | Ga0495686_0015329 | Ga0495686_0015329_1913_2551 | 207 |
| 460 | 3300047472 | Ga0495686_0030576 | Ga0495686_0030576_1816_2460 | 207 |
| 461 | 3300049459 | Ga0495678_006015 | Ga0495678_006015_414_1058 | 207 |
| 462 | 3300050493 | nmdc:mga0k408_16491_c1 | nmdc:mga0k408_16491_c1_277_918 | 207 |
| 463 | 3300050493 | nmdc:mga0k408_671_c1 | nmdc:mga0k408_671_c1_12530_13165 | 207 |
| 464 | 3300053122 | Ga0500608_000417 | Ga0500608_000417_8312_8950 | 207 |
| 465 | 3300053130 | Ga0500642_0092787 | Ga0500642_0092787_168_806 | 207 |
| 466 | 3300053157 | Ga0500624_000230 | Ga0500624_000230_19514_20161 | 207 |
| 467 | 3300059492 | Ga0587073_0024615 | Ga0587073_0024615_399_1037 | 207 |
| 468 | iso_pu_bacteria | 2977232053 | 2977234728 | 207 |
| 469 | 3300005289 | Ga0065704_10333564 | Ga0065704_103335641 | 208 |
| 470 | 3300009093 | Ga0105240_10643183 | Ga0105240_106431832 | 208 |
| 471 | 3300009148 | Ga0105243_10000046 | Ga0105243_1000004653 | 208 |
| 472 | 3300010375 | Ga0105239_10000008 | Ga0105239_10000008236 | 208 |
| 473 | 3300025913 | Ga0207695_10416484 | Ga0207695_104164841 | 208 |
| 474 | 3300025935 | Ga0207709_10000020 | Ga0207709_10000020289 | 208 |
| 475 | 3300031911 | Ga0307412_10149339 | Ga0307412_101493392 | 208 |
| 476 | 3300032004 | Ga0307414_10060303 | Ga0307414_100603034 | 208 |
| 477 | 3300032004 | Ga0307414_10098407 | Ga0307414_100984073 | 208 |
| 478 | 3300048919 | Ga0496116_0004756 | Ga0496116_0004756_11403_12032 | 208 |
| 479 | 3300048920 | Ga0496117_0000995 | Ga0496117_0000995_8220_8849 | 208 |
| 480 | 3300048925 | Ga0496122_0060092 | Ga0496122_0060092_743_1372 | 208 |
| 481 | 3300048926 | Ga0496123_0027067 | Ga0496123_0027067_2751_3380 | 208 |
| 482 | 3300048928 | Ga0496125_0304610 | Ga0496125_0304610_304_933 | 208 |
| 483 | 3300049574 | Ga0501038_0065228 | Ga0501038_0065228_156_830 | 208 |
| 484 | 3300053080 | Ga0500635_0002410 | Ga0500635_0002410_1787_2431 | 208 |
| 485 | iso_pu_bacteria | 2890737413 | 2890739219 | 208 |
| 486 | iso_pu_bacteria | 2898713307 | 2898714527 | 208 |
| 487 | 2162886007 | SwRhRL2b_contig_3308433 | SwRhRL2b_0229.00001910 | 209 |
| 488 | 3300002741 | JGI25157J39369_1002704 | JGI25157J39369_10027044 | 209 |
| 489 | 3300002773 | JGI25152J39213_1000043 | JGI25152J39213_100004327 | 209 |
| 490 | 3300002774 | JGI25150J39212_1000023 | JGI25150J39212_100002399 | 209 |
| 491 | 3300003187 | JGI25151J46595_10000082 | JGI25151J46595_1000008299 | 209 |
| 492 | 3300003215 | JGI25153J46596_10000060 | JGI25153J46596_10000060100 | 209 |
| 493 | 3300003323 | rootH1_10233543 | rootH1_102335433 | 209 |
| 494 | 3300003781 | Ga0055536_1000002 | Ga0055536_100000244 | 209 |
| 495 | 3300003791 | Ga0055530_10000739 | Ga0055530_1000073911 | 209 |
| 496 | 3300005288 | Ga0065714_10003630 | Ga0065714_1000363011 | 209 |
| 497 | 3300005288 | Ga0065714_10004446 | Ga0065714_100044464 | 209 |
| 498 | 3300005288 | Ga0065714_10064525 | Ga0065714_1006452526 | 209 |
| 499 | 3300005288 | Ga0065714_10080235 | Ga0065714_100802353 | 209 |
| 500 | 3300005289 | Ga0065704_10000206 | Ga0065704_1000020675 | 209 |
| 501 | 3300006847 | Ga0075431_100008882 | Ga0075431_1000088828 | 209 |
| 502 | 3300006880 | Ga0075429_100055559 | Ga0075429_1000555593 | 209 |
| 503 | 3300009036 | Ga0105244_10042625 | Ga0105244_100426252 | 209 |
| 504 | 3300009545 | Ga0105237_10000088 | Ga0105237_1000008853 | 209 |
| 505 | 3300013100 | Ga0157373_10000376 | Ga0157373_1000037626 | 209 |
| 506 | 3300013100 | Ga0157373_10000546 | Ga0157373_1000054616 | 209 |
| 507 | 3300013100 | Ga0157373_10042194 | Ga0157373_100421944 | 209 |
| 508 | 3300013100 | Ga0157373_10405367 | Ga0157373_104053672 | 209 |
| 509 | 3300013102 | Ga0157371_10000151 | Ga0157371_1000015140 | 209 |
| 510 | 3300013102 | Ga0157371_10000888 | Ga0157371_1000088825 | 209 |
| 511 | 3300013102 | Ga0157371_10001845 | Ga0157371_100018456 | 209 |
| 512 | 3300013102 | Ga0157371_10023303 | Ga0157371_100233034 | 209 |
| 513 | 3300013102 | Ga0157371_10366364 | Ga0157371_103663642 | 209 |
| 514 | 3300013104 | Ga0157370_10000597 | Ga0157370_1000059714 | 209 |
| 515 | 3300013104 | Ga0157370_10006731 | Ga0157370_100067313 | 209 |
| 516 | 3300013104 | Ga0157370_10017828 | Ga0157370_100178284 | 209 |
| 517 | 3300013104 | Ga0157370_10069775 | Ga0157370_100697755 | 209 |
| 518 | 3300013104 | Ga0157370_10070205 | Ga0157370_100702053 | 209 |
| 519 | 3300013104 | Ga0157370_10110214 | Ga0157370_101102143 | 209 |
| 520 | 3300013104 | Ga0157370_10136766 | Ga0157370_101367661 | 209 |
| 521 | 3300013104 | Ga0157370_10263023 | Ga0157370_102630232 | 209 |
| 522 | 3300013105 | Ga0157369_10021519 | Ga0157369_100215195 | 209 |
| 523 | 3300013306 | Ga0163162_10000011 | Ga0163162_10000011236 | 209 |
| 524 | 3300013307 | Ga0157372_10007865 | Ga0157372_100078657 | 209 |
| 525 | 3300013308 | Ga0157375_10064342 | Ga0157375_100643423 | 209 |
| 526 | 3300013308 | Ga0157375_10156528 | Ga0157375_101565283 | 209 |
| 527 | 3300013308 | Ga0157375_10206292 | Ga0157375_102062922 | 209 |
| 528 | 3300014497 | Ga0182008_10000020 | Ga0182008_1000002045 | 209 |
| 529 | 3300014497 | Ga0182008_10000296 | Ga0182008_1000029614 | 209 |
| 530 | 3300014497 | Ga0182008_10000342 | Ga0182008_1000034211 | 209 |
| 531 | 3300014497 | Ga0182008_10138260 | Ga0182008_101382602 | 209 |
| 532 | 3300014497 | Ga0182008_10247581 | Ga0182008_102475812 | 209 |
| 533 | 3300015261 | Ga0182006_1000242 | Ga0182006_100024229 | 209 |
| 534 | 3300015261 | Ga0182006_1000310 | Ga0182006_100031031 | 209 |
| 535 | 3300015261 | Ga0182006_1000735 | Ga0182006_100073512 | 209 |
| 536 | 3300015261 | Ga0182006_1005572 | Ga0182006_10055723 | 209 |
| 537 | 3300015261 | Ga0182006_1022335 | Ga0182006_10223351 | 209 |
| 538 | 3300015262 | Ga0182007_10008621 | Ga0182007_100086213 | 209 |
| 539 | 3300015262 | Ga0182007_10062468 | Ga0182007_100624682 | 209 |
| 540 | 3300015682 | Ga0183373_1002 | Ga0183373_1002507 | 209 |
| 541 | 3300017792 | Ga0163161_10000330 | Ga0163161_1000033026 | 209 |
| 542 | 3300017792 | Ga0163161_10000565 | Ga0163161_100005659 | 209 |
| 543 | 3300017792 | Ga0163161_10002836 | Ga0163161_100028365 | 209 |
| 544 | 3300017792 | Ga0163161_10067561 | Ga0163161_100675613 | 209 |
| 545 | 3300017792 | Ga0163161_10173456 | Ga0163161_101734562 | 209 |
| 546 | 3300020077 | Ga0206351_10221156 | Ga0206351_102211562 | 209 |
| 547 | 3300025245 | Ga0207425_1000051 | Ga0207425_1000051132 | 209 |
| 548 | 3300025250 | Ga0209026_1000246 | Ga0209026_100024647 | 209 |
| 549 | 3300025258 | Ga0209129_1000121 | Ga0209129_100012199 | 209 |
| 550 | 3300025292 | Ga0209676_1000022 | Ga0209676_1000022496 | 209 |
| 551 | 3300025294 | Ga0209025_1000160 | Ga0209025_100016028 | 209 |
| 552 | 3300025297 | Ga0209758_1000147 | Ga0209758_100014728 | 209 |
| 553 | 3300025298 | Ga0209050_1000020 | Ga0209050_100002043 | 209 |
| 554 | 3300025303 | Ga0209051_1086543 | Ga0209051_10865431 | 209 |
| 555 | 3300025914 | Ga0207671_10000744 | Ga0207671_1000074423 | 209 |
| 556 | 3300030731 | Ga0316177_1061403 | Ga0316177_10614032 | 209 |
| 557 | 3300030731 | Ga0316177_1071693 | Ga0316177_10716933 | 209 |
| 558 | 3300030732 | Ga0316176_1096751 | Ga0316176_10967514 | 209 |
| 559 | 3300030742 | Ga0316183_1100732 | Ga0316183_110073220 | 209 |
| 560 | 3300030744 | Ga0316181_1213886 | Ga0316181_12138863 | 209 |
| 561 | 3300030744 | Ga0316181_1231306 | Ga0316181_12313064 | 209 |
| 562 | 3300031548 | Ga0307408_100000209 | Ga0307408_10000020961 | 209 |
| 563 | 3300031548 | Ga0307408_100000393 | Ga0307408_10000039339 | 209 |
| 564 | 3300031548 | Ga0307408_100000487 | Ga0307408_10000048718 | 209 |
| 565 | 3300031731 | Ga0307405_10012446 | Ga0307405_100124462 | 209 |
| 566 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001355 | 209 |
| 567 | 3300031911 | Ga0307412_10000724 | Ga0307412_1000072415 | 209 |
| 568 | 3300031911 | Ga0307412_10286128 | Ga0307412_102861282 | 209 |
| 569 | 3300031995 | Ga0307409_100713620 | Ga0307409_1007136202 | 209 |
| 570 | 3300032004 | Ga0307414_10001886 | Ga0307414_100018865 | 209 |
| 571 | 3300032004 | Ga0307414_10013334 | Ga0307414_100133343 | 209 |
| 572 | 3300032004 | Ga0307414_10019675 | Ga0307414_100196754 | 209 |
| 573 | 3300032004 | Ga0307414_10052108 | Ga0307414_100521083 | 209 |
| 574 | 3300032004 | Ga0307414_10058710 | Ga0307414_100587102 | 209 |
| 575 | 3300032004 | Ga0307414_10068665 | Ga0307414_100686653 | 209 |
| 576 | 3300032004 | Ga0307414_10192770 | Ga0307414_101927702 | 209 |
| 577 | 3300032004 | Ga0307414_10209358 | Ga0307414_102093582 | 209 |
| 578 | 3300041460 | Ga0451802_1573306 | Ga0451802_1573306_175_810 | 209 |
| 579 | 3300042014 | Ga0439457_024042 | Ga0439457_024042_99_737 | 209 |
| 580 | 3300046507 | Ga0495606_0020092 | Ga0495606_0020092_1439_2086 | 209 |
| 581 | 3300046507 | Ga0495606_0035610 | Ga0495606_0035610_1702_2337 | 209 |
| 582 | 3300046512 | Ga0495610_0000054 | Ga0495610_0000054_99111_99746 | 209 |
| 583 | 3300046538 | Ga0495609_0020070 | Ga0495609_0020070_946_1581 | 209 |
| 584 | 3300046558 | Ga0495633_0011309 | Ga0495633_0011309_2464_3099 | 209 |
| 585 | 3300048925 | Ga0496122_0000817 | Ga0496122_0000817_31118_31753 | 209 |
| 586 | 3300048926 | Ga0496123_0008229 | Ga0496123_0008229_3135_3770 | 209 |
| 587 | 3300049649 | Ga0501198_001244 | Ga0501198_001244_285_926 | 209 |
| 588 | 3300049663 | Ga0501223_001575 | Ga0501223_001575_1812_2453 | 209 |
| 589 | 3300049675 | Ga0501243_016482 | Ga0501243_016482_300_941 | 209 |
| 590 | 3300049682 | Ga0501252_006249 | Ga0501252_006249_492_1124 | 209 |
| 591 | 3300049758 | Ga0501241_002477 | Ga0501241_002477_1567_2196 | 209 |
| 592 | 3300049758 | Ga0501241_016529 | Ga0501241_016529_276_905 | 209 |
| 593 | 3300050509 | nmdc:mga0qj67_23955_c1 | nmdc:mga0qj67_23955_c1_2499_3161 | 209 |
| 594 | 3300053093 | Ga0500651_0001978 | Ga0500651_0001978_5180_5809 | 209 |
| 595 | iso_pu_bacteria | 2842903701 | 2842905068 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z88-assembly1.cif.gz_I | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9766 | 26 | 204 |
| 6z89-assembly1.cif.gz_D-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9692 | 22 | 204 |
| 7ala-assembly1.cif.gz_E-2 | human gch-gfrp inhibitory complex | 0.969 | 22 | 204 |
| 6z88-assembly1.cif.gz_B | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9684 | 22 | 204 |
| 7alc-assembly1.cif.gz_C-2 | human gch-gfrp stimulatory complex | 0.9674 | 26 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I5H7_254_381_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9589 | 77 | 189 | 3.30.1130.10 |
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9525 | 79 | 206 | 3.30.1130.10 |
| 1wm9B01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9406 | 25 | 73 | 1.10.286.10 |
| 1wuqA01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9384 | 25 | 73 | 1.10.286.10 |
| 1wm9A01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9362 | 25 | 73 | 1.10.286.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1MIN2-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 1.001 | 79 | 170 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 |
| AF-A0A7Y1V6H8-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9837 | 14 | 156 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-Q2RYU5-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) | 0.9814 | 14 | 207 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A814HEM1-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) | 0.9809 | 23 | 165 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 |
| AF-A0A521N396-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) | 0.9799 | 14 | 209 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar