F467446

General Info

Members Datasets Scaffolds Average Seq Length
595 233 1190 167

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10195599|Ga0207678_101955992
Length 196
Sequence VAQTLQQAARDVESRHHASPHEKDDTHAMSEATDRLRQQLIRNFDDIEKTREERAPLYDTLCARLGRGTAATKLGISIDIVEPGKRGCPYHFHHAQEEAFVILEGAGTLRVAGEMLALKAGDTVFIPPGPAYPHQIVNTSDAPLKYLSIGTRDSPEIVEYPDSGKYLASATRDGEPDGFARMHREKDDLDYWDGEP

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
215 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
216 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
230 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
231 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
232 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
233 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 2.86
Rhizosphere 92.61
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10195599 3300026067 Bacteria 1728
2 MRS1b_contig_2065107 2162886011 Bacteria 2770
3 Ga0065712_10077711 3300005290 Bacteria 3453
4 Ga0065715_10350956 3300005293 Bacteria 951
5 Ga0070676_10011393 3300005328 Bacteria 4836
6 Ga0070676_10071865 3300005328 Bacteria 2079
7 Ga0070676_10163868 3300005328 Bacteria 1433
8 Ga0070690_100010461 3300005330 Bacteria 5401
9 Ga0070690_100252034 3300005330 Bacteria 1249
10 Ga0070690_101242182 3300005330 Unclassified 595
11 Ga0070670_100001648 3300005331 Bacteria 18088
12 Ga0070670_100051303 3300005331 Bacteria 3543
13 Ga0070670_100059182 3300005331 Bacteria 3288
14 Ga0070670_100063526 3300005331 Bacteria 3169
15 Ga0070670_100075271 3300005331 Bacteria 2901
16 Ga0070670_100126551 3300005331 Bacteria 2205
17 Ga0070670_100182282 3300005331 Bacteria 1823
18 Ga0070670_100457503 3300005331 Bacteria 1131
19 Ga0070677_10016635 3300005333 Bacteria 2621
20 Ga0070677_10022883 3300005333 Bacteria 2307
21 Ga0070677_10055548 3300005333 Bacteria 1617
22 Ga0070677_10089647 3300005333 Bacteria 1335
23 Ga0070677_10260067 3300005333 Unclassified 866
24 Ga0070677_10266116 3300005333 Bacteria 858
25 Ga0068869_100003668 3300005334 Bacteria 9438
26 Ga0068869_100042984 3300005334 Bacteria 3243
27 Ga0068869_100064599 3300005334 Bacteria 2692
28 Ga0068869_100071405 3300005334 Unclassified 2570
29 Ga0068869_100962306 3300005334 Bacteria 741
30 Ga0070666_10008685 3300005335 Bacteria 6318
31 Ga0070666_10095985 3300005335 Bacteria 2040
32 Ga0070666_10319600 3300005335 Bacteria 1107
33 Ga0070680_100020509 3300005336 Bacteria 5245
34 Ga0070680_100086474 3300005336 Unclassified 2591
35 Ga0070682_100156147 3300005337 Bacteria 1571
36 Ga0068868_100003589 3300005338 Bacteria 10810
37 Ga0068868_100011606 3300005338 Bacteria 6418
38 Ga0068868_100038490 3300005338 Bacteria 3712
39 Ga0068868_100106208 3300005338 Bacteria 2277
40 Ga0068868_100108345 3300005338 Bacteria 2255
41 Ga0068868_100799199 3300005338 Bacteria 851
42 Ga0070689_100040996 3300005340 Bacteria 3552
43 Ga0070689_100395448 3300005340 Bacteria 1167
44 Ga0070687_100079409 3300005343 Bacteria 1786
45 Ga0070687_100098088 3300005343 Bacteria 1635
46 Ga0070661_100204767 3300005344 Bacteria 1509
47 Ga0070661_100497369 3300005344 Bacteria 975
48 Ga0070692_10069562 3300005345 Bacteria 1872
49 Ga0070692_10228777 3300005345 Bacteria 1103
50 Ga0070668_100025536 3300005347 Bacteria 4480
51 Ga0070668_100034143 3300005347 Bacteria 3876
52 Ga0070668_100039003 3300005347 Bacteria 3633
53 Ga0070668_100580953 3300005347 Unclassified 978
54 Ga0070668_100838797 3300005347 Bacteria 818
55 Ga0070668_101045684 3300005347 Bacteria 735
56 Ga0070669_100043466 3300005353 Bacteria 3272
57 Ga0070669_100056261 3300005353 Bacteria 2884
58 Ga0070669_100080290 3300005353 Bacteria 2428
59 Ga0070669_100110558 3300005353 Bacteria 2085
60 Ga0070669_100318872 3300005353 Bacteria 1254
61 Ga0070675_100001993 3300005354 Bacteria 15148
62 Ga0070675_100019129 3300005354 Bacteria 5456
63 Ga0070675_100084496 3300005354 Bacteria 2651
64 Ga0070675_100094067 3300005354 Bacteria 2514
65 Ga0070675_100179384 3300005354 Bacteria 1830
66 Ga0070675_100345251 3300005354 Bacteria 1319
67 Ga0070675_100369788 3300005354 Unclassified 1274
68 Ga0070675_100807462 3300005354 Bacteria 858
69 Ga0070671_100010726 3300005355 Bacteria 7357
70 Ga0070671_100057874 3300005355 Bacteria 3226
71 Ga0070671_100128912 3300005355 Bacteria 2130
72 Ga0070671_100146408 3300005355 Bacteria 1994
73 Ga0070671_100326139 3300005355 Bacteria 1309
74 Ga0070671_100405470 3300005355 Bacteria 1166
75 Ga0070674_100015947 3300005356 Bacteria 4703
76 Ga0070674_100048445 3300005356 Bacteria 2916
77 Ga0070674_100439215 3300005356 Bacteria 1075
78 Ga0070674_100493429 3300005356 Bacteria 1018
79 Ga0070674_100614874 3300005356 Bacteria 920
80 Ga0070674_100670071 3300005356 Bacteria 884
81 Ga0070673_100036937 3300005364 Bacteria 3718
82 Ga0070673_100078466 3300005364 Bacteria 2671
83 Ga0070673_100142252 3300005364 Bacteria 2025
84 Ga0070673_100386113 3300005364 Bacteria 1249
85 Ga0070688_100043827 3300005365 Bacteria 2759
86 Ga0070688_100119990 3300005365 Bacteria 1760
87 Ga0070688_100890768 3300005365 Unclassified 701
88 Ga0070688_101429724 3300005365 Bacteria 561
89 Ga0070667_100045152 3300005367 Bacteria 3704
90 Ga0070667_100056668 3300005367 Bacteria 3311
91 Ga0070713_101535977 3300005436 Bacteria 646
92 Ga0070701_10037224 3300005438 Bacteria 2455
93 Ga0070701_11058960 3300005438 Bacteria 569
94 Ga0070700_100015051 3300005441 Bacteria 4379
95 Ga0070700_100027054 3300005441 Bacteria 3397
96 Ga0070700_100047283 3300005441 Bacteria 2662
97 Ga0070700_100224154 3300005441 Bacteria 1334
98 Ga0070694_100162290 3300005444 Bacteria 1641
99 Ga0070678_100023041 3300005456 Bacteria 4141
100 Ga0070678_100037562 3300005456 Bacteria 3402
101 Ga0070678_100050975 3300005456 Bacteria 2997
102 Ga0070678_100088756 3300005456 Bacteria 2365
103 Ga0070678_100141429 3300005456 Bacteria 1926
104 Ga0070678_100222896 3300005456 Bacteria 1568
105 Ga0070678_101070683 3300005456 Unclassified 743
106 Ga0070662_100052602 3300005457 Bacteria 2945
107 Ga0070662_100116483 3300005457 Bacteria 2042
108 Ga0070662_100235059 3300005457 Bacteria 1468
109 Ga0070662_100289393 3300005457 Bacteria 1328
110 Ga0068867_100000287 3300005459 Bacteria 33183
111 Ga0068867_100001624 3300005459 Bacteria 15631
112 Ga0068867_100003734 3300005459 Bacteria 10720
113 Ga0068867_100035530 3300005459 Bacteria 3615
114 Ga0068867_100084448 3300005459 Bacteria 2398
115 Ga0068867_100204557 3300005459 Bacteria 1582
116 Ga0068867_100233033 3300005459 Bacteria 1489
117 Ga0068867_100495258 3300005459 Bacteria 1049
118 Ga0070679_100014568 3300005530 Bacteria 7555
119 Ga0068853_100039021 3300005539 Bacteria 4049
120 Ga0068853_100237407 3300005539 Bacteria 1670
121 Ga0070672_100013405 3300005543 Bacteria 5790
122 Ga0070672_100025217 3300005543 Bacteria 4407
123 Ga0070672_100039549 3300005543 Bacteria 3613
124 Ga0070672_100059868 3300005543 Bacteria 2997
125 Ga0070672_100307095 3300005543 Bacteria 1346
126 Ga0070672_100411346 3300005543 Bacteria 1160
127 Ga0070686_100128511 3300005544 Bacteria 1749
128 Ga0070686_100886451 3300005544 Bacteria 725
129 Ga0070696_100305269 3300005546 Bacteria 1220
130 Ga0070693_100464276 3300005547 Unclassified 891
131 Ga0070665_100000057 3300005548 Bacteria 237271
132 Ga0070665_100695415 3300005548 Bacteria 1030
133 Ga0070665_100782939 3300005548 Bacteria 967
134 Ga0070704_100014989 3300005549 Bacteria 4855
135 Ga0070704_100200306 3300005549 Bacteria 1611
136 Ga0070704_100452848 3300005549 Bacteria 1105
137 Ga0070664_100082504 3300005564 Bacteria 2772
138 Ga0070664_100346929 3300005564 Bacteria 1349
139 Ga0068857_100010399 3300005577 Bacteria 8086
140 Ga0068857_100035609 3300005577 Bacteria 4408
141 Ga0068854_100017820 3300005578 Bacteria 4760
142 Ga0068854_100063969 3300005578 Bacteria 2672
143 Ga0068856_100118046 3300005614 Bacteria 2654
144 Ga0068856_100611058 3300005614 Bacteria 1111
145 Ga0068856_101235793 3300005614 Unclassified 763
146 Ga0068852_100268585 3300005616 Bacteria 1640
147 Ga0068852_100341639 3300005616 Bacteria 1459
148 Ga0068852_100354627 3300005616 Bacteria 1433
149 Ga0068852_100391975 3300005616 Bacteria 1364
150 Ga0068852_101307788 3300005616 Bacteria 747
151 Ga0068852_101935961 3300005616 Unclassified 612
152 Ga0068859_100001347 3300005617 Bacteria 25058
153 Ga0068859_100058573 3300005617 Bacteria 3880
154 Ga0068859_100071862 3300005617 Bacteria 3495
155 Ga0068859_100123077 3300005617 Bacteria 2661
156 Ga0068859_100336305 3300005617 Bacteria 1604
157 Ga0068864_100000875 3300005618 Bacteria 25325
158 Ga0068864_100001786 3300005618 Bacteria 17662
159 Ga0068864_100143724 3300005618 Bacteria 2154
160 Ga0068866_10428129 3300005718 Bacteria 860
161 Ga0068866_10623443 3300005718 Bacteria 731
162 Ga0068861_100002626 3300005719 Bacteria 11748
163 Ga0068861_100026650 3300005719 Bacteria 4204
164 Ga0068861_100035478 3300005719 Bacteria 3694
165 Ga0068861_100038700 3300005719 Bacteria 3555
166 Ga0068861_100374378 3300005719 Bacteria 1256
167 Ga0068861_100578203 3300005719 Bacteria 1028
168 Ga0068861_100744658 3300005719 Bacteria 915
169 Ga0068851_10418715 3300005834 Bacteria 791
170 Ga0068851_10419854 3300005834 Bacteria 790
171 Ga0068870_10018542 3300005840 Bacteria 3362
172 Ga0068870_10028160 3300005840 Bacteria 2818
173 Ga0068870_10094968 3300005840 Bacteria 1674
174 Ga0068863_100010010 3300005841 Bacteria 9229
175 Ga0068863_100096825 3300005841 Bacteria 2802
176 Ga0068863_100145228 3300005841 Bacteria 2269
177 Ga0068863_100432493 3300005841 Bacteria 1290
178 Ga0068863_100461036 3300005841 Bacteria 1248
179 Ga0068858_100000703 3300005842 Bacteria 34923
180 Ga0068858_100005298 3300005842 Bacteria 12648
181 Ga0068858_100032986 3300005842 Bacteria 4809
182 Ga0068860_100000444 3300005843 Bacteria 52273
183 Ga0068860_100006411 3300005843 Bacteria 11811
184 Ga0068860_100033660 3300005843 Bacteria 4916
185 Ga0068860_100250590 3300005843 Bacteria 1724
186 Ga0068862_100014589 3300005844 Bacteria 6524
187 Ga0068862_100034145 3300005844 Bacteria 4302
188 Ga0068862_100039645 3300005844 Bacteria 4001
189 Ga0068862_100077222 3300005844 Bacteria 2883
190 Ga0068862_100084701 3300005844 Bacteria 2754
191 Ga0068862_100229206 3300005844 Bacteria 1685
192 Ga0075363_100882699 3300006048 Bacteria 547
193 Ga0075362_10236462 3300006177 Bacteria 896
194 Ga0075362_10274302 3300006177 Bacteria 833
195 Ga0075366_10005457 3300006195 Bacteria 6892
196 Ga0075366_10007650 3300006195 Bacteria 5978
197 Ga0075366_10165761 3300006195 Bacteria 1340
198 Ga0097621_100030975 3300006237 Bacteria 4240
199 Ga0097621_100056786 3300006237 Bacteria 3199
200 Ga0097621_100191600 3300006237 Bacteria 1771
201 Ga0075370_10000101 3300006353 Bacteria 27175
202 Ga0068871_100069683 3300006358 Bacteria 2889
203 Ga0068871_100085908 3300006358 Bacteria 2614
204 Ga0068871_101108264 3300006358 Bacteria 740
205 Ga0068871_101142065 3300006358 Unclassified 729
206 Ga0075430_100054914 3300006846 Bacteria 3351
207 Ga0075429_100000167 3300006880 Bacteria 42008
208 Ga0075429_100833438 3300006880 Bacteria 807
209 Ga0068865_100024016 3300006881 Bacteria 3996
210 Ga0068865_100036143 3300006881 Bacteria 3328
211 Ga0068865_100087007 3300006881 Bacteria 2257
212 Ga0068865_100405394 3300006881 Bacteria 1117
213 Ga0068865_100654677 3300006881 Bacteria 893
214 Ga0068865_100907619 3300006881 Unclassified 766
215 Ga0097620_100001347 3300006931 Bacteria 25058
216 Ga0097620_100058574 3300006931 Bacteria 3880
217 Ga0097620_100071860 3300006931 Bacteria 3495
218 Ga0097620_100123070 3300006931 Bacteria 2661
219 Ga0097620_100336311 3300006931 Bacteria 1604
220 Ga0105251_10157782 3300009011 Bacteria 1023
221 Ga0105244_10000524 3300009036 Bacteria 34219
222 Ga0105240_10042602 3300009093 Bacteria 5784
223 Ga0105245_10092371 3300009098 Bacteria 2787
224 Ga0105245_10113978 3300009098 Bacteria 2518
225 Ga0105243_10053494 3300009148 Bacteria 3203
226 Ga0105243_10087344 3300009148 Bacteria 2559
227 Ga0105243_10106165 3300009148 Bacteria 2341
228 Ga0105243_10178976 3300009148 Bacteria 1843
229 Ga0105243_11010669 3300009148 Bacteria 835
230 Ga0105243_11043984 3300009148 Bacteria 822
231 Ga0105243_11160121 3300009148 Bacteria 784
232 Ga0105243_12186714 3300009148 Bacteria 590
233 Ga0105241_10091868 3300009174 Bacteria 2396
234 Ga0105242_10575409 3300009176 Bacteria 1084
235 Ga0105248_10001394 3300009177 Bacteria 26961
236 Ga0105248_10041242 3300009177 Bacteria 5174
237 Ga0105248_10152200 3300009177 Bacteria 2610
238 Ga0105248_11009375 3300009177 Unclassified 940
239 Ga0105237_10004793 3300009545 Bacteria 15541
240 Ga0105238_10162666 3300009551 Bacteria 2208
241 Ga0105249_10194660 3300009553 Bacteria 1981
242 Ga0105249_10243219 3300009553 Bacteria 1780
243 Ga0105249_10310991 3300009553 Unclassified 1584
244 Ga0105249_11413694 3300009553 Bacteria 768
245 Ga0105249_12331451 3300009553 Bacteria 608
246 Ga0105239_10011214 3300010375 Bacteria 10002
247 Ga0105246_10429536 3300011119 Bacteria 1105
248 Ga0157371_10501485 3300013102 Bacteria 896
249 Ga0157370_10606882 3300013104 Bacteria 1002
250 Ga0157374_10522035 3300013296 Bacteria 1193
251 Ga0157374_10603726 3300013296 Bacteria 1107
252 Ga0157378_10009382 3300013297 Bacteria 8525
253 Ga0157378_10021252 3300013297 Bacteria 5708
254 Ga0157378_10100983 3300013297 Bacteria 2635
255 Ga0157378_10365875 3300013297 Unclassified 1412
256 Ga0157378_10440836 3300013297 Bacteria 1291
257 Ga0157378_10555309 3300013297 Bacteria 1154
258 Ga0157378_10579406 3300013297 Bacteria 1131
259 Ga0163162_10149160 3300013306 Bacteria 2455
260 Ga0163162_10204736 3300013306 Bacteria 2102
261 Ga0163162_10232891 3300013306 Bacteria 1972
262 Ga0163162_10286195 3300013306 Bacteria 1780
263 Ga0157375_10023109 3300013308 Bacteria 5732
264 Ga0157375_10058566 3300013308 Bacteria 3812
265 Ga0157375_10217527 3300013308 Bacteria 2068
266 Ga0157375_10221332 3300013308 Bacteria 2051
267 Ga0157375_10434215 3300013308 Bacteria 1479
268 Ga0157375_10808427 3300013308 Bacteria 1086
269 Ga0157375_12033115 3300013308 Bacteria 683
270 Ga0157375_12099273 3300013308 Bacteria 672
271 Ga0163163_10005016 3300014325 Bacteria 11410
272 Ga0163163_10005258 3300014325 Bacteria 11165
273 Ga0163163_10090065 3300014325 Bacteria 3081
274 Ga0157380_10010895 3300014326 Bacteria 6555
275 Ga0157380_10193577 3300014326 Unclassified 1798
276 Ga0157380_10721186 3300014326 Bacteria 1005
277 Ga0157380_10950880 3300014326 Bacteria 889
278 Ga0157380_11374529 3300014326 Bacteria 756
279 Ga0157379_10022405 3300014968 Bacteria 5596
280 Ga0157379_10024232 3300014968 Bacteria 5386
281 Ga0157379_10026860 3300014968 Bacteria 5124
282 Ga0157379_10027535 3300014968 Bacteria 5061
283 Ga0157379_10189712 3300014968 Bacteria 1857
284 Ga0157379_10253060 3300014968 Bacteria 1599
285 Ga0157376_10165210 3300014969 Bacteria 2010
286 Ga0157376_11329697 3300014969 Bacteria 749
287 Ga0163161_10122126 3300017792 Bacteria 1958
288 Ga0163161_10229554 3300017792 Bacteria 1440
289 Ga0163161_10433732 3300017792 Bacteria 1059
290 Ga0163161_10524163 3300017792 Bacteria 968
291 Ga0213872_10000226 3300021361 Bacteria 49354
292 Ga0213872_10103650 3300021361 Bacteria 1267
293 Ga0213876_10161505 3300021384 Bacteria 1192
294 Ga0207697_10054641 3300025315 Bacteria 1655
295 Ga0207697_10186887 3300025315 Bacteria 909
296 Ga0207656_10036064 3300025321 Bacteria 2074
297 Ga0207656_10132202 3300025321 Bacteria 1170
298 Ga0207656_10435449 3300025321 Bacteria 662
299 Ga0207656_10438816 3300025321 Bacteria 659
300 Ga0207655_1011082 3300025728 Bacteria 5403
301 Ga0207682_10002043 3300025893 Bacteria 9135
302 Ga0207682_10101728 3300025893 Bacteria 1257
303 Ga0207682_10148943 3300025893 Bacteria 1054
304 Ga0207642_10434186 3300025899 Bacteria 792
305 Ga0207688_10281312 3300025901 Bacteria 1013
306 Ga0207688_10396640 3300025901 Bacteria 855
307 Ga0207680_10013624 3300025903 Bacteria 4184
308 Ga0207680_10069530 3300025903 Bacteria 2176
309 Ga0207680_10097814 3300025903 Bacteria 1880
310 Ga0207680_10417318 3300025903 Bacteria 950
311 Ga0207680_10492662 3300025903 Bacteria 872
312 Ga0207680_10766479 3300025903 Bacteria 692
313 Ga0207645_10004572 3300025907 Bacteria 10200
314 Ga0207645_10012351 3300025907 Bacteria 5796
315 Ga0207645_10063814 3300025907 Bacteria 2353
316 Ga0207645_10185217 3300025907 Unclassified 1367
317 Ga0207643_10007365 3300025908 Bacteria 5903
318 Ga0207643_10018110 3300025908 Bacteria 3859
319 Ga0207643_10131066 3300025908 Bacteria 1492
320 Ga0207705_10031234 3300025909 Bacteria 3800
321 Ga0207654_10158074 3300025911 Bacteria 1461
322 Ga0207695_10015782 3300025913 Bacteria 8874
323 Ga0207671_10004349 3300025914 Bacteria 13596
324 Ga0207662_10277306 3300025918 Bacteria 1108
325 Ga0207662_10556176 3300025918 Bacteria 795
326 Ga0207657_10838031 3300025919 Unclassified 710
327 Ga0207649_10346378 3300025920 Bacteria 1098
328 Ga0207649_10458600 3300025920 Bacteria 963
329 Ga0207652_10365566 3300025921 Bacteria 1302
330 Ga0207681_10007369 3300025923 Bacteria 6739
331 Ga0207681_10129868 3300025923 Bacteria 1861
332 Ga0207681_10275235 3300025923 Bacteria 1323
333 Ga0207681_10337149 3300025923 Bacteria 1203
334 Ga0207681_10342104 3300025923 Bacteria 1195
335 Ga0207694_10161994 3300025924 Bacteria 1807
336 Ga0207650_10021208 3300025925 Bacteria 4593
337 Ga0207650_10031984 3300025925 Bacteria 3804
338 Ga0207650_10033725 3300025925 Bacteria 3709
339 Ga0207650_10228028 3300025925 Bacteria 1501
340 Ga0207650_10500660 3300025925 Bacteria 1015
341 Ga0207659_10001268 3300025926 Bacteria 15123
342 Ga0207659_10004326 3300025926 Bacteria 8584
343 Ga0207659_10047812 3300025926 Bacteria 3027
344 Ga0207659_10059678 3300025926 Bacteria 2743
345 Ga0207659_10254394 3300025926 Bacteria 1426
346 Ga0207659_10273287 3300025926 Bacteria 1379
347 Ga0207659_10446576 3300025926 Bacteria 1088
348 Ga0207659_10781803 3300025926 Bacteria 820
349 Ga0207659_11129557 3300025926 Bacteria 674
350 Ga0207687_10402933 3300025927 Bacteria 1125
351 Ga0207644_10019021 3300025931 Bacteria 4656
352 Ga0207644_10034224 3300025931 Bacteria 3554
353 Ga0207644_10104590 3300025931 Bacteria 2131
354 Ga0207644_10329227 3300025931 Bacteria 1237
355 Ga0207644_10450584 3300025931 Bacteria 1057
356 Ga0207690_10253355 3300025932 Bacteria 1361
357 Ga0207706_10019724 3300025933 Bacteria 6065
358 Ga0207706_10322937 3300025933 Bacteria 1343
359 Ga0207706_10346997 3300025933 Unclassified 1291
360 Ga0207706_10399553 3300025933 Bacteria 1191
361 Ga0207686_11348856 3300025934 Bacteria 586
362 Ga0207709_10046706 3300025935 Bacteria 2629
363 Ga0207709_10061287 3300025935 Bacteria 2350
364 Ga0207709_10626749 3300025935 Bacteria 854
365 Ga0207709_10851520 3300025935 Bacteria 739
366 Ga0207670_10030788 3300025936 Bacteria 3430
367 Ga0207670_10617906 3300025936 Unclassified 891
368 Ga0207669_10012050 3300025937 Bacteria 4236
369 Ga0207669_10088737 3300025937 Unclassified 2006
370 Ga0207669_10203135 3300025937 Bacteria 1440
371 Ga0207669_10327058 3300025937 Bacteria 1176
372 Ga0207669_10576659 3300025937 Bacteria 911
373 Ga0207669_10782513 3300025937 Bacteria 790
374 Ga0207669_10815839 3300025937 Bacteria 774
375 Ga0207704_10011976 3300025938 Bacteria 4290
376 Ga0207704_10020231 3300025938 Bacteria 3516
377 Ga0207704_10135424 3300025938 Bacteria 1713
378 Ga0207704_10192055 3300025938 Bacteria 1486
379 Ga0207704_10402770 3300025938 Bacteria 1080
380 Ga0207704_10427360 3300025938 Bacteria 1052
381 Ga0207691_10007485 3300025940 Bacteria 10510
382 Ga0207691_10031941 3300025940 Bacteria 4913
383 Ga0207691_10036482 3300025940 Bacteria 4555
384 Ga0207691_10097071 3300025940 Bacteria 2634
385 Ga0207691_10291174 3300025940 Bacteria 1404
386 Ga0207711_10083057 3300025941 Bacteria 2801
387 Ga0207711_10090998 3300025941 Bacteria 2683
388 Ga0207689_10000251 3300025942 Bacteria 48161
389 Ga0207689_10016111 3300025942 Bacteria 6328
390 Ga0207689_10019637 3300025942 Bacteria 5695
391 Ga0207689_10019801 3300025942 Bacteria 5668
392 Ga0207689_10522731 3300025942 Bacteria 995
393 Ga0207679_10107671 3300025945 Bacteria 2194
394 Ga0207679_10263264 3300025945 Bacteria 1472
395 Ga0207679_10707355 3300025945 Bacteria 915
396 Ga0207651_10005606 3300025960 Bacteria 6465
397 Ga0207651_10078593 3300025960 Bacteria 2367
398 Ga0207651_10134222 3300025960 Bacteria 1900
399 Ga0207651_10356607 3300025960 Bacteria 1233
400 Ga0207712_10120150 3300025961 Bacteria 1987
401 Ga0207712_10196006 3300025961 Bacteria 1598
402 Ga0207712_10333439 3300025961 Unclassified 1255
403 Ga0207712_10779506 3300025961 Bacteria 839
404 Ga0207712_10992588 3300025961 Bacteria 745
405 Ga0207668_10033237 3300025972 Bacteria 3415
406 Ga0207668_10360603 3300025972 Bacteria 1218
407 Ga0207668_10688868 3300025972 Bacteria 897
408 Ga0207640_10057614 3300025981 Bacteria 2556
409 Ga0207640_10420292 3300025981 Bacteria 1094
410 Ga0207658_10065840 3300025986 Bacteria 2723
411 Ga0207658_10430919 3300025986 Bacteria 1164
412 Ga0207658_10904306 3300025986 Bacteria 804
413 Ga0207677_10006608 3300026023 Bacteria 6361
414 Ga0207677_10343884 3300026023 Bacteria 1247
415 Ga0207677_10691374 3300026023 Bacteria 904
416 Ga0207677_10994697 3300026023 Bacteria 760
417 Ga0207703_10001771 3300026035 Bacteria 19284
418 Ga0207703_10008624 3300026035 Bacteria 8044
419 Ga0207703_10016069 3300026035 Bacteria 5838
420 Ga0207639_10035082 3300026041 Bacteria 3711
421 Ga0207639_10795315 3300026041 Bacteria 881
422 Ga0207678_10028904 3300026067 Bacteria 4839
423 Ga0207708_10015649 3300026075 Bacteria 5690
424 Ga0207708_10021379 3300026075 Bacteria 4879
425 Ga0207708_10044190 3300026075 Bacteria 3394
426 Ga0207708_10384240 3300026075 Bacteria 1158
427 Ga0207702_10100408 3300026078 Bacteria 2553
428 Ga0207702_10488127 3300026078 Bacteria 1199
429 Ga0207641_10035303 3300026088 Bacteria 4164
430 Ga0207641_10094728 3300026088 Bacteria 2619
431 Ga0207641_10331606 3300026088 Bacteria 1445
432 Ga0207648_10000283 3300026089 Bacteria 55253
433 Ga0207648_10001012 3300026089 Bacteria 31652
434 Ga0207648_10001802 3300026089 Bacteria 23480
435 Ga0207648_10035596 3300026089 Bacteria 4386
436 Ga0207648_10042712 3300026089 Bacteria 3980
437 Ga0207648_10067106 3300026089 Bacteria 3128
438 Ga0207648_10093044 3300026089 Bacteria 2636
439 Ga0207648_10187936 3300026089 Bacteria 1830
440 Ga0207648_10253026 3300026089 Bacteria 1571
441 Ga0207648_10905130 3300026089 Bacteria 824
442 Ga0207648_11047925 3300026089 Bacteria 764
443 Ga0207676_10009583 3300026095 Bacteria 6894
444 Ga0207676_10028034 3300026095 Bacteria 4202
445 Ga0207676_10096496 3300026095 Bacteria 2440
446 Ga0207676_10151937 3300026095 Bacteria 1995
447 Ga0207676_10270482 3300026095 Bacteria 1539
448 Ga0207676_10402523 3300026095 Bacteria 1279
449 Ga0207676_10451946 3300026095 Unclassified 1211
450 Ga0207676_11073573 3300026095 Unclassified 795
451 Ga0207674_10002494 3300026116 Bacteria 23211
452 Ga0207674_10045796 3300026116 Bacteria 4496
453 Ga0207675_100001457 3300026118 Bacteria 23724
454 Ga0207675_100031990 3300026118 Bacteria 4901
455 Ga0207675_100036426 3300026118 Bacteria 4589
456 Ga0207675_100058158 3300026118 Bacteria 3608
457 Ga0207675_100099102 3300026118 Bacteria 2745
458 Ga0207675_100437261 3300026118 Bacteria 1294
459 Ga0207675_101020274 3300026118 Bacteria 846
460 Ga0207683_10002307 3300026121 Bacteria 16733
461 Ga0207683_10011956 3300026121 Bacteria 7409
462 Ga0207683_10122748 3300026121 Bacteria 2333
463 Ga0207683_10160593 3300026121 Bacteria 2031
464 Ga0207683_10263685 3300026121 Bacteria 1573
465 Ga0207683_10432576 3300026121 Bacteria 1212
466 Ga0207698_10017398 3300026142 Bacteria 4875
467 Ga0207698_10343628 3300026142 Bacteria 1407
468 Ga0207698_10352668 3300026142 Bacteria 1390
469 Ga0268266_10000001 3300028379 Bacteria 4040580
470 Ga0268265_10096950 3300028380 Bacteria 2371
471 Ga0268265_10182959 3300028380 Bacteria 1802
472 Ga0268265_10590381 3300028380 Bacteria 1060
473 Ga0268265_10827446 3300028380 Bacteria 904
474 Ga0268265_11654871 3300028380 Unclassified 645
475 Ga0268264_10001973 3300028381 Bacteria 18439
476 Ga0268264_10085622 3300028381 Bacteria 2705
477 Ga0268264_10134322 3300028381 Bacteria 2198
478 Ga0268264_10163212 3300028381 Bacteria 2009
479 Ga0307513_10437985 3300031456 Bacteria 1034
480 Ga0307516_10001054 3300031730 Bacteria 38370
481 Ga0307405_10023769 3300031731 Bacteria 3489
482 Ga0307405_10858018 3300031731 Bacteria 765
483 Ga0307410_10364417 3300031852 Bacteria 1158
484 Ga0307410_11172271 3300031852 Bacteria 668
485 Ga0307406_10016209 3300031901 Bacteria 4326
486 Ga0307406_10547154 3300031901 Bacteria 946
487 Ga0307407_10057875 3300031903 Bacteria 2251
488 Ga0307412_10157227 3300031911 Bacteria 1684
489 Ga0307412_10404040 3300031911 Bacteria 1113
490 Ga0307412_10702469 3300031911 Bacteria 868
491 Ga0307409_100037258 3300031995 Bacteria 3584
492 Ga0307409_101205928 3300031995 Bacteria 780
493 Ga0307416_100002702 3300032002 Bacteria 10275
494 Ga0307416_100263450 3300032002 Bacteria 1686
495 Ga0307416_100999023 3300032002 Bacteria 940
496 Ga0307411_10062148 3300032005 Bacteria 2490
497 Ga0307411_10757608 3300032005 Bacteria 851
498 Ga0307415_100010508 3300032126 Bacteria 5247
499 Ga0307510_10131290 3300033180 Bacteria 2177
500 Ga0373934_0272459 3300035086 Bacteria 701
501 Ga0373954_0338225 3300035118 Bacteria 743
502 Ga0373957_0055035 3300035120 Bacteria 1529
503 Ga0373946_0131685 3300035171 Bacteria 1151
504 Ga0373924_0011440 3300035410 Bacteria 3296
505 Ga0373933_0046455 3300035724 Bacteria 2579
506 Ga0373947_0129398 3300035725 Bacteria 1610
507 Ga0373925_0045095 3300037068 Bacteria 3275
508 Ga0436365_0361177 3300039437 Bacteria 4074
509 Ga0436365_1316352 3300039437 Unclassified 655
510 Ga0436360_1231071 3300039438 Bacteria 818
511 Ga0436361_0096676 3300039447 Bacteria 32751
512 Ga0436361_0116244 3300039447 Bacteria 917
513 Ga0436361_1137198 3300039447 Unclassified 1219
514 Ga0436363_0190589 3300039450 Bacteria 1557
515 Ga0436363_0794536 3300039450 Bacteria 2406
516 Ga0439441_053273 3300042001 Bacteria 838
517 Ga0439450_024317 3300042008 Bacteria 1320
518 Ga0439464_0039100 3300042439 Bacteria 1348
519 Ga0439460_0025519 3300042461 Bacteria 1646
520 Ga0451577_0230017 3300042876 Bacteria 1677
521 Ga0453684_0131908 3300044712 Bacteria 2997
522 Ga0453684_1594602 3300044712 Unclassified 670
523 Ga0495629_0141305 3300046459 Bacteria 1675
524 Ga0495629_0204716 3300046459 Bacteria 1364
525 Ga0495638_0026480 3300046460 Bacteria 3758
526 Ga0495650_0003313 3300046471 Bacteria 11881
527 Ga0495584_0031674 3300046491 Bacteria 2676
528 Ga0495607_0023142 3300046501 Bacteria 3891
529 Ga0495606_0009733 3300046507 Bacteria 8087
530 Ga0495616_0000279 3300046513 Bacteria 41349
531 Ga0495620_0000313 3300046515 Bacteria 34533
532 Ga0495620_0045960 3300046515 Bacteria 1888
533 Ga0495620_0057337 3300046515 Bacteria 1635
534 Ga0495632_0013756 3300046519 Bacteria 4604
535 Ga0495632_0055239 3300046519 Bacteria 1944
536 Ga0495637_0000323 3300046520 Bacteria 37103
537 Ga0495643_0002133 3300046522 Bacteria 16304
538 Ga0495646_0267005 3300046680 Bacteria 913
539 Ga0495647_0056593 3300046681 Bacteria 1538
540 Ga0495647_0145652 3300046681 Bacteria 1013
541 Ga0495658_0024043 3300046683 Bacteria 3240
542 Ga0495658_0269965 3300046683 Bacteria 1072
543 Ga0495670_0237073 3300046691 Bacteria 971
544 Ga0495649_0012894 3300046694 Bacteria 4841
545 Ga0495660_0013062 3300046810 Bacteria 4814
546 Ga0495672_0005553 3300047320 Bacteria 9977
547 Ga0495683_0179073 3300047323 Bacteria 969
548 Ga0495675_0470710 3300047444 Bacteria 725
549 Ga0495673_0000328 3300047469 Bacteria 61350
550 Ga0495673_0001043 3300047469 Bacteria 24417
551 Ga0495681_0012536 3300047470 Bacteria 4975
552 Ga0495686_0003640 3300047472 Bacteria 13199
553 Ga0495686_0357739 3300047472 Bacteria 792
554 Ga0495626_0001311 3300048091 Bacteria 20243
555 Ga0496101_0679234 3300048904 Bacteria 813
556 Ga0496104_0182487 3300048907 Bacteria 2009
557 Ga0496104_0297480 3300048907 Bacteria 1526
558 Ga0496105_0020021 3300048908 Bacteria 5401
559 Ga0496107_0517345 3300048910 Bacteria 885
560 Ga0496108_0298480 3300048911 Bacteria 1403
561 Ga0496108_0586201 3300048911 Unclassified 972
562 Ga0496108_0838748 3300048911 Bacteria 791
563 Ga0496109_0182361 3300048912 Bacteria 1972
564 Ga0496109_0845437 3300048912 Unclassified 853
565 Ga0496110_0203931 3300048913 Bacteria 1797
566 Ga0496110_0416825 3300048913 Bacteria 1224
567 Ga0496111_0414705 3300048914 Bacteria 995
568 Ga0496112_0091742 3300048915 Bacteria 3006
569 Ga0496113_0387688 3300048916 Bacteria 1121
570 Ga0496114_0029841 3300048917 Bacteria 4483
571 Ga0496124_0129642 3300048927 Bacteria 2005
572 Ga0495678_002335 3300049459 Bacteria 13049
573 Ga0501292_006802 3300049515 Bacteria 1636
574 Ga0501294_006021 3300049517 Bacteria 1156
575 Ga0501303_000929 3300049526 Bacteria 2188
576 Ga0501206_042341 3300049653 Bacteria 705
577 Ga0501223_102609 3300049663 Bacteria 591
578 Ga0501265_007515 3300049762 Bacteria 1285
579 nmdc:mga03683_141356_c1 3300050489 Bacteria 1082
580 nmdc:mga03n38_606670_c1 3300050490 Bacteria 624
581 nmdc:mga0k408_202817_c1 3300050493 Bacteria 1184
582 nmdc:mga0k408_79881_c1 3300050493 Bacteria 1914
583 nmdc:mga07m45_317_c1 3300050496 Bacteria 19459
584 nmdc:mga07m45_371066_c1 3300050496 Bacteria 831
585 nmdc:mga09592_1007_c1 3300050508 Bacteria 22372
586 nmdc:mga0qj67_212074_c1 3300050509 Bacteria 1573
587 Ga0495612_0023758 3300053078 Bacteria 2461
588 Ga0495595_0025582 3300053084 Bacteria 2617
589 Ga0500578_0025843 3300053086 Bacteria 3767
590 Ga0500645_002232 3300053730 Bacteria 8833
591 2587757800 2585428062 Bacteria 6842168
592 2599326476 2599185155 Bacteria 5827168
593 2826583452 2826581358 Bacteria 5963467
594 2842817223 2842815866 Bacteria 5947510
595 2842850296 2842849001 Bacteria 5924277
596 Ga0207678_10195599
597 MRS1b_contig_2065107
598 Ga0065712_10077711
599 Ga0065715_10350956
600 Ga0070676_10011393
601 Ga0070676_10071865
602 Ga0070676_10163868
603 Ga0070690_100010461
604 Ga0070690_100252034
605 Ga0070690_101242182
606 Ga0070670_100001648
607 Ga0070670_100051303
608 Ga0070670_100059182
609 Ga0070670_100063526
610 Ga0070670_100075271
611 Ga0070670_100126551
612 Ga0070670_100182282
613 Ga0070670_100457503
614 Ga0070677_10016635
615 Ga0070677_10022883
616 Ga0070677_10055548
617 Ga0070677_10089647
618 Ga0070677_10260067
619 Ga0070677_10266116
620 Ga0068869_100003668
621 Ga0068869_100042984
622 Ga0068869_100064599
623 Ga0068869_100071405
624 Ga0068869_100962306
625 Ga0070666_10008685
626 Ga0070666_10095985
627 Ga0070666_10319600
628 Ga0070680_100020509
629 Ga0070680_100086474
630 Ga0070682_100156147
631 Ga0068868_100003589
632 Ga0068868_100011606
633 Ga0068868_100038490
634 Ga0068868_100106208
635 Ga0068868_100108345
636 Ga0068868_100799199
637 Ga0070689_100040996
638 Ga0070689_100395448
639 Ga0070687_100079409
640 Ga0070687_100098088
641 Ga0070661_100204767
642 Ga0070661_100497369
643 Ga0070692_10069562
644 Ga0070692_10228777
645 Ga0070668_100025536
646 Ga0070668_100034143
647 Ga0070668_100039003
648 Ga0070668_100580953
649 Ga0070668_100838797
650 Ga0070668_101045684
651 Ga0070669_100043466
652 Ga0070669_100056261
653 Ga0070669_100080290
654 Ga0070669_100110558
655 Ga0070669_100318872
656 Ga0070675_100001993
657 Ga0070675_100019129
658 Ga0070675_100084496
659 Ga0070675_100094067
660 Ga0070675_100179384
661 Ga0070675_100345251
662 Ga0070675_100369788
663 Ga0070675_100807462
664 Ga0070671_100010726
665 Ga0070671_100057874
666 Ga0070671_100128912
667 Ga0070671_100146408
668 Ga0070671_100326139
669 Ga0070671_100405470
670 Ga0070674_100015947
671 Ga0070674_100048445
672 Ga0070674_100439215
673 Ga0070674_100493429
674 Ga0070674_100614874
675 Ga0070674_100670071
676 Ga0070673_100036937
677 Ga0070673_100078466
678 Ga0070673_100142252
679 Ga0070673_100386113
680 Ga0070688_100043827
681 Ga0070688_100119990
682 Ga0070688_100890768
683 Ga0070688_101429724
684 Ga0070667_100045152
685 Ga0070667_100056668
686 Ga0070713_101535977
687 Ga0070701_10037224
688 Ga0070701_11058960
689 Ga0070700_100015051
690 Ga0070700_100027054
691 Ga0070700_100047283
692 Ga0070700_100224154
693 Ga0070694_100162290
694 Ga0070678_100023041
695 Ga0070678_100037562
696 Ga0070678_100050975
697 Ga0070678_100088756
698 Ga0070678_100141429
699 Ga0070678_100222896
700 Ga0070678_101070683
701 Ga0070662_100052602
702 Ga0070662_100116483
703 Ga0070662_100235059
704 Ga0070662_100289393
705 Ga0068867_100000287
706 Ga0068867_100001624
707 Ga0068867_100003734
708 Ga0068867_100035530
709 Ga0068867_100084448
710 Ga0068867_100204557
711 Ga0068867_100233033
712 Ga0068867_100495258
713 Ga0070679_100014568
714 Ga0068853_100039021
715 Ga0068853_100237407
716 Ga0070672_100013405
717 Ga0070672_100025217
718 Ga0070672_100039549
719 Ga0070672_100059868
720 Ga0070672_100307095
721 Ga0070672_100411346
722 Ga0070686_100128511
723 Ga0070686_100886451
724 Ga0070696_100305269
725 Ga0070693_100464276
726 Ga0070665_100000057
727 Ga0070665_100695415
728 Ga0070665_100782939
729 Ga0070704_100014989
730 Ga0070704_100200306
731 Ga0070704_100452848
732 Ga0070664_100082504
733 Ga0070664_100346929
734 Ga0068857_100010399
735 Ga0068857_100035609
736 Ga0068854_100017820
737 Ga0068854_100063969
738 Ga0068856_100118046
739 Ga0068856_100611058
740 Ga0068856_101235793
741 Ga0068852_100268585
742 Ga0068852_100341639
743 Ga0068852_100354627
744 Ga0068852_100391975
745 Ga0068852_101307788
746 Ga0068852_101935961
747 Ga0068859_100001347
748 Ga0068859_100058573
749 Ga0068859_100071862
750 Ga0068859_100123077
751 Ga0068859_100336305
752 Ga0068864_100000875
753 Ga0068864_100001786
754 Ga0068864_100143724
755 Ga0068866_10428129
756 Ga0068866_10623443
757 Ga0068861_100002626
758 Ga0068861_100026650
759 Ga0068861_100035478
760 Ga0068861_100038700
761 Ga0068861_100374378
762 Ga0068861_100578203
763 Ga0068861_100744658
764 Ga0068851_10418715
765 Ga0068851_10419854
766 Ga0068870_10018542
767 Ga0068870_10028160
768 Ga0068870_10094968
769 Ga0068863_100010010
770 Ga0068863_100096825
771 Ga0068863_100145228
772 Ga0068863_100432493
773 Ga0068863_100461036
774 Ga0068858_100000703
775 Ga0068858_100005298
776 Ga0068858_100032986
777 Ga0068860_100000444
778 Ga0068860_100006411
779 Ga0068860_100033660
780 Ga0068860_100250590
781 Ga0068862_100014589
782 Ga0068862_100034145
783 Ga0068862_100039645
784 Ga0068862_100077222
785 Ga0068862_100084701
786 Ga0068862_100229206
787 Ga0075363_100882699
788 Ga0075362_10236462
789 Ga0075362_10274302
790 Ga0075366_10005457
791 Ga0075366_10007650
792 Ga0075366_10165761
793 Ga0097621_100030975
794 Ga0097621_100056786
795 Ga0097621_100191600
796 Ga0075370_10000101
797 Ga0068871_100069683
798 Ga0068871_100085908
799 Ga0068871_101108264
800 Ga0068871_101142065
801 Ga0075430_100054914
802 Ga0075429_100000167
803 Ga0075429_100833438
804 Ga0068865_100024016
805 Ga0068865_100036143
806 Ga0068865_100087007
807 Ga0068865_100405394
808 Ga0068865_100654677
809 Ga0068865_100907619
810 Ga0097620_100001347
811 Ga0097620_100058574
812 Ga0097620_100071860
813 Ga0097620_100123070
814 Ga0097620_100336311
815 Ga0105251_10157782
816 Ga0105244_10000524
817 Ga0105240_10042602
818 Ga0105245_10092371
819 Ga0105245_10113978
820 Ga0105243_10053494
821 Ga0105243_10087344
822 Ga0105243_10106165
823 Ga0105243_10178976
824 Ga0105243_11010669
825 Ga0105243_11043984
826 Ga0105243_11160121
827 Ga0105243_12186714
828 Ga0105241_10091868
829 Ga0105242_10575409
830 Ga0105248_10001394
831 Ga0105248_10041242
832 Ga0105248_10152200
833 Ga0105248_11009375
834 Ga0105237_10004793
835 Ga0105238_10162666
836 Ga0105249_10194660
837 Ga0105249_10243219
838 Ga0105249_10310991
839 Ga0105249_11413694
840 Ga0105249_12331451
841 Ga0105239_10011214
842 Ga0105246_10429536
843 Ga0157371_10501485
844 Ga0157370_10606882
845 Ga0157374_10522035
846 Ga0157374_10603726
847 Ga0157378_10009382
848 Ga0157378_10021252
849 Ga0157378_10100983
850 Ga0157378_10365875
851 Ga0157378_10440836
852 Ga0157378_10555309
853 Ga0157378_10579406
854 Ga0163162_10149160
855 Ga0163162_10204736
856 Ga0163162_10232891
857 Ga0163162_10286195
858 Ga0157375_10023109
859 Ga0157375_10058566
860 Ga0157375_10217527
861 Ga0157375_10221332
862 Ga0157375_10434215
863 Ga0157375_10808427
864 Ga0157375_12033115
865 Ga0157375_12099273
866 Ga0163163_10005016
867 Ga0163163_10005258
868 Ga0163163_10090065
869 Ga0157380_10010895
870 Ga0157380_10193577
871 Ga0157380_10721186
872 Ga0157380_10950880
873 Ga0157380_11374529
874 Ga0157379_10022405
875 Ga0157379_10024232
876 Ga0157379_10026860
877 Ga0157379_10027535
878 Ga0157379_10189712
879 Ga0157379_10253060
880 Ga0157376_10165210
881 Ga0157376_11329697
882 Ga0163161_10122126
883 Ga0163161_10229554
884 Ga0163161_10433732
885 Ga0163161_10524163
886 Ga0213872_10000226
887 Ga0213872_10103650
888 Ga0213876_10161505
889 Ga0207697_10054641
890 Ga0207697_10186887
891 Ga0207656_10036064
892 Ga0207656_10132202
893 Ga0207656_10435449
894 Ga0207656_10438816
895 Ga0207655_1011082
896 Ga0207682_10002043
897 Ga0207682_10101728
898 Ga0207682_10148943
899 Ga0207642_10434186
900 Ga0207688_10281312
901 Ga0207688_10396640
902 Ga0207680_10013624
903 Ga0207680_10069530
904 Ga0207680_10097814
905 Ga0207680_10417318
906 Ga0207680_10492662
907 Ga0207680_10766479
908 Ga0207645_10004572
909 Ga0207645_10012351
910 Ga0207645_10063814
911 Ga0207645_10185217
912 Ga0207643_10007365
913 Ga0207643_10018110
914 Ga0207643_10131066
915 Ga0207705_10031234
916 Ga0207654_10158074
917 Ga0207695_10015782
918 Ga0207671_10004349
919 Ga0207662_10277306
920 Ga0207662_10556176
921 Ga0207657_10838031
922 Ga0207649_10346378
923 Ga0207649_10458600
924 Ga0207652_10365566
925 Ga0207681_10007369
926 Ga0207681_10129868
927 Ga0207681_10275235
928 Ga0207681_10337149
929 Ga0207681_10342104
930 Ga0207694_10161994
931 Ga0207650_10021208
932 Ga0207650_10031984
933 Ga0207650_10033725
934 Ga0207650_10228028
935 Ga0207650_10500660
936 Ga0207659_10001268
937 Ga0207659_10004326
938 Ga0207659_10047812
939 Ga0207659_10059678
940 Ga0207659_10254394
941 Ga0207659_10273287
942 Ga0207659_10446576
943 Ga0207659_10781803
944 Ga0207659_11129557
945 Ga0207687_10402933
946 Ga0207644_10019021
947 Ga0207644_10034224
948 Ga0207644_10104590
949 Ga0207644_10329227
950 Ga0207644_10450584
951 Ga0207690_10253355
952 Ga0207706_10019724
953 Ga0207706_10322937
954 Ga0207706_10346997
955 Ga0207706_10399553
956 Ga0207686_11348856
957 Ga0207709_10046706
958 Ga0207709_10061287
959 Ga0207709_10626749
960 Ga0207709_10851520
961 Ga0207670_10030788
962 Ga0207670_10617906
963 Ga0207669_10012050
964 Ga0207669_10088737
965 Ga0207669_10203135
966 Ga0207669_10327058
967 Ga0207669_10576659
968 Ga0207669_10782513
969 Ga0207669_10815839
970 Ga0207704_10011976
971 Ga0207704_10020231
972 Ga0207704_10135424
973 Ga0207704_10192055
974 Ga0207704_10402770
975 Ga0207704_10427360
976 Ga0207691_10007485
977 Ga0207691_10031941
978 Ga0207691_10036482
979 Ga0207691_10097071
980 Ga0207691_10291174
981 Ga0207711_10083057
982 Ga0207711_10090998
983 Ga0207689_10000251
984 Ga0207689_10016111
985 Ga0207689_10019637
986 Ga0207689_10019801
987 Ga0207689_10522731
988 Ga0207679_10107671
989 Ga0207679_10263264
990 Ga0207679_10707355
991 Ga0207651_10005606
992 Ga0207651_10078593
993 Ga0207651_10134222
994 Ga0207651_10356607
995 Ga0207712_10120150
996 Ga0207712_10196006
997 Ga0207712_10333439
998 Ga0207712_10779506
999 Ga0207712_10992588
1000 Ga0207668_10033237
1001 Ga0207668_10360603
1002 Ga0207668_10688868
1003 Ga0207640_10057614
1004 Ga0207640_10420292
1005 Ga0207658_10065840
1006 Ga0207658_10430919
1007 Ga0207658_10904306
1008 Ga0207677_10006608
1009 Ga0207677_10343884
1010 Ga0207677_10691374
1011 Ga0207677_10994697
1012 Ga0207703_10001771
1013 Ga0207703_10008624
1014 Ga0207703_10016069
1015 Ga0207639_10035082
1016 Ga0207639_10795315
1017 Ga0207678_10028904
1018 Ga0207708_10015649
1019 Ga0207708_10021379
1020 Ga0207708_10044190
1021 Ga0207708_10384240
1022 Ga0207702_10100408
1023 Ga0207702_10488127
1024 Ga0207641_10035303
1025 Ga0207641_10094728
1026 Ga0207641_10331606
1027 Ga0207648_10000283
1028 Ga0207648_10001012
1029 Ga0207648_10001802
1030 Ga0207648_10035596
1031 Ga0207648_10042712
1032 Ga0207648_10067106
1033 Ga0207648_10093044
1034 Ga0207648_10187936
1035 Ga0207648_10253026
1036 Ga0207648_10905130
1037 Ga0207648_11047925
1038 Ga0207676_10009583
1039 Ga0207676_10028034
1040 Ga0207676_10096496
1041 Ga0207676_10151937
1042 Ga0207676_10270482
1043 Ga0207676_10402523
1044 Ga0207676_10451946
1045 Ga0207676_11073573
1046 Ga0207674_10002494
1047 Ga0207674_10045796
1048 Ga0207675_100001457
1049 Ga0207675_100031990
1050 Ga0207675_100036426
1051 Ga0207675_100058158
1052 Ga0207675_100099102
1053 Ga0207675_100437261
1054 Ga0207675_101020274
1055 Ga0207683_10002307
1056 Ga0207683_10011956
1057 Ga0207683_10122748
1058 Ga0207683_10160593
1059 Ga0207683_10263685
1060 Ga0207683_10432576
1061 Ga0207698_10017398
1062 Ga0207698_10343628
1063 Ga0207698_10352668
1064 Ga0268266_10000001
1065 Ga0268265_10096950
1066 Ga0268265_10182959
1067 Ga0268265_10590381
1068 Ga0268265_10827446
1069 Ga0268265_11654871
1070 Ga0268264_10001973
1071 Ga0268264_10085622
1072 Ga0268264_10134322
1073 Ga0268264_10163212
1074 Ga0307513_10437985
1075 Ga0307516_10001054
1076 Ga0307405_10023769
1077 Ga0307405_10858018
1078 Ga0307410_10364417
1079 Ga0307410_11172271
1080 Ga0307406_10016209
1081 Ga0307406_10547154
1082 Ga0307407_10057875
1083 Ga0307412_10157227
1084 Ga0307412_10404040
1085 Ga0307412_10702469
1086 Ga0307409_100037258
1087 Ga0307409_101205928
1088 Ga0307416_100002702
1089 Ga0307416_100263450
1090 Ga0307416_100999023
1091 Ga0307411_10062148
1092 Ga0307411_10757608
1093 Ga0307415_100010508
1094 Ga0307510_10131290
1095 Ga0373934_0272459
1096 Ga0373954_0338225
1097 Ga0373957_0055035
1098 Ga0373946_0131685
1099 Ga0373924_0011440
1100 Ga0373933_0046455
1101 Ga0373947_0129398
1102 Ga0373925_0045095
1103 Ga0436365_0361177
1104 Ga0436365_1316352
1105 Ga0436360_1231071
1106 Ga0436361_0096676
1107 Ga0436361_0116244
1108 Ga0436361_1137198
1109 Ga0436363_0190589
1110 Ga0436363_0794536
1111 Ga0439441_053273
1112 Ga0439450_024317
1113 Ga0439464_0039100
1114 Ga0439460_0025519
1115 Ga0451577_0230017
1116 Ga0453684_0131908
1117 Ga0453684_1594602
1118 Ga0495629_0141305
1119 Ga0495629_0204716
1120 Ga0495638_0026480
1121 Ga0495650_0003313
1122 Ga0495584_0031674
1123 Ga0495607_0023142
1124 Ga0495606_0009733
1125 Ga0495616_0000279
1126 Ga0495620_0000313
1127 Ga0495620_0045960
1128 Ga0495620_0057337
1129 Ga0495632_0013756
1130 Ga0495632_0055239
1131 Ga0495637_0000323
1132 Ga0495643_0002133
1133 Ga0495646_0267005
1134 Ga0495647_0056593
1135 Ga0495647_0145652
1136 Ga0495658_0024043
1137 Ga0495658_0269965
1138 Ga0495670_0237073
1139 Ga0495649_0012894
1140 Ga0495660_0013062
1141 Ga0495672_0005553
1142 Ga0495683_0179073
1143 Ga0495675_0470710
1144 Ga0495673_0000328
1145 Ga0495673_0001043
1146 Ga0495681_0012536
1147 Ga0495686_0003640
1148 Ga0495686_0357739
1149 Ga0495626_0001311
1150 Ga0496101_0679234
1151 Ga0496104_0182487
1152 Ga0496104_0297480
1153 Ga0496105_0020021
1154 Ga0496107_0517345
1155 Ga0496108_0298480
1156 Ga0496108_0586201
1157 Ga0496108_0838748
1158 Ga0496109_0182361
1159 Ga0496109_0845437
1160 Ga0496110_0203931
1161 Ga0496110_0416825
1162 Ga0496111_0414705
1163 Ga0496112_0091742
1164 Ga0496113_0387688
1165 Ga0496114_0029841
1166 Ga0496124_0129642
1167 Ga0495678_002335
1168 Ga0501292_006802
1169 Ga0501294_006021
1170 Ga0501303_000929
1171 Ga0501206_042341
1172 Ga0501223_102609
1173 Ga0501265_007515
1174 nmdc:mga03683_141356_c1
1175 nmdc:mga03n38_606670_c1
1176 nmdc:mga0k408_202817_c1
1177 nmdc:mga0k408_79881_c1
1178 nmdc:mga07m45_317_c1
1179 nmdc:mga07m45_371066_c1
1180 nmdc:mga09592_1007_c1
1181 nmdc:mga0qj67_212074_c1
1182 Ga0495612_0023758
1183 Ga0495595_0025582
1184 Ga0500578_0025843
1185 Ga0500645_002232
1186 2587757800
1187 2599326476
1188 2826583452
1189 2842817223
1190 2842850296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

77

150

0.94

PF02311

AraC_binding

AraC-like ligand binding domain

80

178

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9096 35 126
2h0v-assembly1.cif.gz_B crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution 0.888 32 126
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8767 16 126
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8727 25 126
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.8697 15 126
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9274 37 126 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8767 16 126 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8697 15 126 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8627 32 125 2.60.120.10
3es1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8591 49 126 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2R7S800-F1-model_v4 Auxin-binding protein 0.9873 9 124
AF-A0A3M6C3W4-F1-model_v4 Auxin-binding protein 0.9795 6 169
AF-A0A3M4CA73-F1-model_v4 deleted 0.9791 6 135
AF-A0A0K8NZZ5-F1-model_v4 Putative auxin-binding protein 0.9726 8 169 GO:0016747
AF-A0A1W9EZW7-F1-model_v4 deleted 0.9719 40 139

Map