F467389
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 594 | 399 | 520 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0343298|Ga0496121_0343298_91_753 |
| Length | 220 |
| Sequence | VVATAISAGTSTDPGRDCPLCARLVEYRTELRAREPDGFNAPVPSFGGPDAQLLIVGLAPGAQGANRTGRPFTGDYAGDLLYDTLLHFGFAEGTFLARPDDGLTLTNSRITNAVRCVPPQNKPLPVEITTCRPFLIATMETMPNLRAIVLLGRVAHDTMLKTLGIRAVTAPFGHGAVHDAGRFKLYDSYHCSRYNTNTGVLTPEMFRAVFARVKKDLAET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 9 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 12 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 13 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 14 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 15 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 16 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 17 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 18 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 19 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 20 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 21 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 22 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 23 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 24 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 25 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 26 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 27 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 28 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 29 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 30 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 31 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 32 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 33 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 34 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 35 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 36 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 37 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 38 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 39 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 40 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 41 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 42 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 43 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 44 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 45 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 46 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 47 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 48 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 49 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 50 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 51 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 52 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 53 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 54 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 55 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 56 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 57 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 214 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 234 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 312 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 361 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 363 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 365 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 366 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 367 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 372 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 385 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 386 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 387 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 388 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 389 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 390 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 391 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 392 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 393 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 394 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 395 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 396 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 397 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 398 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 399 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.97 |
| Metatranscriptomes | 0.17 |
| Isolates | 11.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.26 |
| Nodule | 9.6 |
| Rhizoplane | 7.74 |
| Rhizosphere | 67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1011751 | 3300003214 | Bacteria | 1244 |
| 2 | JGI25153J46596_10013737 | 3300003215 | Bacteria | 3406 |
| 3 | JGI25153J46596_10034134 | 3300003215 | Bacteria | 1667 |
| 4 | Ga0055525_1006398 | 3300003759 | Bacteria | 997 |
| 5 | Ga0055526_1018611 | 3300003771 | Bacteria | 2583 |
| 6 | Ga0055536_1000643 | 3300003781 | Bacteria | 23754 |
| 7 | Ga0055536_1000792 | 3300003781 | Bacteria | 21010 |
| 8 | Ga0065165_1002461 | 3300005262 | Bacteria | 15609 |
| 9 | Ga0065715_10016906 | 3300005293 | Bacteria | 2258 |
| 10 | Ga0070658_10054028 | 3300005327 | Bacteria | 3261 |
| 11 | Ga0070658_10234085 | 3300005327 | Bacteria | 1556 |
| 12 | Ga0070660_100345609 | 3300005339 | Bacteria | 1224 |
| 13 | Ga0070691_10040017 | 3300005341 | Bacteria | 2215 |
| 14 | Ga0070691_10128741 | 3300005341 | Bacteria | 1281 |
| 15 | Ga0070661_100085416 | 3300005344 | Bacteria | 2332 |
| 16 | Ga0070669_100235528 | 3300005353 | Bacteria | 1453 |
| 17 | Ga0070674_100013377 | 3300005356 | Bacteria | 5071 |
| 18 | Ga0070674_100123527 | 3300005356 | Bacteria | 1919 |
| 19 | Ga0070674_100414320 | 3300005356 | Bacteria | 1104 |
| 20 | Ga0070688_100252835 | 3300005365 | Bacteria | 1255 |
| 21 | Ga0070667_100033552 | 3300005367 | Bacteria | 4292 |
| 22 | Ga0070703_10002959 | 3300005406 | Bacteria | 4853 |
| 23 | Ga0070709_10444045 | 3300005434 | Bacteria | 976 |
| 24 | Ga0070714_100058060 | 3300005435 | Bacteria | 3314 |
| 25 | Ga0070713_100047485 | 3300005436 | Bacteria | 3529 |
| 26 | Ga0070701_10259451 | 3300005438 | Bacteria | 1053 |
| 27 | Ga0070705_100000171 | 3300005440 | Bacteria | 37880 |
| 28 | Ga0070705_100577981 | 3300005440 | Bacteria | 866 |
| 29 | Ga0070700_100002232 | 3300005441 | Bacteria | 9855 |
| 30 | Ga0070694_100000555 | 3300005444 | Bacteria | 20563 |
| 31 | Ga0070708_100053574 | 3300005445 | Bacteria | 3580 |
| 32 | Ga0070663_100002218 | 3300005455 | Bacteria | 10873 |
| 33 | Ga0070663_100105639 | 3300005455 | Bacteria | 2108 |
| 34 | Ga0070663_100399668 | 3300005455 | Bacteria | 1123 |
| 35 | Ga0070681_10004750 | 3300005458 | Bacteria | 13015 |
| 36 | Ga0070681_10054076 | 3300005458 | Bacteria | 4000 |
| 37 | Ga0068867_100203869 | 3300005459 | Bacteria | 1585 |
| 38 | Ga0070706_100305857 | 3300005467 | Bacteria | 1483 |
| 39 | Ga0070699_100000167 | 3300005518 | Bacteria | 63239 |
| 40 | Ga0070686_100018540 | 3300005544 | Bacteria | 4088 |
| 41 | Ga0070695_100000722 | 3300005545 | Bacteria | 17637 |
| 42 | Ga0070696_100000097 | 3300005546 | Bacteria | 44009 |
| 43 | Ga0070696_100098339 | 3300005546 | Bacteria | 2093 |
| 44 | Ga0070693_100023657 | 3300005547 | Bacteria | 3286 |
| 45 | Ga0070693_100175755 | 3300005547 | Bacteria | 1375 |
| 46 | Ga0070693_100404262 | 3300005547 | Bacteria | 948 |
| 47 | Ga0070665_100513659 | 3300005548 | Bacteria | 1210 |
| 48 | Ga0070704_100007113 | 3300005549 | Bacteria | 6645 |
| 49 | Ga0068855_100051875 | 3300005563 | Bacteria | 4831 |
| 50 | Ga0070664_100213309 | 3300005564 | Bacteria | 1726 |
| 51 | Ga0068857_100009356 | 3300005577 | Bacteria | 8508 |
| 52 | Ga0068854_100568276 | 3300005578 | Bacteria | 964 |
| 53 | Ga0068856_100602324 | 3300005614 | Bacteria | 1120 |
| 54 | Ga0070702_100083117 | 3300005615 | Bacteria | 1923 |
| 55 | Ga0068859_100001658 | 3300005617 | Bacteria | 22662 |
| 56 | Ga0068866_10011028 | 3300005718 | Bacteria | 3894 |
| 57 | Ga0068861_100023275 | 3300005719 | Bacteria | 4467 |
| 58 | Ga0068861_100026465 | 3300005719 | Bacteria | 4217 |
| 59 | Ga0068870_10037186 | 3300005840 | Bacteria | 2508 |
| 60 | Ga0068863_100001297 | 3300005841 | Bacteria | 24954 |
| 61 | Ga0068863_100057437 | 3300005841 | Bacteria | 3683 |
| 62 | Ga0068860_100000623 | 3300005843 | Bacteria | 41934 |
| 63 | Ga0068860_100001592 | 3300005843 | Bacteria | 24376 |
| 64 | Ga0068860_100299305 | 3300005843 | Bacteria | 1575 |
| 65 | Ga0068862_100000194 | 3300005844 | Bacteria | 67126 |
| 66 | Ga0068862_100001428 | 3300005844 | Bacteria | 22066 |
| 67 | Ga0068862_100021469 | 3300005844 | Bacteria | 5395 |
| 68 | Ga0081455_10000230 | 3300005937 | Bacteria | 72112 |
| 69 | Ga0081455_10005420 | 3300005937 | Bacteria | 13994 |
| 70 | Ga0081455_10065103 | 3300005937 | Bacteria | 3050 |
| 71 | Ga0081455_10209285 | 3300005937 | Bacteria | 1454 |
| 72 | Ga0081540_1000423 | 3300005983 | Bacteria | 41829 |
| 73 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 74 | Ga0081539_10047511 | 3300005985 | Bacteria | 2450 |
| 75 | Ga0070717_10031151 | 3300006028 | Bacteria | 4289 |
| 76 | Ga0075365_10005236 | 3300006038 | Bacteria | 6978 |
| 77 | Ga0075364_10379242 | 3300006051 | Bacteria | 964 |
| 78 | Ga0075367_10353769 | 3300006178 | Bacteria | 927 |
| 79 | Ga0075369_10044754 | 3300006186 | Bacteria | 1902 |
| 80 | Ga0075366_10118075 | 3300006195 | Bacteria | 1598 |
| 81 | Ga0075366_10538257 | 3300006195 | Bacteria | 723 |
| 82 | Ga0075428_100101601 | 3300006844 | Bacteria | 3135 |
| 83 | Ga0075430_100030537 | 3300006846 | Bacteria | 4577 |
| 84 | Ga0075430_100036840 | 3300006846 | Bacteria | 4146 |
| 85 | Ga0075430_100153798 | 3300006846 | Bacteria | 1915 |
| 86 | Ga0075431_100000652 | 3300006847 | Bacteria | 29451 |
| 87 | Ga0075431_100000793 | 3300006847 | Bacteria | 27547 |
| 88 | Ga0075431_100036187 | 3300006847 | Bacteria | 5084 |
| 89 | Ga0075431_100102126 | 3300006847 | Bacteria | 2959 |
| 90 | Ga0075433_10308314 | 3300006852 | Bacteria | 1401 |
| 91 | Ga0075434_100139069 | 3300006871 | Bacteria | 2448 |
| 92 | Ga0075434_100485302 | 3300006871 | Bacteria | 1257 |
| 93 | Ga0075434_100706249 | 3300006871 | Bacteria | 1026 |
| 94 | Ga0075429_100013169 | 3300006880 | Bacteria | 7175 |
| 95 | Ga0068865_100026656 | 3300006881 | Bacteria | 3812 |
| 96 | Ga0097620_100001658 | 3300006931 | Bacteria | 22662 |
| 97 | Ga0097620_100018941 | 3300006931 | Bacteria | 6914 |
| 98 | Ga0075435_100576554 | 3300007076 | Bacteria | 975 |
| 99 | Ga0075435_100917974 | 3300007076 | Bacteria | 764 |
| 100 | Ga0105240_10081849 | 3300009093 | Bacteria | 3965 |
| 101 | Ga0111539_10001024 | 3300009094 | Bacteria | 36666 |
| 102 | Ga0111539_10266125 | 3300009094 | Bacteria | 1995 |
| 103 | Ga0111539_10749462 | 3300009094 | Bacteria | 1137 |
| 104 | Ga0105245_10376994 | 3300009098 | Bacteria | 1412 |
| 105 | Ga0114129_10031876 | 3300009147 | Bacteria | 7451 |
| 106 | Ga0114129_10268648 | 3300009147 | Bacteria | 2282 |
| 107 | Ga0114129_10767437 | 3300009147 | Bacteria | 1233 |
| 108 | Ga0105243_10278187 | 3300009148 | Bacteria | 1506 |
| 109 | Ga0105241_10145219 | 3300009174 | Bacteria | 1935 |
| 110 | Ga0105241_10533436 | 3300009174 | Bacteria | 1051 |
| 111 | Ga0105242_10098895 | 3300009176 | Bacteria | 2468 |
| 112 | Ga0105237_10197231 | 3300009545 | Bacteria | 2013 |
| 113 | Ga0105237_10440220 | 3300009545 | Bacteria | 1309 |
| 114 | Ga0105237_10619298 | 3300009545 | Bacteria | 1089 |
| 115 | Ga0105249_10000135 | 3300009553 | Bacteria | 96943 |
| 116 | Ga0105249_10040803 | 3300009553 | Bacteria | 4217 |
| 117 | Ga0105249_10817366 | 3300009553 | Bacteria | 996 |
| 118 | Ga0105239_10321194 | 3300010375 | Bacteria | 1746 |
| 119 | Ga0105239_10619079 | 3300010375 | Bacteria | 1235 |
| 120 | Ga0105239_10752637 | 3300010375 | Bacteria | 1115 |
| 121 | Ga0105239_11059718 | 3300010375 | Bacteria | 933 |
| 122 | Ga0105246_10043734 | 3300011119 | Bacteria | 3040 |
| 123 | Ga0105246_10228958 | 3300011119 | Bacteria | 1462 |
| 124 | Ga0157369_10027642 | 3300013105 | Bacteria | 6285 |
| 125 | Ga0157378_10025383 | 3300013297 | Bacteria | 5219 |
| 126 | Ga0157378_10025603 | 3300013297 | Bacteria | 5194 |
| 127 | Ga0157378_10139457 | 3300013297 | Bacteria | 2250 |
| 128 | Ga0157378_10335847 | 3300013297 | Bacteria | 1472 |
| 129 | Ga0163163_10413721 | 3300014325 | Bacteria | 1407 |
| 130 | Ga0157380_10288056 | 3300014326 | Bacteria | 1506 |
| 131 | Ga0157380_10732823 | 3300014326 | Bacteria | 998 |
| 132 | Ga0157377_10114456 | 3300014745 | Bacteria | 1626 |
| 133 | Ga0157377_10119862 | 3300014745 | Bacteria | 1593 |
| 134 | Ga0157379_10572245 | 3300014968 | Bacteria | 1052 |
| 135 | Ga0157376_10564819 | 3300014969 | Bacteria | 1128 |
| 136 | Ga0163161_10049221 | 3300017792 | Bacteria | 3045 |
| 137 | Ga0213872_10065815 | 3300021361 | Bacteria | 1636 |
| 138 | Ga0213876_10184440 | 3300021384 | Bacteria | 1110 |
| 139 | Ga0213875_10021595 | 3300021388 | Bacteria | 3081 |
| 140 | Ga0213871_10007602 | 3300021441 | Bacteria | 2353 |
| 141 | Ga0209563_101101 | 3300025230 | Bacteria | 7740 |
| 142 | Ga0209677_102497 | 3300025253 | Bacteria | 6870 |
| 143 | Ga0209233_1026715 | 3300025261 | Bacteria | 1407 |
| 144 | Ga0209673_1039315 | 3300025273 | Bacteria | 1366 |
| 145 | Ga0209676_1000070 | 3300025292 | Bacteria | 312074 |
| 146 | Ga0209564_1002681 | 3300025295 | Bacteria | 13500 |
| 147 | Ga0209564_1017449 | 3300025295 | Bacteria | 2796 |
| 148 | Ga0209758_1003040 | 3300025297 | Bacteria | 15973 |
| 149 | Ga0209758_1003616 | 3300025297 | Bacteria | 13830 |
| 150 | Ga0209256_1003151 | 3300025299 | Bacteria | 11994 |
| 151 | Ga0207426_1000596 | 3300025302 | Bacteria | 47621 |
| 152 | Ga0207426_1001063 | 3300025302 | Bacteria | 25997 |
| 153 | Ga0207653_10001766 | 3300025885 | Bacteria | 6908 |
| 154 | Ga0207653_10056818 | 3300025885 | Bacteria | 1313 |
| 155 | Ga0207642_10026215 | 3300025899 | Bacteria | 2369 |
| 156 | Ga0207699_10578280 | 3300025906 | Bacteria | 816 |
| 157 | Ga0207643_10438421 | 3300025908 | Bacteria | 830 |
| 158 | Ga0207684_10108118 | 3300025910 | Bacteria | 2380 |
| 159 | Ga0207654_10232377 | 3300025911 | Bacteria | 1229 |
| 160 | Ga0207707_10014508 | 3300025912 | Bacteria | 6861 |
| 161 | Ga0207707_10044293 | 3300025912 | Bacteria | 3880 |
| 162 | Ga0207695_10081357 | 3300025913 | Bacteria | 3278 |
| 163 | Ga0207663_10381973 | 3300025916 | Bacteria | 1073 |
| 164 | Ga0207660_10005384 | 3300025917 | Bacteria | 8309 |
| 165 | Ga0207662_10116581 | 3300025918 | Bacteria | 1670 |
| 166 | Ga0207657_10042204 | 3300025919 | Bacteria | 4026 |
| 167 | Ga0207652_10676329 | 3300025921 | Bacteria | 922 |
| 168 | Ga0207681_10118411 | 3300025923 | Bacteria | 1939 |
| 169 | Ga0207681_10240798 | 3300025923 | Bacteria | 1408 |
| 170 | Ga0207694_10012988 | 3300025924 | Bacteria | 6271 |
| 171 | Ga0207687_10462458 | 3300025927 | Bacteria | 1054 |
| 172 | Ga0207664_10142487 | 3300025929 | Bacteria | 2029 |
| 173 | Ga0207690_10150091 | 3300025932 | Bacteria | 1727 |
| 174 | Ga0207706_10027494 | 3300025933 | Bacteria | 5086 |
| 175 | Ga0207706_10046897 | 3300025933 | Bacteria | 3825 |
| 176 | Ga0207706_10296554 | 3300025933 | Bacteria | 1409 |
| 177 | Ga0207686_10701537 | 3300025934 | Bacteria | 804 |
| 178 | Ga0207709_10060686 | 3300025935 | Bacteria | 2359 |
| 179 | Ga0207669_10128014 | 3300025937 | Bacteria | 1739 |
| 180 | Ga0207689_10144623 | 3300025942 | Bacteria | 1959 |
| 181 | Ga0207661_10307155 | 3300025944 | Bacteria | 1423 |
| 182 | Ga0207667_10007941 | 3300025949 | Bacteria | 12666 |
| 183 | Ga0207712_10000101 | 3300025961 | Bacteria | 96961 |
| 184 | Ga0207712_10001350 | 3300025961 | Bacteria | 16801 |
| 185 | Ga0207668_10040749 | 3300025972 | Bacteria | 3135 |
| 186 | Ga0207668_10507438 | 3300025972 | Bacteria | 1038 |
| 187 | Ga0207658_10212172 | 3300025986 | Bacteria | 1623 |
| 188 | Ga0207703_10286456 | 3300026035 | Bacteria | 1498 |
| 189 | Ga0207639_10054034 | 3300026041 | Bacteria | 3067 |
| 190 | Ga0207678_10005726 | 3300026067 | Bacteria | 11092 |
| 191 | Ga0207678_10097086 | 3300026067 | Bacteria | 2518 |
| 192 | Ga0207678_10386905 | 3300026067 | Bacteria | 1210 |
| 193 | Ga0207708_10000296 | 3300026075 | Bacteria | 39206 |
| 194 | Ga0207708_10032322 | 3300026075 | Bacteria | 3974 |
| 195 | Ga0207702_10171271 | 3300026078 | Bacteria | 1991 |
| 196 | Ga0207702_10800954 | 3300026078 | Bacteria | 931 |
| 197 | Ga0207641_10044646 | 3300026088 | Bacteria | 3728 |
| 198 | Ga0207641_10097239 | 3300026088 | Bacteria | 2587 |
| 199 | Ga0207648_10083975 | 3300026089 | Bacteria | 2777 |
| 200 | Ga0207648_10901589 | 3300026089 | Bacteria | 826 |
| 201 | Ga0207674_10004822 | 3300026116 | Bacteria | 16164 |
| 202 | Ga0207675_100040969 | 3300026118 | Bacteria | 4326 |
| 203 | Ga0207675_100106809 | 3300026118 | Bacteria | 2639 |
| 204 | Ga0207675_100112912 | 3300026118 | Bacteria | 2565 |
| 205 | Ga0207683_10080458 | 3300026121 | Bacteria | 2891 |
| 206 | Ga0207428_10046390 | 3300027907 | Bacteria | 3495 |
| 207 | Ga0207428_10704229 | 3300027907 | Bacteria | 722 |
| 208 | Ga0268266_10095574 | 3300028379 | Bacteria | 2610 |
| 209 | Ga0268266_10460187 | 3300028379 | Bacteria | 1210 |
| 210 | Ga0268266_10653362 | 3300028379 | Bacteria | 1012 |
| 211 | Ga0268265_10000151 | 3300028380 | Bacteria | 85523 |
| 212 | Ga0268265_10000508 | 3300028380 | Bacteria | 40027 |
| 213 | Ga0268265_10026653 | 3300028380 | Bacteria | 4114 |
| 214 | Ga0268265_10293529 | 3300028380 | Bacteria | 1460 |
| 215 | Ga0268264_10000303 | 3300028381 | Bacteria | 79730 |
| 216 | Ga0268264_10003796 | 3300028381 | Bacteria | 12956 |
| 217 | Ga0268264_10059275 | 3300028381 | Bacteria | 3207 |
| 218 | Ga0265332_10010810 | 3300031238 | Bacteria | 4056 |
| 219 | Ga0265320_10008942 | 3300031240 | Bacteria | 6084 |
| 220 | Ga0265340_10021278 | 3300031247 | Bacteria | 3327 |
| 221 | Ga0265340_10131148 | 3300031247 | Bacteria | 1149 |
| 222 | Ga0265339_10276108 | 3300031249 | Bacteria | 807 |
| 223 | Ga0265316_10188380 | 3300031344 | Bacteria | 1534 |
| 224 | Ga0265316_10463540 | 3300031344 | Bacteria | 908 |
| 225 | Ga0307408_100207219 | 3300031548 | Bacteria | 1591 |
| 226 | Ga0307408_100385808 | 3300031548 | Bacteria | 1199 |
| 227 | Ga0265313_10027832 | 3300031595 | Bacteria | 2952 |
| 228 | Ga0265314_10053865 | 3300031711 | Bacteria | 2787 |
| 229 | Ga0265342_10019647 | 3300031712 | Bacteria | 4350 |
| 230 | Ga0265342_10227084 | 3300031712 | Bacteria | 1004 |
| 231 | Ga0316578_10070719 | 3300031728 | Bacteria | 2066 |
| 232 | Ga0307405_10205343 | 3300031731 | Bacteria | 1434 |
| 233 | Ga0307407_10256931 | 3300031903 | Bacteria | 1200 |
| 234 | Ga0307414_10532487 | 3300032004 | Bacteria | 1044 |
| 235 | Ga0307415_100755715 | 3300032126 | Bacteria | 883 |
| 236 | Ga0307510_10031031 | 3300033180 | Bacteria | 6046 |
| 237 | Ga0307510_10042319 | 3300033180 | Bacteria | 4965 |
| 238 | Ga0307510_10285351 | 3300033180 | Bacteria | 1119 |
| 239 | Ga0316596_1016560 | 3300033541 | Bacteria | 1848 |
| 240 | Ga0316215_1007363 | 3300033544 | Bacteria | 1072 |
| 241 | Ga0373958_0014878 | 3300034819 | Bacteria | 1366 |
| 242 | Ga0373938_0068776 | 3300034957 | Bacteria | 842 |
| 243 | Ga0373929_0025233 | 3300035085 | Bacteria | 1233 |
| 244 | Ga0373951_0016900 | 3300035091 | Bacteria | 1649 |
| 245 | Ga0373939_0006111 | 3300035114 | Bacteria | 2894 |
| 246 | Ga0373941_0001972 | 3300035115 | Bacteria | 4449 |
| 247 | Ga0373960_0021196 | 3300035121 | Bacteria | 1726 |
| 248 | Ga0373946_0380141 | 3300035171 | Bacteria | 710 |
| 249 | Ga0316574_0197754 | 3300035398 | Bacteria | 1292 |
| 250 | Ga0373924_0027381 | 3300035410 | Bacteria | 2266 |
| 251 | Ga0373931_0004666 | 3300035691 | Bacteria | 6271 |
| 252 | Ga0373927_0038409 | 3300035695 | Bacteria | 3108 |
| 253 | Ga0373927_0118770 | 3300035695 | Bacteria | 1725 |
| 254 | Ga0373933_0082406 | 3300035724 | Bacteria | 1974 |
| 255 | Ga0373937_0006904 | 3300036401 | Bacteria | 9799 |
| 256 | Ga0316584_0036211 | 3300036712 | Bacteria | 3661 |
| 257 | Ga0373925_0056161 | 3300037068 | Bacteria | 2949 |
| 258 | Ga0395898_0408602 | 3300037466 | Bacteria | 1294 |
| 259 | Ga0395898_0573656 | 3300037466 | Bacteria | 1071 |
| 260 | Ga0395898_0742938 | 3300037466 | Bacteria | 923 |
| 261 | Ga0436364_0075557 | 3300037853 | Bacteria | 10295 |
| 262 | Ga0436364_0954368 | 3300037853 | Unclassified | 2285 |
| 263 | Ga0395901_0776576 | 3300038443 | Bacteria | 949 |
| 264 | Ga0436365_1501284 | 3300039437 | Bacteria | 4389 |
| 265 | Ga0436365_1673354 | 3300039437 | Bacteria | 1151 |
| 266 | Ga0436361_0431438 | 3300039447 | Bacteria | 7452 |
| 267 | Ga0451802_0229276 | 3300041460 | Bacteria | 1545 |
| 268 | Ga0439455_0005605 | 3300042012 | Bacteria | 2559 |
| 269 | Ga0451577_0084229 | 3300042876 | Bacteria | 2837 |
| 270 | Ga0451577_0147776 | 3300042876 | Bacteria | 2114 |
| 271 | Ga0466969_0042037 | 3300044656 | Bacteria | 2284 |
| 272 | Ga0466966_0125763 | 3300044684 | Bacteria | 1572 |
| 273 | Ga0466961_0075292 | 3300044693 | Bacteria | 2140 |
| 274 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 275 | Ga0466971_0078708 | 3300044719 | Bacteria | 1502 |
| 276 | Ga0466959_0019584 | 3300045049 | Bacteria | 4977 |
| 277 | Ga0451576_0027187 | 3300045051 | Bacteria | 6146 |
| 278 | Ga0451576_0110064 | 3300045051 | Bacteria | 2867 |
| 279 | Ga0466967_0082999 | 3300045976 | Bacteria | 2897 |
| 280 | Ga0495592_0123465 | 3300046454 | Bacteria | 1819 |
| 281 | Ga0495603_0052164 | 3300046455 | Bacteria | 2429 |
| 282 | Ga0495590_0043258 | 3300046457 | Bacteria | 1571 |
| 283 | Ga0495629_0004968 | 3300046459 | Bacteria | 9975 |
| 284 | Ga0495653_0073743 | 3300046463 | Bacteria | 2546 |
| 285 | Ga0495580_0373031 | 3300046472 | Bacteria | 965 |
| 286 | Ga0495582_0276643 | 3300046473 | Bacteria | 964 |
| 287 | Ga0495582_0424562 | 3300046473 | Bacteria | 767 |
| 288 | Ga0495605_0055791 | 3300046474 | Bacteria | 1907 |
| 289 | Ga0495664_0000874 | 3300046477 | Bacteria | 15509 |
| 290 | Ga0495583_0041932 | 3300046506 | Bacteria | 2141 |
| 291 | Ga0495606_0005580 | 3300046507 | Bacteria | 11983 |
| 292 | Ga0495606_0155650 | 3300046507 | Bacteria | 1337 |
| 293 | Ga0495608_0124875 | 3300046511 | Bacteria | 1649 |
| 294 | Ga0495616_0037479 | 3300046513 | Bacteria | 2494 |
| 295 | Ga0495618_0207985 | 3300046514 | Bacteria | 1237 |
| 296 | Ga0495628_0168719 | 3300046516 | Bacteria | 1660 |
| 297 | Ga0495648_0044488 | 3300046524 | Bacteria | 2771 |
| 298 | Ga0495648_0232528 | 3300046524 | Bacteria | 901 |
| 299 | Ga0495654_0186340 | 3300046530 | Bacteria | 896 |
| 300 | Ga0495665_0037382 | 3300046531 | Bacteria | 2591 |
| 301 | Ga0495665_0344006 | 3300046531 | Bacteria | 760 |
| 302 | Ga0495640_0007811 | 3300046533 | Bacteria | 8414 |
| 303 | Ga0495587_0145172 | 3300046536 | Bacteria | 1353 |
| 304 | Ga0495645_0007670 | 3300046543 | Bacteria | 7506 |
| 305 | Ga0495622_0028661 | 3300046557 | Bacteria | 2600 |
| 306 | Ga0495656_0021282 | 3300046615 | Bacteria | 2523 |
| 307 | Ga0495668_0244147 | 3300046616 | Bacteria | 983 |
| 308 | Ga0495611_0037715 | 3300046648 | Bacteria | 2148 |
| 309 | Ga0495611_0192823 | 3300046648 | Bacteria | 951 |
| 310 | Ga0495625_0194413 | 3300046660 | Bacteria | 1342 |
| 311 | Ga0495635_0021418 | 3300046663 | Bacteria | 4504 |
| 312 | Ga0495635_0038378 | 3300046663 | Bacteria | 3316 |
| 313 | Ga0495657_0082366 | 3300046675 | Bacteria | 2080 |
| 314 | Ga0495623_0155529 | 3300046679 | Bacteria | 1348 |
| 315 | Ga0495646_0080631 | 3300046680 | Bacteria | 1898 |
| 316 | Ga0495658_0334451 | 3300046683 | Bacteria | 961 |
| 317 | Ga0495669_0002716 | 3300046684 | Bacteria | 7250 |
| 318 | Ga0495613_0074903 | 3300046689 | Bacteria | 2464 |
| 319 | Ga0495624_0123530 | 3300046690 | Bacteria | 1589 |
| 320 | Ga0495670_0116490 | 3300046691 | Bacteria | 1386 |
| 321 | Ga0495671_0109872 | 3300046692 | Bacteria | 1347 |
| 322 | Ga0495649_0038722 | 3300046694 | Bacteria | 2615 |
| 323 | Ga0495649_0041881 | 3300046694 | Bacteria | 2503 |
| 324 | Ga0495589_0061902 | 3300046794 | Bacteria | 1836 |
| 325 | Ga0495600_0050462 | 3300046809 | Bacteria | 2715 |
| 326 | Ga0495600_0290597 | 3300046809 | Bacteria | 1033 |
| 327 | Ga0495581_0174708 | 3300047315 | Bacteria | 1256 |
| 328 | Ga0495674_0055498 | 3300047319 | Bacteria | 3474 |
| 329 | Ga0495674_0586613 | 3300047319 | Bacteria | 884 |
| 330 | Ga0495672_0024387 | 3300047320 | Bacteria | 3898 |
| 331 | Ga0495676_0032128 | 3300047321 | Bacteria | 4434 |
| 332 | Ga0495676_0352167 | 3300047321 | Bacteria | 984 |
| 333 | Ga0495673_0009492 | 3300047469 | Bacteria | 5385 |
| 334 | Ga0495673_0110508 | 3300047469 | Bacteria | 1099 |
| 335 | Ga0495673_0167862 | 3300047469 | Bacteria | 838 |
| 336 | Ga0495684_0038027 | 3300047471 | Bacteria | 3691 |
| 337 | Ga0495686_0170559 | 3300047472 | Bacteria | 1266 |
| 338 | Ga0495593_0080837 | 3300047673 | Bacteria | 1681 |
| 339 | Ga0495615_0085706 | 3300048090 | Bacteria | 871 |
| 340 | Ga0496100_0067734 | 3300048903 | Bacteria | 2372 |
| 341 | Ga0496101_0163936 | 3300048904 | Bacteria | 1706 |
| 342 | Ga0496102_0003290 | 3300048905 | Bacteria | 13702 |
| 343 | Ga0496102_0025292 | 3300048905 | Bacteria | 5284 |
| 344 | Ga0496102_0063257 | 3300048905 | Bacteria | 3388 |
| 345 | Ga0496102_0397934 | 3300048905 | Bacteria | 1295 |
| 346 | Ga0496103_0124712 | 3300048906 | Bacteria | 1642 |
| 347 | Ga0496103_0314140 | 3300048906 | Bacteria | 1008 |
| 348 | Ga0496104_0000182 | 3300048907 | Bacteria | 56117 |
| 349 | Ga0496104_0040114 | 3300048907 | Bacteria | 4387 |
| 350 | Ga0496104_0150280 | 3300048907 | Bacteria | 2236 |
| 351 | Ga0496104_0152048 | 3300048907 | Bacteria | 2221 |
| 352 | Ga0496104_0328973 | 3300048907 | Bacteria | 1441 |
| 353 | Ga0496105_0016358 | 3300048908 | Bacteria | 5921 |
| 354 | Ga0496105_0110087 | 3300048908 | Bacteria | 2273 |
| 355 | Ga0496105_0252568 | 3300048908 | Bacteria | 1428 |
| 356 | Ga0496106_0004830 | 3300048909 | Bacteria | 9971 |
| 357 | Ga0496106_0739694 | 3300048909 | Bacteria | 782 |
| 358 | Ga0496107_0001227 | 3300048910 | Bacteria | 15652 |
| 359 | Ga0496107_0096715 | 3300048910 | Bacteria | 2161 |
| 360 | Ga0496108_0001152 | 3300048911 | Bacteria | 20646 |
| 361 | Ga0496108_0092022 | 3300048911 | Bacteria | 2578 |
| 362 | Ga0496109_0002055 | 3300048912 | Bacteria | 16695 |
| 363 | Ga0496109_0131046 | 3300048912 | Bacteria | 2340 |
| 364 | Ga0496109_0378231 | 3300048912 | Bacteria | 1338 |
| 365 | Ga0496110_0008254 | 3300048913 | Bacteria | 8373 |
| 366 | Ga0496110_0036848 | 3300048913 | Bacteria | 4249 |
| 367 | Ga0496110_0088176 | 3300048913 | Bacteria | 2771 |
| 368 | Ga0496110_0578586 | 3300048913 | Bacteria | 1020 |
| 369 | Ga0496110_0606120 | 3300048913 | Bacteria | 993 |
| 370 | Ga0496111_0012429 | 3300048914 | Bacteria | 5764 |
| 371 | Ga0496112_0013651 | 3300048915 | Bacteria | 7506 |
| 372 | Ga0496113_0020005 | 3300048916 | Bacteria | 4696 |
| 373 | Ga0496113_0086437 | 3300048916 | Bacteria | 2410 |
| 374 | Ga0496113_0235526 | 3300048916 | Bacteria | 1460 |
| 375 | Ga0496114_0124231 | 3300048917 | Bacteria | 2223 |
| 376 | Ga0496114_0162081 | 3300048917 | Bacteria | 1945 |
| 377 | Ga0496114_0200420 | 3300048917 | Bacteria | 1748 |
| 378 | Ga0496115_0037216 | 3300048918 | Bacteria | 3856 |
| 379 | Ga0496115_0096864 | 3300048918 | Bacteria | 2416 |
| 380 | Ga0496115_0137187 | 3300048918 | Bacteria | 2017 |
| 381 | Ga0496115_0162457 | 3300048918 | Bacteria | 1846 |
| 382 | Ga0496115_0168281 | 3300048918 | Bacteria | 1812 |
| 383 | Ga0496115_0460152 | 3300048918 | Bacteria | 1026 |
| 384 | Ga0496116_0232006 | 3300048919 | Bacteria | 935 |
| 385 | Ga0496118_0207789 | 3300048921 | Bacteria | 1152 |
| 386 | Ga0496119_0016935 | 3300048922 | Bacteria | 5514 |
| 387 | Ga0496120_0124632 | 3300048923 | Bacteria | 1327 |
| 388 | Ga0496121_0343298 | 3300048924 | Bacteria | 997 |
| 389 | Ga0496124_0016861 | 3300048927 | Bacteria | 6922 |
| 390 | Ga0496124_0152553 | 3300048927 | Bacteria | 1810 |
| 391 | Ga0496125_0004318 | 3300048928 | Bacteria | 16505 |
| 392 | Ga0496125_0096968 | 3300048928 | Bacteria | 2187 |
| 393 | Ga0496125_0296150 | 3300048928 | Bacteria | 994 |
| 394 | Ga0496126_0100701 | 3300048929 | Bacteria | 2528 |
| 395 | Ga0496126_0218628 | 3300048929 | Bacteria | 1602 |
| 396 | Ga0496126_0495796 | 3300048929 | Bacteria | 977 |
| 397 | Ga0495682_0040447 | 3300049460 | Bacteria | 1709 |
| 398 | Ga0501031_0089058 | 3300049568 | Bacteria | 2012 |
| 399 | Ga0501032_0077494 | 3300049569 | Bacteria | 2213 |
| 400 | Ga0501033_0150139 | 3300049570 | Bacteria | 1681 |
| 401 | Ga0501033_0609990 | 3300049570 | Bacteria | 748 |
| 402 | Ga0501034_0000391 | 3300049571 | Bacteria | 74631 |
| 403 | Ga0501034_0004261 | 3300049571 | Bacteria | 15956 |
| 404 | Ga0501034_0025458 | 3300049571 | Bacteria | 6024 |
| 405 | Ga0501034_0119775 | 3300049571 | Bacteria | 2619 |
| 406 | Ga0501034_0228348 | 3300049571 | Bacteria | 1811 |
| 407 | Ga0501034_0348572 | 3300049571 | Bacteria | 1409 |
| 408 | Ga0501034_0369283 | 3300049571 | Bacteria | 1361 |
| 409 | Ga0501034_0418102 | 3300049571 | Bacteria | 1262 |
| 410 | Ga0501036_0062691 | 3300049572 | Bacteria | 3149 |
| 411 | Ga0501036_0223254 | 3300049572 | Bacteria | 1582 |
| 412 | Ga0501038_0112787 | 3300049574 | Bacteria | 2250 |
| 413 | Ga0501038_0149649 | 3300049574 | Bacteria | 1904 |
| 414 | Ga0501038_0423432 | 3300049574 | Bacteria | 1027 |
| 415 | Ga0501039_0000070 | 3300049575 | Bacteria | 77967 |
| 416 | Ga0501039_0184135 | 3300049575 | Bacteria | 1642 |
| 417 | Ga0501040_0210412 | 3300049576 | Bacteria | 1383 |
| 418 | Ga0501043_0044532 | 3300049579 | Bacteria | 3489 |
| 419 | Ga0501046_0007046 | 3300049580 | Bacteria | 9904 |
| 420 | Ga0501047_0000102 | 3300049581 | Bacteria | 104950 |
| 421 | Ga0501047_0081221 | 3300049581 | Bacteria | 3116 |
| 422 | Ga0501047_0206645 | 3300049581 | Bacteria | 1823 |
| 423 | Ga0501047_0331608 | 3300049581 | Bacteria | 1360 |
| 424 | Ga0501047_0374238 | 3300049581 | Unclassified | 1259 |
| 425 | Ga0501067_0005270 | 3300049583 | Bacteria | 7183 |
| 426 | Ga0501067_0042856 | 3300049583 | Bacteria | 2513 |
| 427 | Ga0501067_0106615 | 3300049583 | Bacteria | 1557 |
| 428 | Ga0501067_0347843 | 3300049583 | Bacteria | 826 |
| 429 | Ga0501070_0021105 | 3300049586 | Bacteria | 5465 |
| 430 | Ga0501070_0362359 | 3300049586 | Bacteria | 1176 |
| 431 | Ga0501070_0369030 | 3300049586 | Bacteria | 1164 |
| 432 | Ga0501071_0234134 | 3300049587 | Bacteria | 1384 |
| 433 | Ga0501073_0243585 | 3300049589 | Bacteria | 1241 |
| 434 | Ga0501073_0285079 | 3300049589 | Bacteria | 1139 |
| 435 | Ga0501073_0382170 | 3300049589 | Bacteria | 973 |
| 436 | Ga0501074_0296866 | 3300049590 | Bacteria | 1148 |
| 437 | Ga0501076_0012958 | 3300049592 | Bacteria | 6242 |
| 438 | Ga0501076_0033571 | 3300049592 | Bacteria | 4007 |
| 439 | Ga0501076_0101815 | 3300049592 | Bacteria | 2315 |
| 440 | Ga0501077_0029077 | 3300049593 | Bacteria | 3513 |
| 441 | Ga0501079_0494257 | 3300049741 | Bacteria | 962 |
| 442 | Ga0501079_0582879 | 3300049741 | Bacteria | 880 |
| 443 | Ga0501080_0000028 | 3300049742 | Bacteria | 88948 |
| 444 | Ga0501080_0132220 | 3300049742 | Bacteria | 2310 |
| 445 | Ga0501080_0252385 | 3300049742 | Bacteria | 1608 |
| 446 | Ga0501080_0496433 | 3300049742 | Bacteria | 1091 |
| 447 | Ga0501083_0005111 | 3300049744 | Bacteria | 9291 |
| 448 | Ga0501083_0010351 | 3300049744 | Bacteria | 6565 |
| 449 | Ga0501083_0038864 | 3300049744 | Bacteria | 3233 |
| 450 | Ga0501035_0000020 | 3300049822 | Bacteria | 221605 |
| 451 | Ga0501035_0143338 | 3300049822 | Bacteria | 2076 |
| 452 | Ga0501035_0191759 | 3300049822 | Bacteria | 1757 |
| 453 | Ga0501035_0444766 | 3300049822 | Bacteria | 1073 |
| 454 | Ga0501035_0467243 | 3300049822 | Bacteria | 1042 |
| 455 | Ga0501044_0000007 | 3300049823 | Bacteria | 283429 |
| 456 | Ga0501044_0130995 | 3300049823 | Bacteria | 2502 |
| 457 | Ga0501044_0198096 | 3300049823 | Bacteria | 1967 |
| 458 | Ga0501044_0464765 | 3300049823 | Bacteria | 1170 |
| 459 | Ga0501044_0775571 | 3300049823 | Unclassified | 839 |
| 460 | Ga0501045_0076772 | 3300049824 | Bacteria | 2462 |
| 461 | Ga0501045_0084042 | 3300049824 | Bacteria | 2348 |
| 462 | nmdc:mga00v17_172718_c1 | 3300050491 | Bacteria | 1394 |
| 463 | nmdc:mga0yw44_304098_c1 | 3300050492 | Bacteria | 1069 |
| 464 | nmdc:mga0yw44_45596_c1 | 3300050492 | Bacteria | 2629 |
| 465 | nmdc:mga0k408_132933_c1 | 3300050493 | Bacteria | 1477 |
| 466 | nmdc:mga05p37_243473_c1 | 3300050507 | Bacteria | 2161 |
| 467 | nmdc:mga09592_15142_c1 | 3300050508 | Bacteria | 6301 |
| 468 | nmdc:mga09592_280333_c1 | 3300050508 | Bacteria | 1446 |
| 469 | nmdc:mga0qj67_130987_c1 | 3300050509 | Bacteria | 2031 |
| 470 | nmdc:mga0qj67_171880_c1 | 3300050509 | Bacteria | 1760 |
| 471 | nmdc:mga0qj67_39723_c1 | 3300050509 | Bacteria | 3697 |
| 472 | nmdc:mga06r32_1040_c1 | 3300050510 | Bacteria | 25051 |
| 473 | nmdc:mga06r32_212204_c1 | 3300050510 | Bacteria | 1924 |
| 474 | nmdc:mga06r32_88502_c1 | 3300050510 | Bacteria | 3023 |
| 475 | nmdc:mga08y16_140659_c1 | 3300050511 | Bacteria | 2509 |
| 476 | nmdc:mga08y16_371687_c1 | 3300050511 | Bacteria | 1466 |
| 477 | nmdc:mga08y16_5279_c1 | 3300050511 | Bacteria | 13507 |
| 478 | nmdc:mga08y16_654463_c1 | 3300050511 | Bacteria | 1054 |
| 479 | nmdc:mga0rr50_369426_c1 | 3300050513 | Bacteria | 1208 |
| 480 | nmdc:mga0a205_235383_c1 | 3300050515 | Bacteria | 1713 |
| 481 | nmdc:mga0sz30_18114_c1 | 3300050516 | Bacteria | 2815 |
| 482 | Ga0495601_0013287 | 3300053077 | Bacteria | 4949 |
| 483 | Ga0495655_0089423 | 3300053083 | Bacteria | 895 |
| 484 | Ga0495595_0165554 | 3300053084 | Bacteria | 1093 |
| 485 | Ga0495619_0593264 | 3300053085 | Bacteria | 758 |
| 486 | Ga0500578_0106784 | 3300053086 | Bacteria | 1768 |
| 487 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 488 | Ga0500644_0032464 | 3300053088 | Bacteria | 1669 |
| 489 | Ga0500641_0065665 | 3300053096 | Bacteria | 1518 |
| 490 | Ga0500650_0202708 | 3300053098 | Bacteria | 903 |
| 491 | Ga0500555_002304 | 3300053103 | Bacteria | 5557 |
| 492 | Ga0500569_018641 | 3300053109 | Bacteria | 1795 |
| 493 | Ga0500572_034326 | 3300053111 | Bacteria | 1436 |
| 494 | Ga0500607_027067 | 3300053121 | Bacteria | 3183 |
| 495 | Ga0500614_045766 | 3300053123 | Bacteria | 1130 |
| 496 | Ga0500642_0007503 | 3300053130 | Bacteria | 3670 |
| 497 | Ga0500655_043209 | 3300053133 | Bacteria | 887 |
| 498 | Ga0500658_0133994 | 3300053134 | Bacteria | 1107 |
| 499 | Ga0500559_0034055 | 3300053136 | Bacteria | 2195 |
| 500 | Ga0500559_0035588 | 3300053136 | Bacteria | 2151 |
| 501 | Ga0500568_0008868 | 3300053139 | Bacteria | 4815 |
| 502 | Ga0500589_134775 | 3300053147 | Bacteria | 1026 |
| 503 | Ga0500603_002147 | 3300053150 | Bacteria | 4359 |
| 504 | Ga0500619_000868 | 3300053154 | Bacteria | 5160 |
| 505 | Ga0500627_0008486 | 3300053158 | Bacteria | 3653 |
| 506 | Ga0500633_0020495 | 3300053160 | Bacteria | 1996 |
| 507 | Ga0500638_011578 | 3300053162 | Bacteria | 3919 |
| 508 | Ga0500636_0284226 | 3300053177 | Bacteria | 824 |
| 509 | Ga0500645_082044 | 3300053730 | Bacteria | 919 |
| 510 | Ga0501084_0009497 | 3300054114 | Bacteria | 8049 |
| 511 | Ga0501084_0026219 | 3300054114 | Bacteria | 4862 |
| 512 | Ga0501084_0065205 | 3300054114 | Bacteria | 3047 |
| 513 | Ga0501084_0312302 | 3300054114 | Bacteria | 1327 |
| 514 | Ga0501084_0466113 | 3300054114 | Bacteria | 1068 |
| 515 | Ga0590071_002138 | 3300059421 | Bacteria | 5034 |
| 516 | Ga0590075_031176 | 3300059424 | Bacteria | 1351 |
| 517 | Ga0501082_0007775 | 3300060353 | Bacteria | 9250 |
| 518 | Ga0501082_0051487 | 3300060353 | Bacteria | 3549 |
| 519 | Ga0501082_0110894 | 3300060353 | Bacteria | 2374 |
| 520 | Ga0530510_0136303 | 3300061734 | Bacteria | 1807 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0582879 | Ga0501079_0582879_28_651 | 194 |
| 2 | 3300005367 | Ga0070667_100033552 | Ga0070667_1000335522 | 206 |
| 3 | 3300006178 | Ga0075367_10353769 | Ga0075367_103537692 | 206 |
| 4 | 3300009176 | Ga0105242_10098895 | Ga0105242_100988954 | 206 |
| 5 | 3300035171 | Ga0373946_0380141 | Ga0373946_0380141_31_684 | 206 |
| 6 | 3300042012 | Ga0439455_0005605 | Ga0439455_0005605_252_881 | 206 |
| 7 | 3300046463 | Ga0495653_0073743 | Ga0495653_0073743_989_1642 | 206 |
| 8 | 3300046477 | Ga0495664_0000874 | Ga0495664_0000874_14450_15103 | 206 |
| 9 | 3300046531 | Ga0495665_0037382 | Ga0495665_0037382_1710_2363 | 206 |
| 10 | 3300046533 | Ga0495640_0007811 | Ga0495640_0007811_811_1464 | 206 |
| 11 | 3300046543 | Ga0495645_0007670 | Ga0495645_0007670_6831_7484 | 206 |
| 12 | 3300046663 | Ga0495635_0038378 | Ga0495635_0038378_1579_2232 | 206 |
| 13 | 3300047319 | Ga0495674_0055498 | Ga0495674_0055498_290_943 | 206 |
| 14 | 3300047321 | Ga0495676_0352167 | Ga0495676_0352167_173_820 | 206 |
| 15 | 3300047471 | Ga0495684_0038027 | Ga0495684_0038027_262_915 | 206 |
| 16 | 3300053077 | Ga0495601_0013287 | Ga0495601_0013287_4124_4777 | 206 |
| 17 | 3300053084 | Ga0495595_0165554 | Ga0495595_0165554_333_986 | 206 |
| 18 | 3300005293 | Ga0065715_10016906 | Ga0065715_100169062 | 207 |
| 19 | 3300005356 | Ga0070674_100123527 | Ga0070674_1001235272 | 207 |
| 20 | 3300007076 | Ga0075435_100576554 | Ga0075435_1005765541 | 207 |
| 21 | 3300009147 | Ga0114129_10268648 | Ga0114129_102686482 | 207 |
| 22 | 3300010375 | Ga0105239_11059718 | Ga0105239_110597182 | 207 |
| 23 | 3300025921 | Ga0207652_10676329 | Ga0207652_106763292 | 207 |
| 24 | 3300025934 | Ga0207686_10701537 | Ga0207686_107015372 | 207 |
| 25 | 3300026118 | Ga0207675_100106809 | Ga0207675_1001068093 | 207 |
| 26 | 3300028380 | Ga0268265_10293529 | Ga0268265_102935292 | 207 |
| 27 | 3300037466 | Ga0395898_0573656 | Ga0395898_0573656_370_1008 | 207 |
| 28 | 3300048913 | Ga0496110_0606120 | Ga0496110_0606120_324_953 | 207 |
| 29 | 3300049589 | Ga0501073_0382170 | Ga0501073_0382170_295_927 | 207 |
| 30 | 3300050515 | nmdc:mga0a205_235383_c1 | nmdc:mga0a205_235383_c1_302_931 | 207 |
| 31 | 3300054114 | Ga0501084_0065205 | Ga0501084_0065205_1848_2474 | 207 |
| 32 | 3300059421 | Ga0590071_002138 | Ga0590071_002138_2161_2787 | 207 |
| 33 | 3300059424 | Ga0590075_031176 | Ga0590075_031176_386_1012 | 207 |
| 34 | 3300005455 | Ga0070663_100399668 | Ga0070663_1003996681 | 208 |
| 35 | 3300005719 | Ga0068861_100026465 | Ga0068861_1000264654 | 208 |
| 36 | 3300026118 | Ga0207675_100040969 | Ga0207675_1000409693 | 208 |
| 37 | 3300031240 | Ga0265320_10008942 | Ga0265320_100089423 | 208 |
| 38 | 3300031548 | Ga0307408_100385808 | Ga0307408_1003858081 | 208 |
| 39 | 3300031711 | Ga0265314_10053865 | Ga0265314_100538653 | 208 |
| 40 | 3300047469 | Ga0495673_0009492 | Ga0495673_0009492_3013_3648 | 208 |
| 41 | 3300049571 | Ga0501034_0119775 | Ga0501034_0119775_1019_1663 | 208 |
| 42 | 3300049823 | Ga0501044_0464765 | Ga0501044_0464765_261_890 | 208 |
| 43 | 3300003771 | Ga0055526_1018611 | Ga0055526_10186112 | 209 |
| 44 | 3300003781 | Ga0055536_1000643 | Ga0055536_10006437 | 209 |
| 45 | 3300009545 | Ga0105237_10440220 | Ga0105237_104402202 | 209 |
| 46 | 3300025292 | Ga0209676_1000070 | Ga0209676_1000070198 | 209 |
| 47 | 3300031247 | Ga0265340_10021278 | Ga0265340_100212782 | 209 |
| 48 | 3300031595 | Ga0265313_10027832 | Ga0265313_100278322 | 209 |
| 49 | 3300031712 | Ga0265342_10019647 | Ga0265342_100196472 | 209 |
| 50 | 3300031728 | Ga0316578_10070719 | Ga0316578_100707193 | 209 |
| 51 | 3300032004 | Ga0307414_10532487 | Ga0307414_105324872 | 209 |
| 52 | 3300033541 | Ga0316596_1016560 | Ga0316596_10165602 | 209 |
| 53 | 3300035398 | Ga0316574_0197754 | Ga0316574_0197754_220_876 | 209 |
| 54 | 3300042876 | Ga0451577_0084229 | Ga0451577_0084229_1122_1754 | 209 |
| 55 | 3300044712 | Ga0453684_0000031 | Ga0453684_0000031_307967_308599 | 209 |
| 56 | 3300048921 | Ga0496118_0207789 | Ga0496118_0207789_178_834 | 209 |
| 57 | 3300048924 | Ga0496121_0343298 | Ga0496121_0343298_91_753 | 209 |
| 58 | 3300049568 | Ga0501031_0089058 | Ga0501031_0089058_1205_1861 | 209 |
| 59 | 3300049570 | Ga0501033_0150139 | Ga0501033_0150139_492_1148 | 209 |
| 60 | 3300049571 | Ga0501034_0025458 | Ga0501034_0025458_1186_1842 | 209 |
| 61 | 3300049571 | Ga0501034_0348572 | Ga0501034_0348572_235_870 | 209 |
| 62 | 3300049571 | Ga0501034_0418102 | Ga0501034_0418102_132_767 | 209 |
| 63 | 3300049581 | Ga0501047_0206645 | Ga0501047_0206645_281_943 | 209 |
| 64 | 3300049583 | Ga0501067_0042856 | Ga0501067_0042856_1316_1951 | 209 |
| 65 | 3300049583 | Ga0501067_0106615 | Ga0501067_0106615_807_1442 | 209 |
| 66 | 3300049583 | Ga0501067_0347843 | Ga0501067_0347843_164_799 | 209 |
| 67 | 3300049589 | Ga0501073_0243585 | Ga0501073_0243585_563_1198 | 209 |
| 68 | 3300049589 | Ga0501073_0285079 | Ga0501073_0285079_17_655 | 209 |
| 69 | 3300049592 | Ga0501076_0101815 | Ga0501076_0101815_1377_2012 | 209 |
| 70 | 3300049741 | Ga0501079_0494257 | Ga0501079_0494257_41_676 | 209 |
| 71 | 3300049742 | Ga0501080_0132220 | Ga0501080_0132220_227_862 | 209 |
| 72 | 3300049742 | Ga0501080_0252385 | Ga0501080_0252385_810_1445 | 209 |
| 73 | 3300049744 | Ga0501083_0005111 | Ga0501083_0005111_1497_2135 | 209 |
| 74 | 3300049744 | Ga0501083_0010351 | Ga0501083_0010351_4961_5596 | 209 |
| 75 | 3300049744 | Ga0501083_0038864 | Ga0501083_0038864_1113_1748 | 209 |
| 76 | 3300049822 | Ga0501035_0191759 | Ga0501035_0191759_312_965 | 209 |
| 77 | 3300049822 | Ga0501035_0444766 | Ga0501035_0444766_323_985 | 209 |
| 78 | 3300049823 | Ga0501044_0130995 | Ga0501044_0130995_1536_2183 | 209 |
| 79 | 3300049823 | Ga0501044_0198096 | Ga0501044_0198096_828_1484 | 209 |
| 80 | 3300050509 | nmdc:mga0qj67_130987_c1 | nmdc:mga0qj67_130987_c1_1220_1858 | 209 |
| 81 | 3300054114 | Ga0501084_0009497 | Ga0501084_0009497_1919_2554 | 209 |
| 82 | 3300054114 | Ga0501084_0312302 | Ga0501084_0312302_636_1271 | 209 |
| 83 | 3300054114 | Ga0501084_0466113 | Ga0501084_0466113_61_702 | 209 |
| 84 | 3300060353 | Ga0501082_0007775 | Ga0501082_0007775_246_881 | 209 |
| 85 | 3300060353 | Ga0501082_0110894 | Ga0501082_0110894_404_1039 | 209 |
| 86 | iso_pu_bacteria | 2524023250 | 2524610297 | 209 |
| 87 | 3300005327 | Ga0070658_10234085 | Ga0070658_102340852 | 210 |
| 88 | 3300005458 | Ga0070681_10054076 | Ga0070681_100540765 | 210 |
| 89 | 3300005563 | Ga0068855_100051875 | Ga0068855_1000518753 | 210 |
| 90 | 3300005614 | Ga0068856_100602324 | Ga0068856_1006023241 | 210 |
| 91 | 3300009093 | Ga0105240_10081849 | Ga0105240_100818495 | 210 |
| 92 | 3300009174 | Ga0105241_10145219 | Ga0105241_101452194 | 210 |
| 93 | 3300009545 | Ga0105237_10619298 | Ga0105237_106192982 | 210 |
| 94 | 3300010375 | Ga0105239_10321194 | Ga0105239_103211942 | 210 |
| 95 | 3300013105 | Ga0157369_10027642 | Ga0157369_100276426 | 210 |
| 96 | 3300025911 | Ga0207654_10232377 | Ga0207654_102323772 | 210 |
| 97 | 3300025912 | Ga0207707_10044293 | Ga0207707_100442932 | 210 |
| 98 | 3300025913 | Ga0207695_10081357 | Ga0207695_100813575 | 210 |
| 99 | 3300025916 | Ga0207663_10381973 | Ga0207663_103819732 | 210 |
| 100 | 3300025924 | Ga0207694_10012988 | Ga0207694_100129884 | 210 |
| 101 | 3300025949 | Ga0207667_10007941 | Ga0207667_100079419 | 210 |
| 102 | 3300026078 | Ga0207702_10171271 | Ga0207702_101712713 | 210 |
| 103 | 3300048907 | Ga0496104_0328973 | Ga0496104_0328973_49_717 | 210 |
| 104 | 3300048913 | Ga0496110_0578586 | Ga0496110_0578586_154_822 | 210 |
| 105 | 3300049574 | Ga0501038_0149649 | Ga0501038_0149649_455_1099 | 210 |
| 106 | iso_pu_bacteria | 2671180139 | 2671694560 | 210 |
| 107 | 3300005341 | Ga0070691_10040017 | Ga0070691_100400172 | 211 |
| 108 | 3300005406 | Ga0070703_10002959 | Ga0070703_100029595 | 211 |
| 109 | 3300005440 | Ga0070705_100000171 | Ga0070705_1000001713 | 211 |
| 110 | 3300005441 | Ga0070700_100002232 | Ga0070700_1000022322 | 211 |
| 111 | 3300005444 | Ga0070694_100000555 | Ga0070694_10000055516 | 211 |
| 112 | 3300005445 | Ga0070708_100053574 | Ga0070708_1000535742 | 211 |
| 113 | 3300005455 | Ga0070663_100002218 | Ga0070663_10000221810 | 211 |
| 114 | 3300005458 | Ga0070681_10004750 | Ga0070681_100047509 | 211 |
| 115 | 3300005467 | Ga0070706_100305857 | Ga0070706_1003058572 | 211 |
| 116 | 3300005518 | Ga0070699_100000167 | Ga0070699_10000016735 | 211 |
| 117 | 3300005545 | Ga0070695_100000722 | Ga0070695_10000072214 | 211 |
| 118 | 3300005546 | Ga0070696_100000097 | Ga0070696_10000009712 | 211 |
| 119 | 3300005547 | Ga0070693_100023657 | Ga0070693_1000236572 | 211 |
| 120 | 3300005549 | Ga0070704_100007113 | Ga0070704_1000071132 | 211 |
| 121 | 3300005577 | Ga0068857_100009356 | Ga0068857_10000935610 | 211 |
| 122 | 3300005617 | Ga0068859_100001658 | Ga0068859_10000165815 | 211 |
| 123 | 3300005840 | Ga0068870_10037186 | Ga0068870_100371864 | 211 |
| 124 | 3300005843 | Ga0068860_100001592 | Ga0068860_10000159212 | 211 |
| 125 | 3300005844 | Ga0068862_100001428 | Ga0068862_10000142813 | 211 |
| 126 | 3300005937 | Ga0081455_10209285 | Ga0081455_102092852 | 211 |
| 127 | 3300006846 | Ga0075430_100030537 | Ga0075430_1000305372 | 211 |
| 128 | 3300006847 | Ga0075431_100000652 | Ga0075431_10000065215 | 211 |
| 129 | 3300006847 | Ga0075431_100000793 | Ga0075431_1000007936 | 211 |
| 130 | 3300006880 | Ga0075429_100013169 | Ga0075429_1000131697 | 211 |
| 131 | 3300006931 | Ga0097620_100001658 | Ga0097620_10000165815 | 211 |
| 132 | 3300009545 | Ga0105237_10197231 | Ga0105237_101972312 | 211 |
| 133 | 3300009553 | Ga0105249_10040803 | Ga0105249_100408034 | 211 |
| 134 | 3300011119 | Ga0105246_10043734 | Ga0105246_100437344 | 211 |
| 135 | 3300013297 | Ga0157378_10025383 | Ga0157378_100253832 | 211 |
| 136 | 3300014745 | Ga0157377_10119862 | Ga0157377_101198622 | 211 |
| 137 | 3300021361 | Ga0213872_10065815 | Ga0213872_100658151 | 211 |
| 138 | 3300021441 | Ga0213871_10007602 | Ga0213871_100076022 | 211 |
| 139 | 3300025885 | Ga0207653_10001766 | Ga0207653_100017662 | 211 |
| 140 | 3300025908 | Ga0207643_10438421 | Ga0207643_104384212 | 211 |
| 141 | 3300025910 | Ga0207684_10108118 | Ga0207684_101081183 | 211 |
| 142 | 3300025912 | Ga0207707_10014508 | Ga0207707_100145082 | 211 |
| 143 | 3300025917 | Ga0207660_10005384 | Ga0207660_100053842 | 211 |
| 144 | 3300025933 | Ga0207706_10027494 | Ga0207706_100274945 | 211 |
| 145 | 3300025942 | Ga0207689_10144623 | Ga0207689_101446232 | 211 |
| 146 | 3300025961 | Ga0207712_10001350 | Ga0207712_100013503 | 211 |
| 147 | 3300026041 | Ga0207639_10054034 | Ga0207639_100540344 | 211 |
| 148 | 3300026067 | Ga0207678_10005726 | Ga0207678_1000572610 | 211 |
| 149 | 3300026075 | Ga0207708_10000296 | Ga0207708_1000029630 | 211 |
| 150 | 3300026116 | Ga0207674_10004822 | Ga0207674_1000482213 | 211 |
| 151 | 3300028380 | Ga0268265_10000508 | Ga0268265_1000050823 | 211 |
| 152 | 3300028381 | Ga0268264_10003796 | Ga0268264_100037962 | 211 |
| 153 | 3300039447 | Ga0436361_0431438 | Ga0436361_0431438_3786_4433 | 211 |
| 154 | 3300048903 | Ga0496100_0067734 | Ga0496100_0067734_355_1014 | 211 |
| 155 | 3300048904 | Ga0496101_0163936 | Ga0496101_0163936_705_1364 | 211 |
| 156 | 3300048905 | Ga0496102_0003290 | Ga0496102_0003290_5093_5752 | 211 |
| 157 | 3300048907 | Ga0496104_0150280 | Ga0496104_0150280_1465_2124 | 211 |
| 158 | 3300048909 | Ga0496106_0004830 | Ga0496106_0004830_880_1539 | 211 |
| 159 | 3300048910 | Ga0496107_0001227 | Ga0496107_0001227_10739_11398 | 211 |
| 160 | 3300048918 | Ga0496115_0037216 | Ga0496115_0037216_466_1125 | 211 |
| 161 | 3300049571 | Ga0501034_0228348 | Ga0501034_0228348_673_1311 | 211 |
| 162 | 3300049742 | Ga0501080_0496433 | Ga0501080_0496433_399_1043 | 211 |
| 163 | 3300050508 | nmdc:mga09592_15142_c1 | nmdc:mga09592_15142_c1_1121_1777 | 211 |
| 164 | 3300050510 | nmdc:mga06r32_1040_c1 | nmdc:mga06r32_1040_c1_5390_6046 | 211 |
| 165 | 3300005434 | Ga0070709_10444045 | Ga0070709_104440451 | 212 |
| 166 | 3300005841 | Ga0068863_100057437 | Ga0068863_1000574375 | 212 |
| 167 | 3300005937 | Ga0081455_10000230 | Ga0081455_1000023014 | 212 |
| 168 | 3300006844 | Ga0075428_100101601 | Ga0075428_1001016015 | 212 |
| 169 | 3300009094 | Ga0111539_10001024 | Ga0111539_1000102428 | 212 |
| 170 | 3300009094 | Ga0111539_10266125 | Ga0111539_102661254 | 212 |
| 171 | 3300009147 | Ga0114129_10031876 | Ga0114129_100318768 | 212 |
| 172 | 3300009147 | Ga0114129_10767437 | Ga0114129_107674372 | 212 |
| 173 | 3300009553 | Ga0105249_10817366 | Ga0105249_108173662 | 212 |
| 174 | 3300014326 | Ga0157380_10288056 | Ga0157380_102880562 | 212 |
| 175 | 3300025906 | Ga0207699_10578280 | Ga0207699_105782801 | 212 |
| 176 | 3300026088 | Ga0207641_10044646 | Ga0207641_100446464 | 212 |
| 177 | 3300027907 | Ga0207428_10046390 | Ga0207428_100463902 | 212 |
| 178 | 3300035724 | Ga0373933_0082406 | Ga0373933_0082406_36_689 | 212 |
| 179 | 3300036401 | Ga0373937_0006904 | Ga0373937_0006904_625_1278 | 212 |
| 180 | 3300044656 | Ga0466969_0042037 | Ga0466969_0042037_115_807 | 212 |
| 181 | 3300044684 | Ga0466966_0125763 | Ga0466966_0125763_317_1009 | 212 |
| 182 | 3300044693 | Ga0466961_0075292 | Ga0466961_0075292_843_1535 | 212 |
| 183 | 3300044719 | Ga0466971_0078708 | Ga0466971_0078708_693_1385 | 212 |
| 184 | 3300045049 | Ga0466959_0019584 | Ga0466959_0019584_2841_3533 | 212 |
| 185 | 3300045976 | Ga0466967_0082999 | Ga0466967_0082999_298_966 | 212 |
| 186 | 3300046516 | Ga0495628_0168719 | Ga0495628_0168719_431_1084 | 212 |
| 187 | 3300046809 | Ga0495600_0290597 | Ga0495600_0290597_205_858 | 212 |
| 188 | 3300050507 | nmdc:mga05p37_243473_c1 | nmdc:mga05p37_243473_c1_40_687 | 212 |
| 189 | 3300050511 | nmdc:mga08y16_140659_c1 | nmdc:mga08y16_140659_c1_368_1015 | 212 |
| 190 | 3300050511 | nmdc:mga08y16_5279_c1 | nmdc:mga08y16_5279_c1_2633_3280 | 212 |
| 191 | iso_pu_bacteria | 2791355199 | 2793081803 | 212 |
| 192 | iso_pu_bacteria | 2876808645 | 2876808905 | 212 |
| 193 | iso_pu_bacteria | 2879110137 | 2879110303 | 212 |
| 194 | iso_pu_bacteria | 2889033259 | 2889040737 | 212 |
| 195 | iso_pu_bacteria | 8056673599 | 8056678086 | 212 |
| 196 | 3300006038 | Ga0075365_10005236 | Ga0075365_100052364 | 213 |
| 197 | 3300006846 | Ga0075430_100153798 | Ga0075430_1001537982 | 213 |
| 198 | 3300006847 | Ga0075431_100036187 | Ga0075431_1000361875 | 213 |
| 199 | 3300031344 | Ga0265316_10188380 | Ga0265316_101883802 | 213 |
| 200 | 3300037068 | Ga0373925_0056161 | Ga0373925_0056161_798_1442 | 213 |
| 201 | 3300048907 | Ga0496104_0000182 | Ga0496104_0000182_18448_19095 | 213 |
| 202 | 3300048908 | Ga0496105_0016358 | Ga0496105_0016358_4542_5189 | 213 |
| 203 | 3300048911 | Ga0496108_0001152 | Ga0496108_0001152_14104_14751 | 213 |
| 204 | 3300048912 | Ga0496109_0002055 | Ga0496109_0002055_8773_9420 | 213 |
| 205 | 3300048913 | Ga0496110_0008254 | Ga0496110_0008254_483_1130 | 213 |
| 206 | 3300048914 | Ga0496111_0012429 | Ga0496111_0012429_4564_5211 | 213 |
| 207 | 3300048915 | Ga0496112_0013651 | Ga0496112_0013651_2299_2946 | 213 |
| 208 | 3300048916 | Ga0496113_0020005 | Ga0496113_0020005_3648_4295 | 213 |
| 209 | 3300049571 | Ga0501034_0369283 | Ga0501034_0369283_359_1018 | 213 |
| 210 | 3300049572 | Ga0501036_0223254 | Ga0501036_0223254_163_822 | 213 |
| 211 | 3300049822 | Ga0501035_0467243 | Ga0501035_0467243_344_1003 | 213 |
| 212 | 3300050492 | nmdc:mga0yw44_45596_c1 | nmdc:mga0yw44_45596_c1_436_1083 | 213 |
| 213 | 3300003781 | Ga0055536_1000792 | Ga0055536_10007922 | 214 |
| 214 | 3300005365 | Ga0070688_100252835 | Ga0070688_1002528351 | 214 |
| 215 | 3300005438 | Ga0070701_10259451 | Ga0070701_102594512 | 214 |
| 216 | 3300005440 | Ga0070705_100577981 | Ga0070705_1005779812 | 214 |
| 217 | 3300005841 | Ga0068863_100001297 | Ga0068863_10000129729 | 214 |
| 218 | 3300005843 | Ga0068860_100000623 | Ga0068860_10000062334 | 214 |
| 219 | 3300005844 | Ga0068862_100000194 | Ga0068862_10000019445 | 214 |
| 220 | 3300005985 | Ga0081539_10047511 | Ga0081539_100475115 | 214 |
| 221 | 3300006051 | Ga0075364_10379242 | Ga0075364_103792421 | 214 |
| 222 | 3300006846 | Ga0075430_100036840 | Ga0075430_1000368402 | 214 |
| 223 | 3300006847 | Ga0075431_100102126 | Ga0075431_1001021264 | 214 |
| 224 | 3300006871 | Ga0075434_100485302 | Ga0075434_1004853022 | 214 |
| 225 | 3300006871 | Ga0075434_100706249 | Ga0075434_1007062492 | 214 |
| 226 | 3300006931 | Ga0097620_100018941 | Ga0097620_1000189414 | 214 |
| 227 | 3300007076 | Ga0075435_100917974 | Ga0075435_1009179741 | 214 |
| 228 | 3300009553 | Ga0105249_10000135 | Ga0105249_1000013570 | 214 |
| 229 | 3300010375 | Ga0105239_10619079 | Ga0105239_106190791 | 214 |
| 230 | 3300010375 | Ga0105239_10752637 | Ga0105239_107526372 | 214 |
| 231 | 3300013297 | Ga0157378_10139457 | Ga0157378_101394573 | 214 |
| 232 | 3300014326 | Ga0157380_10732823 | Ga0157380_107328232 | 214 |
| 233 | 3300021384 | Ga0213876_10184440 | Ga0213876_101844402 | 214 |
| 234 | 3300025885 | Ga0207653_10056818 | Ga0207653_100568182 | 214 |
| 235 | 3300025923 | Ga0207681_10118411 | Ga0207681_101184113 | 214 |
| 236 | 3300025933 | Ga0207706_10296554 | Ga0207706_102965542 | 214 |
| 237 | 3300025961 | Ga0207712_10000101 | Ga0207712_1000010131 | 214 |
| 238 | 3300026035 | Ga0207703_10286456 | Ga0207703_102864562 | 214 |
| 239 | 3300026088 | Ga0207641_10097239 | Ga0207641_100972393 | 214 |
| 240 | 3300026089 | Ga0207648_10901589 | Ga0207648_109015891 | 214 |
| 241 | 3300026118 | Ga0207675_100112912 | Ga0207675_1001129122 | 214 |
| 242 | 3300027907 | Ga0207428_10704229 | Ga0207428_107042291 | 214 |
| 243 | 3300028380 | Ga0268265_10000151 | Ga0268265_1000015169 | 214 |
| 244 | 3300028381 | Ga0268264_10000303 | Ga0268264_1000030363 | 214 |
| 245 | 3300039437 | Ga0436365_1673354 | Ga0436365_1673354_344_994 | 214 |
| 246 | 3300045051 | Ga0451576_0027187 | Ga0451576_0027187_1528_2205 | 214 |
| 247 | 3300045051 | Ga0451576_0110064 | Ga0451576_0110064_2043_2732 | 214 |
| 248 | 3300048905 | Ga0496102_0063257 | Ga0496102_0063257_2425_3081 | 214 |
| 249 | 3300048906 | Ga0496103_0314140 | Ga0496103_0314140_255_911 | 214 |
| 250 | 3300048907 | Ga0496104_0152048 | Ga0496104_0152048_913_1569 | 214 |
| 251 | 3300048908 | Ga0496105_0252568 | Ga0496105_0252568_200_856 | 214 |
| 252 | 3300048910 | Ga0496107_0096715 | Ga0496107_0096715_433_1089 | 214 |
| 253 | 3300048911 | Ga0496108_0092022 | Ga0496108_0092022_1072_1728 | 214 |
| 254 | 3300048912 | Ga0496109_0131046 | Ga0496109_0131046_273_929 | 214 |
| 255 | 3300048912 | Ga0496109_0378231 | Ga0496109_0378231_22_678 | 214 |
| 256 | 3300048913 | Ga0496110_0036848 | Ga0496110_0036848_281_937 | 214 |
| 257 | 3300048913 | Ga0496110_0088176 | Ga0496110_0088176_725_1381 | 214 |
| 258 | 3300048916 | Ga0496113_0086437 | Ga0496113_0086437_600_1256 | 214 |
| 259 | 3300048917 | Ga0496114_0200420 | Ga0496114_0200420_186_842 | 214 |
| 260 | 3300048918 | Ga0496115_0168281 | Ga0496115_0168281_1061_1717 | 214 |
| 261 | 3300049574 | Ga0501038_0423432 | Ga0501038_0423432_104_799 | 214 |
| 262 | 3300049575 | Ga0501039_0184135 | Ga0501039_0184135_436_1131 | 214 |
| 263 | 3300049576 | Ga0501040_0210412 | Ga0501040_0210412_486_1190 | 214 |
| 264 | 3300049586 | Ga0501070_0362359 | Ga0501070_0362359_394_1089 | 214 |
| 265 | 3300049587 | Ga0501071_0234134 | Ga0501071_0234134_226_921 | 214 |
| 266 | 3300049590 | Ga0501074_0296866 | Ga0501074_0296866_238_933 | 214 |
| 267 | 3300049592 | Ga0501076_0012958 | Ga0501076_0012958_559_1254 | 214 |
| 268 | 3300049593 | Ga0501077_0029077 | Ga0501077_0029077_1689_2384 | 214 |
| 269 | 3300049824 | Ga0501045_0076772 | Ga0501045_0076772_1114_1809 | 214 |
| 270 | 3300050508 | nmdc:mga09592_280333_c1 | nmdc:mga09592_280333_c1_498_1154 | 214 |
| 271 | 3300050509 | nmdc:mga0qj67_171880_c1 | nmdc:mga0qj67_171880_c1_425_1081 | 214 |
| 272 | 3300050509 | nmdc:mga0qj67_39723_c1 | nmdc:mga0qj67_39723_c1_2293_2949 | 214 |
| 273 | 3300050510 | nmdc:mga06r32_212204_c1 | nmdc:mga06r32_212204_c1_746_1402 | 214 |
| 274 | 3300050510 | nmdc:mga06r32_88502_c1 | nmdc:mga06r32_88502_c1_661_1317 | 214 |
| 275 | 3300050513 | nmdc:mga0rr50_369426_c1 | nmdc:mga0rr50_369426_c1_257_913 | 214 |
| 276 | 3300054114 | Ga0501084_0026219 | Ga0501084_0026219_2097_2792 | 214 |
| 277 | 3300005356 | Ga0070674_100414320 | Ga0070674_1004143201 | 215 |
| 278 | 3300005455 | Ga0070663_100105639 | Ga0070663_1001056392 | 215 |
| 279 | 3300005546 | Ga0070696_100098339 | Ga0070696_1000983392 | 215 |
| 280 | 3300005578 | Ga0068854_100568276 | Ga0068854_1005682762 | 215 |
| 281 | 3300009098 | Ga0105245_10376994 | Ga0105245_103769942 | 215 |
| 282 | 3300011119 | Ga0105246_10228958 | Ga0105246_102289581 | 215 |
| 283 | 3300025937 | Ga0207669_10128014 | Ga0207669_101280142 | 215 |
| 284 | 3300026067 | Ga0207678_10386905 | Ga0207678_103869052 | 215 |
| 285 | 3300026089 | Ga0207648_10083975 | Ga0207648_100839754 | 215 |
| 286 | 3300031548 | Ga0307408_100207219 | Ga0307408_1002072192 | 215 |
| 287 | 3300031731 | Ga0307405_10205343 | Ga0307405_102053432 | 215 |
| 288 | 3300031903 | Ga0307407_10256931 | Ga0307407_102569312 | 215 |
| 289 | 3300034819 | Ga0373958_0014878 | Ga0373958_0014878_454_1125 | 215 |
| 290 | 3300034957 | Ga0373938_0068776 | Ga0373938_0068776_17_688 | 215 |
| 291 | 3300035085 | Ga0373929_0025233 | Ga0373929_0025233_65_718 | 215 |
| 292 | 3300035091 | Ga0373951_0016900 | Ga0373951_0016900_947_1618 | 215 |
| 293 | 3300035114 | Ga0373939_0006111 | Ga0373939_0006111_1476_2132 | 215 |
| 294 | 3300035115 | Ga0373941_0001972 | Ga0373941_0001972_1424_2095 | 215 |
| 295 | 3300035121 | Ga0373960_0021196 | Ga0373960_0021196_205_876 | 215 |
| 296 | 3300035691 | Ga0373931_0004666 | Ga0373931_0004666_4253_4924 | 215 |
| 297 | 3300035695 | Ga0373927_0118770 | Ga0373927_0118770_102_755 | 215 |
| 298 | 3300046455 | Ga0495603_0052164 | Ga0495603_0052164_1458_2114 | 215 |
| 299 | 3300046457 | Ga0495590_0043258 | Ga0495590_0043258_265_921 | 215 |
| 300 | 3300046473 | Ga0495582_0276643 | Ga0495582_0276643_121_774 | 215 |
| 301 | 3300046473 | Ga0495582_0424562 | Ga0495582_0424562_19_675 | 215 |
| 302 | 3300046506 | Ga0495583_0041932 | Ga0495583_0041932_751_1407 | 215 |
| 303 | 3300046616 | Ga0495668_0244147 | Ga0495668_0244147_240_896 | 215 |
| 304 | 3300046648 | Ga0495611_0037715 | Ga0495611_0037715_584_1240 | 215 |
| 305 | 3300046694 | Ga0495649_0041881 | Ga0495649_0041881_1366_2022 | 215 |
| 306 | 3300046794 | Ga0495589_0061902 | Ga0495589_0061902_1067_1723 | 215 |
| 307 | 3300047320 | Ga0495672_0024387 | Ga0495672_0024387_1622_2278 | 215 |
| 308 | 3300047469 | Ga0495673_0110508 | Ga0495673_0110508_171_947 | 215 |
| 309 | 3300048927 | Ga0496124_0016861 | Ga0496124_0016861_4482_5150 | 215 |
| 310 | 3300050511 | nmdc:mga08y16_371687_c1 | nmdc:mga08y16_371687_c1_770_1438 | 215 |
| 311 | 3300053085 | Ga0495619_0593264 | Ga0495619_0593264_61_735 | 215 |
| 312 | 3300053098 | Ga0500650_0202708 | Ga0500650_0202708_57_713 | 215 |
| 313 | 3300053133 | Ga0500655_043209 | Ga0500655_043209_160_816 | 215 |
| 314 | iso_pu_bacteria | 2508501009 | 2508543532 | 215 |
| 315 | iso_pu_bacteria | 2508501042 | 2508698690 | 215 |
| 316 | iso_pu_bacteria | 2511231028 | 2511395151 | 215 |
| 317 | iso_pu_bacteria | 2513237096 | 2513656524 | 215 |
| 318 | iso_pu_bacteria | 2513237137 | 2513859592 | 215 |
| 319 | iso_pu_bacteria | 2513237145 | 2513917709 | 215 |
| 320 | iso_pu_bacteria | 2515154112 | 2515631317 | 215 |
| 321 | iso_pu_bacteria | 2517093001 | 2517106637 | 215 |
| 322 | iso_pu_bacteria | 2517572143 | 2517893218 | 215 |
| 323 | iso_pu_bacteria | 2523231067 | 2523467256 | 215 |
| 324 | iso_pu_bacteria | 2524023228 | 2524537228 | 215 |
| 325 | iso_pu_bacteria | 2667528175 | 2671117854 | 215 |
| 326 | iso_pu_bacteria | 2791355197 | 2793069915 | 215 |
| 327 | iso_pu_bacteria | 2824661429 | 2824666274 | 215 |
| 328 | iso_pu_bacteria | 2874590934 | 2874591915 | 215 |
| 329 | iso_pu_bacteria | 2874645413 | 2874651249 | 215 |
| 330 | iso_pu_bacteria | 2876771140 | 2876771506 | 215 |
| 331 | iso_pu_bacteria | 2876818435 | 2876819459 | 215 |
| 332 | iso_pu_bacteria | 2879074833 | 2879075911 | 215 |
| 333 | iso_pu_bacteria | 2885374607 | 2885374809 | 215 |
| 334 | iso_pu_bacteria | 2888388044 | 2888394724 | 215 |
| 335 | iso_pu_bacteria | 2903748898 | 2903755682 | 215 |
| 336 | iso_pu_bacteria | 2904699407 | 2904704187 | 215 |
| 337 | iso_pu_bacteria | 2906610324 | 2906617578 | 215 |
| 338 | iso_pu_bacteria | 2906635258 | 2906635777 | 215 |
| 339 | iso_pu_bacteria | 2906660503 | 2906667919 | 215 |
| 340 | iso_pu_bacteria | 2908739725 | 2908743611 | 215 |
| 341 | iso_pu_bacteria | 2922425934 | 2922429265 | 215 |
| 342 | iso_pu_bacteria | 2929615660 | 2929615661 | 215 |
| 343 | iso_pu_bacteria | 2929624759 | 2929630276 | 215 |
| 344 | iso_pu_bacteria | 2932828146 | 2932835980 | 215 |
| 345 | iso_pu_bacteria | 2933577622 | 2933579052 | 215 |
| 346 | iso_pu_bacteria | 2935630451 | 2935634155 | 215 |
| 347 | iso_pu_bacteria | 2935638405 | 2935647296 | 215 |
| 348 | iso_pu_bacteria | 2935648319 | 2935651697 | 215 |
| 349 | iso_pu_bacteria | 2935656913 | 2935660507 | 215 |
| 350 | iso_pu_bacteria | 2935665750 | 2935674398 | 215 |
| 351 | iso_pu_bacteria | 2935810662 | 2935818953 | 215 |
| 352 | iso_pu_bacteria | 2935827899 | 2935836673 | 215 |
| 353 | iso_pu_bacteria | 2935975950 | 2935980824 | 215 |
| 354 | iso_pu_bacteria | 2935984226 | 2935990308 | 215 |
| 355 | iso_pu_bacteria | 2936011229 | 2936014563 | 215 |
| 356 | iso_pu_bacteria | 2936019824 | 2936023641 | 215 |
| 357 | iso_pu_bacteria | 2936028420 | 2936032669 | 215 |
| 358 | iso_pu_bacteria | 2936037263 | 2936045667 | 215 |
| 359 | iso_pu_bacteria | 2936046547 | 2936050304 | 215 |
| 360 | iso_pu_bacteria | 2936055302 | 2936059204 | 215 |
| 361 | iso_pu_bacteria | 2941507105 | 2941511046 | 215 |
| 362 | iso_pu_bacteria | 2941515067 | 2941518430 | 215 |
| 363 | iso_pu_bacteria | 2941523033 | 2941527307 | 215 |
| 364 | iso_pu_bacteria | 3005474847 | 3005479429 | 215 |
| 365 | iso_pu_bacteria | 8006933436 | 8006941724 | 215 |
| 366 | iso_pu_bacteria | 8006973647 | 8006981438 | 215 |
| 367 | iso_pu_bacteria | 8016511872 | 8016514428 | 215 |
| 368 | iso_pu_bacteria | 8016583857 | 8016592949 | 215 |
| 369 | iso_pu_bacteria | 8016630954 | 8016632003 | 215 |
| 370 | iso_pu_bacteria | 8017057580 | 8017061997 | 215 |
| 371 | iso_pu_bacteria | 8019555841 | 8019557625 | 215 |
| 372 | iso_pu_bacteria | 8019619141 | 8019627172 | 215 |
| 373 | iso_pu_bacteria | 8019629233 | 8019635377 | 215 |
| 374 | iso_pu_bacteria | 8019638758 | 8019644327 | 215 |
| 375 | iso_pu_bacteria | 8019659431 | 8019663203 | 215 |
| 376 | iso_pu_bacteria | 8019668869 | 8019672810 | 215 |
| 377 | iso_pu_bacteria | 8019678201 | 8019683329 | 215 |
| 378 | iso_pu_bacteria | 8055742211 | 8055747309 | 215 |
| 379 | iso_pu_bacteria | 8056689827 | 8056690295 | 215 |
| 380 | 3300005341 | Ga0070691_10128741 | Ga0070691_101287412 | 216 |
| 381 | 3300005344 | Ga0070661_100085416 | Ga0070661_1000854163 | 216 |
| 382 | 3300005353 | Ga0070669_100235528 | Ga0070669_1002355281 | 216 |
| 383 | 3300005356 | Ga0070674_100013377 | Ga0070674_1000133776 | 216 |
| 384 | 3300005459 | Ga0068867_100203869 | Ga0068867_1002038691 | 216 |
| 385 | 3300005544 | Ga0070686_100018540 | Ga0070686_1000185402 | 216 |
| 386 | 3300005547 | Ga0070693_100175755 | Ga0070693_1001757552 | 216 |
| 387 | 3300005548 | Ga0070665_100513659 | Ga0070665_1005136592 | 216 |
| 388 | 3300005564 | Ga0070664_100213309 | Ga0070664_1002133091 | 216 |
| 389 | 3300005615 | Ga0070702_100083117 | Ga0070702_1000831172 | 216 |
| 390 | 3300005718 | Ga0068866_10011028 | Ga0068866_100110285 | 216 |
| 391 | 3300005719 | Ga0068861_100023275 | Ga0068861_1000232756 | 216 |
| 392 | 3300005843 | Ga0068860_100299305 | Ga0068860_1002993052 | 216 |
| 393 | 3300005844 | Ga0068862_100021469 | Ga0068862_1000214696 | 216 |
| 394 | 3300005937 | Ga0081455_10005420 | Ga0081455_100054205 | 216 |
| 395 | 3300005937 | Ga0081455_10065103 | Ga0081455_100651034 | 216 |
| 396 | 3300005983 | Ga0081540_1000423 | Ga0081540_100042338 | 216 |
| 397 | 3300006195 | Ga0075366_10538257 | Ga0075366_105382571 | 216 |
| 398 | 3300006881 | Ga0068865_100026656 | Ga0068865_1000266562 | 216 |
| 399 | 3300009094 | Ga0111539_10749462 | Ga0111539_107494621 | 216 |
| 400 | 3300009148 | Ga0105243_10278187 | Ga0105243_102781872 | 216 |
| 401 | 3300009174 | Ga0105241_10533436 | Ga0105241_105334361 | 216 |
| 402 | 3300014325 | Ga0163163_10413721 | Ga0163163_104137212 | 216 |
| 403 | 3300014745 | Ga0157377_10114456 | Ga0157377_101144562 | 216 |
| 404 | 3300014968 | Ga0157379_10572245 | Ga0157379_105722452 | 216 |
| 405 | 3300014969 | Ga0157376_10564819 | Ga0157376_105648192 | 216 |
| 406 | 3300017792 | Ga0163161_10049221 | Ga0163161_100492212 | 216 |
| 407 | 3300025899 | Ga0207642_10026215 | Ga0207642_100262152 | 216 |
| 408 | 3300025918 | Ga0207662_10116581 | Ga0207662_101165812 | 216 |
| 409 | 3300025923 | Ga0207681_10240798 | Ga0207681_102407982 | 216 |
| 410 | 3300025927 | Ga0207687_10462458 | Ga0207687_104624582 | 216 |
| 411 | 3300025932 | Ga0207690_10150091 | Ga0207690_101500913 | 216 |
| 412 | 3300025933 | Ga0207706_10046897 | Ga0207706_100468973 | 216 |
| 413 | 3300025935 | Ga0207709_10060686 | Ga0207709_100606861 | 216 |
| 414 | 3300025972 | Ga0207668_10040749 | Ga0207668_100407492 | 216 |
| 415 | 3300025972 | Ga0207668_10507438 | Ga0207668_105074382 | 216 |
| 416 | 3300026067 | Ga0207678_10097086 | Ga0207678_100970862 | 216 |
| 417 | 3300026075 | Ga0207708_10032322 | Ga0207708_100323224 | 216 |
| 418 | 3300026121 | Ga0207683_10080458 | Ga0207683_100804583 | 216 |
| 419 | 3300028379 | Ga0268266_10460187 | Ga0268266_104601872 | 216 |
| 420 | 3300028380 | Ga0268265_10026653 | Ga0268265_100266535 | 216 |
| 421 | 3300028381 | Ga0268264_10059275 | Ga0268264_100592752 | 216 |
| 422 | 3300039437 | Ga0436365_1501284 | Ga0436365_1501284_2990_3727 | 216 |
| 423 | 3300042876 | Ga0451577_0147776 | Ga0451577_0147776_638_1306 | 216 |
| 424 | 3300046474 | Ga0495605_0055791 | Ga0495605_0055791_409_1065 | 216 |
| 425 | 3300046513 | Ga0495616_0037479 | Ga0495616_0037479_1746_2402 | 216 |
| 426 | 3300046615 | Ga0495656_0021282 | Ga0495656_0021282_38_694 | 216 |
| 427 | 3300046684 | Ga0495669_0002716 | Ga0495669_0002716_4620_5276 | 216 |
| 428 | 3300046691 | Ga0495670_0116490 | Ga0495670_0116490_322_978 | 216 |
| 429 | 3300047472 | Ga0495686_0170559 | Ga0495686_0170559_307_963 | 216 |
| 430 | 3300048090 | Ga0495615_0085706 | Ga0495615_0085706_170_826 | 216 |
| 431 | 3300048905 | Ga0496102_0025292 | Ga0496102_0025292_639_1292 | 216 |
| 432 | 3300048906 | Ga0496103_0124712 | Ga0496103_0124712_928_1581 | 216 |
| 433 | 3300048909 | Ga0496106_0739694 | Ga0496106_0739694_71_727 | 216 |
| 434 | 3300048917 | Ga0496114_0162081 | Ga0496114_0162081_680_1336 | 216 |
| 435 | 3300048918 | Ga0496115_0096864 | Ga0496115_0096864_838_1494 | 216 |
| 436 | 3300048918 | Ga0496115_0460152 | Ga0496115_0460152_144_797 | 216 |
| 437 | 3300049581 | Ga0501047_0331608 | Ga0501047_0331608_74_733 | 216 |
| 438 | 3300049592 | Ga0501076_0033571 | Ga0501076_0033571_3212_3868 | 216 |
| 439 | 3300050492 | nmdc:mga0yw44_304098_c1 | nmdc:mga0yw44_304098_c1_389_1042 | 216 |
| 440 | 3300050511 | nmdc:mga08y16_654463_c1 | nmdc:mga08y16_654463_c1_353_1021 | 216 |
| 441 | iso_pu_bacteria | 2513237098 | 2513676801 | 216 |
| 442 | 3300005262 | Ga0065165_1002461 | Ga0065165_10024617 | 217 |
| 443 | 3300006852 | Ga0075433_10308314 | Ga0075433_103083142 | 217 |
| 444 | 3300006871 | Ga0075434_100139069 | Ga0075434_1001390692 | 217 |
| 445 | 3300025302 | Ga0207426_1001063 | Ga0207426_10010639 | 217 |
| 446 | 3300028379 | Ga0268266_10095574 | Ga0268266_100955742 | 217 |
| 447 | 3300037466 | Ga0395898_0408602 | Ga0395898_0408602_395_1054 | 217 |
| 448 | 3300038443 | Ga0395901_0776576 | Ga0395901_0776576_55_714 | 217 |
| 449 | 3300046524 | Ga0495648_0232528 | Ga0495648_0232528_144_821 | 217 |
| 450 | 3300046648 | Ga0495611_0192823 | Ga0495611_0192823_207_884 | 217 |
| 451 | 3300048917 | Ga0496114_0124231 | Ga0496114_0124231_889_1584 | 217 |
| 452 | 3300048918 | Ga0496115_0137187 | Ga0496115_0137187_180_875 | 217 |
| 453 | 3300049569 | Ga0501032_0077494 | Ga0501032_0077494_1401_2060 | 217 |
| 454 | 3300049581 | Ga0501047_0374238 | Ga0501047_0374238_60_719 | 217 |
| 455 | 3300049586 | Ga0501070_0369030 | Ga0501070_0369030_37_696 | 217 |
| 456 | 3300049822 | Ga0501035_0143338 | Ga0501035_0143338_1272_1931 | 217 |
| 457 | 3300049823 | Ga0501044_0775571 | Ga0501044_0775571_110_769 | 217 |
| 458 | 3300053087 | Ga0500643_000025 | Ga0500643_000025_99916_100593 | 217 |
| 459 | 3300053096 | Ga0500641_0065665 | Ga0500641_0065665_208_885 | 217 |
| 460 | 3300053103 | Ga0500555_002304 | Ga0500555_002304_560_1237 | 217 |
| 461 | 3300053130 | Ga0500642_0007503 | Ga0500642_0007503_1052_1729 | 217 |
| 462 | 3300053139 | Ga0500568_0008868 | Ga0500568_0008868_1917_2594 | 217 |
| 463 | 3300053147 | Ga0500589_134775 | Ga0500589_134775_256_933 | 217 |
| 464 | 3300053158 | Ga0500627_0008486 | Ga0500627_0008486_2820_3497 | 217 |
| 465 | 3300053730 | Ga0500645_082044 | Ga0500645_082044_158_835 | 217 |
| 466 | 3300003215 | JGI25153J46596_10013737 | JGI25153J46596_100137375 | 218 |
| 467 | 3300003215 | JGI25153J46596_10034134 | JGI25153J46596_100341342 | 218 |
| 468 | 3300003759 | Ga0055525_1006398 | Ga0055525_10063982 | 218 |
| 469 | 3300005327 | Ga0070658_10054028 | Ga0070658_100540284 | 218 |
| 470 | 3300005339 | Ga0070660_100345609 | Ga0070660_1003456092 | 218 |
| 471 | 3300005547 | Ga0070693_100404262 | Ga0070693_1004042622 | 218 |
| 472 | 3300006186 | Ga0075369_10044754 | Ga0075369_100447542 | 218 |
| 473 | 3300006195 | Ga0075366_10118075 | Ga0075366_101180752 | 218 |
| 474 | 3300013297 | Ga0157378_10335847 | Ga0157378_103358472 | 218 |
| 475 | 3300025230 | Ga0209563_101101 | Ga0209563_1011015 | 218 |
| 476 | 3300025253 | Ga0209677_102497 | Ga0209677_1024977 | 218 |
| 477 | 3300025273 | Ga0209673_1039315 | Ga0209673_10393152 | 218 |
| 478 | 3300025295 | Ga0209564_1002681 | Ga0209564_10026812 | 218 |
| 479 | 3300025295 | Ga0209564_1017449 | Ga0209564_10174495 | 218 |
| 480 | 3300025297 | Ga0209758_1003040 | Ga0209758_100304014 | 218 |
| 481 | 3300025297 | Ga0209758_1003616 | Ga0209758_10036169 | 218 |
| 482 | 3300025299 | Ga0209256_1003151 | Ga0209256_10031519 | 218 |
| 483 | 3300025302 | Ga0207426_1000596 | Ga0207426_100059626 | 218 |
| 484 | 3300025919 | Ga0207657_10042204 | Ga0207657_100422044 | 218 |
| 485 | 3300026078 | Ga0207702_10800954 | Ga0207702_108009542 | 218 |
| 486 | 3300033180 | Ga0307510_10031031 | Ga0307510_100310316 | 218 |
| 487 | 3300033180 | Ga0307510_10042319 | Ga0307510_100423196 | 218 |
| 488 | 3300033180 | Ga0307510_10285351 | Ga0307510_102853512 | 218 |
| 489 | 3300037853 | Ga0436364_0954368 | Ga0436364_0954368_36_716 | 218 |
| 490 | 3300041460 | Ga0451802_0229276 | Ga0451802_0229276_96_770 | 218 |
| 491 | 3300046454 | Ga0495592_0123465 | Ga0495592_0123465_603_1277 | 218 |
| 492 | 3300046459 | Ga0495629_0004968 | Ga0495629_0004968_3637_4311 | 218 |
| 493 | 3300046507 | Ga0495606_0155650 | Ga0495606_0155650_180_854 | 218 |
| 494 | 3300046511 | Ga0495608_0124875 | Ga0495608_0124875_194_868 | 218 |
| 495 | 3300046514 | Ga0495618_0207985 | Ga0495618_0207985_47_721 | 218 |
| 496 | 3300046524 | Ga0495648_0044488 | Ga0495648_0044488_1474_2148 | 218 |
| 497 | 3300046530 | Ga0495654_0186340 | Ga0495654_0186340_48_722 | 218 |
| 498 | 3300046531 | Ga0495665_0344006 | Ga0495665_0344006_44_718 | 218 |
| 499 | 3300046536 | Ga0495587_0145172 | Ga0495587_0145172_61_735 | 218 |
| 500 | 3300046557 | Ga0495622_0028661 | Ga0495622_0028661_891_1565 | 218 |
| 501 | 3300046660 | Ga0495625_0194413 | Ga0495625_0194413_204_878 | 218 |
| 502 | 3300046663 | Ga0495635_0021418 | Ga0495635_0021418_1065_1739 | 218 |
| 503 | 3300046675 | Ga0495657_0082366 | Ga0495657_0082366_1211_1885 | 218 |
| 504 | 3300046679 | Ga0495623_0155529 | Ga0495623_0155529_354_1028 | 218 |
| 505 | 3300046680 | Ga0495646_0080631 | Ga0495646_0080631_437_1111 | 218 |
| 506 | 3300046683 | Ga0495658_0334451 | Ga0495658_0334451_168_842 | 218 |
| 507 | 3300046689 | Ga0495613_0074903 | Ga0495613_0074903_1020_1694 | 218 |
| 508 | 3300046690 | Ga0495624_0123530 | Ga0495624_0123530_677_1351 | 218 |
| 509 | 3300046692 | Ga0495671_0109872 | Ga0495671_0109872_410_1084 | 218 |
| 510 | 3300046694 | Ga0495649_0038722 | Ga0495649_0038722_196_870 | 218 |
| 511 | 3300046809 | Ga0495600_0050462 | Ga0495600_0050462_1528_2202 | 218 |
| 512 | 3300047315 | Ga0495581_0174708 | Ga0495581_0174708_135_809 | 218 |
| 513 | 3300047321 | Ga0495676_0032128 | Ga0495676_0032128_2976_3650 | 218 |
| 514 | 3300047469 | Ga0495673_0167862 | Ga0495673_0167862_89_763 | 218 |
| 515 | 3300047673 | Ga0495593_0080837 | Ga0495593_0080837_692_1366 | 218 |
| 516 | 3300048907 | Ga0496104_0040114 | Ga0496104_0040114_2822_3496 | 218 |
| 517 | 3300048908 | Ga0496105_0110087 | Ga0496105_0110087_1210_1884 | 218 |
| 518 | 3300048916 | Ga0496113_0235526 | Ga0496113_0235526_387_1061 | 218 |
| 519 | 3300048918 | Ga0496115_0162457 | Ga0496115_0162457_282_956 | 218 |
| 520 | 3300048919 | Ga0496116_0232006 | Ga0496116_0232006_71_745 | 218 |
| 521 | 3300048922 | Ga0496119_0016935 | Ga0496119_0016935_3183_3857 | 218 |
| 522 | 3300048923 | Ga0496120_0124632 | Ga0496120_0124632_91_765 | 218 |
| 523 | 3300048927 | Ga0496124_0152553 | Ga0496124_0152553_503_1177 | 218 |
| 524 | 3300048928 | Ga0496125_0096968 | Ga0496125_0096968_516_1190 | 218 |
| 525 | 3300048928 | Ga0496125_0296150 | Ga0496125_0296150_72_746 | 218 |
| 526 | 3300049460 | Ga0495682_0040447 | Ga0495682_0040447_882_1556 | 218 |
| 527 | 3300049570 | Ga0501033_0609990 | Ga0501033_0609990_33_698 | 218 |
| 528 | 3300049571 | Ga0501034_0000391 | Ga0501034_0000391_55287_55952 | 218 |
| 529 | 3300049572 | Ga0501036_0062691 | Ga0501036_0062691_499_1164 | 218 |
| 530 | 3300049574 | Ga0501038_0112787 | Ga0501038_0112787_464_1129 | 218 |
| 531 | 3300049575 | Ga0501039_0000070 | Ga0501039_0000070_49127_49792 | 218 |
| 532 | 3300049579 | Ga0501043_0044532 | Ga0501043_0044532_1131_1796 | 218 |
| 533 | 3300049580 | Ga0501046_0007046 | Ga0501046_0007046_5391_6056 | 218 |
| 534 | 3300049581 | Ga0501047_0000102 | Ga0501047_0000102_20483_21148 | 218 |
| 535 | 3300049583 | Ga0501067_0005270 | Ga0501067_0005270_355_1020 | 218 |
| 536 | 3300049586 | Ga0501070_0021105 | Ga0501070_0021105_762_1427 | 218 |
| 537 | 3300049742 | Ga0501080_0000028 | Ga0501080_0000028_38039_38704 | 218 |
| 538 | 3300049822 | Ga0501035_0000020 | Ga0501035_0000020_57861_58526 | 218 |
| 539 | 3300049823 | Ga0501044_0000007 | Ga0501044_0000007_123041_123706 | 218 |
| 540 | 3300049824 | Ga0501045_0084042 | Ga0501045_0084042_171_836 | 218 |
| 541 | 3300050491 | nmdc:mga00v17_172718_c1 | nmdc:mga00v17_172718_c1_338_1012 | 218 |
| 542 | 3300050493 | nmdc:mga0k408_132933_c1 | nmdc:mga0k408_132933_c1_549_1223 | 218 |
| 543 | 3300050516 | nmdc:mga0sz30_18114_c1 | nmdc:mga0sz30_18114_c1_2063_2737 | 218 |
| 544 | 3300053083 | Ga0495655_0089423 | Ga0495655_0089423_185_859 | 218 |
| 545 | 3300053086 | Ga0500578_0106784 | Ga0500578_0106784_354_1028 | 218 |
| 546 | 3300053088 | Ga0500644_0032464 | Ga0500644_0032464_246_920 | 218 |
| 547 | 3300053109 | Ga0500569_018641 | Ga0500569_018641_1081_1755 | 218 |
| 548 | 3300053111 | Ga0500572_034326 | Ga0500572_034326_357_1031 | 218 |
| 549 | 3300053121 | Ga0500607_027067 | Ga0500607_027067_2446_3120 | 218 |
| 550 | 3300053123 | Ga0500614_045766 | Ga0500614_045766_421_1095 | 218 |
| 551 | 3300053134 | Ga0500658_0133994 | Ga0500658_0133994_352_1026 | 218 |
| 552 | 3300053136 | Ga0500559_0034055 | Ga0500559_0034055_1226_1900 | 218 |
| 553 | 3300053136 | Ga0500559_0035588 | Ga0500559_0035588_537_1211 | 218 |
| 554 | 3300053150 | Ga0500603_002147 | Ga0500603_002147_3263_3958 | 218 |
| 555 | 3300053154 | Ga0500619_000868 | Ga0500619_000868_3990_4664 | 218 |
| 556 | 3300053160 | Ga0500633_0020495 | Ga0500633_0020495_336_1013 | 218 |
| 557 | 3300053162 | Ga0500638_011578 | Ga0500638_011578_3224_3898 | 218 |
| 558 | 3300053177 | Ga0500636_0284226 | Ga0500636_0284226_48_722 | 218 |
| 559 | 3300060353 | Ga0501082_0051487 | Ga0501082_0051487_2299_2964 | 218 |
| 560 | 3300061734 | Ga0530510_0136303 | Ga0530510_0136303_333_1013 | 218 |
| 561 | 3300003214 | JGI25165J46597_1011751 | JGI25165J46597_10117512 | 219 |
| 562 | 3300005435 | Ga0070714_100058060 | Ga0070714_1000580602 | 219 |
| 563 | 3300005436 | Ga0070713_100047485 | Ga0070713_1000474853 | 219 |
| 564 | 3300005985 | Ga0081539_10000231 | Ga0081539_1000023181 | 219 |
| 565 | 3300006028 | Ga0070717_10031151 | Ga0070717_100311515 | 219 |
| 566 | 3300013297 | Ga0157378_10025603 | Ga0157378_100256032 | 219 |
| 567 | 3300021388 | Ga0213875_10021595 | Ga0213875_100215955 | 219 |
| 568 | 3300025261 | Ga0209233_1026715 | Ga0209233_10267152 | 219 |
| 569 | 3300025929 | Ga0207664_10142487 | Ga0207664_101424872 | 219 |
| 570 | 3300025944 | Ga0207661_10307155 | Ga0207661_103071551 | 219 |
| 571 | 3300025986 | Ga0207658_10212172 | Ga0207658_102121723 | 219 |
| 572 | 3300028379 | Ga0268266_10653362 | Ga0268266_106533622 | 219 |
| 573 | 3300031238 | Ga0265332_10010810 | Ga0265332_100108105 | 219 |
| 574 | 3300031247 | Ga0265340_10131148 | Ga0265340_101311482 | 219 |
| 575 | 3300031249 | Ga0265339_10276108 | Ga0265339_102761081 | 219 |
| 576 | 3300031344 | Ga0265316_10463540 | Ga0265316_104635402 | 219 |
| 577 | 3300031712 | Ga0265342_10227084 | Ga0265342_102270842 | 219 |
| 578 | 3300032126 | Ga0307415_100755715 | Ga0307415_1007557152 | 219 |
| 579 | 3300033544 | Ga0316215_1007363 | Ga0316215_10073631 | 219 |
| 580 | 3300035410 | Ga0373924_0027381 | Ga0373924_0027381_157_852 | 219 |
| 581 | 3300035695 | Ga0373927_0038409 | Ga0373927_0038409_1338_2033 | 219 |
| 582 | 3300036712 | Ga0316584_0036211 | Ga0316584_0036211_2891_3637 | 219 |
| 583 | 3300037466 | Ga0395898_0742938 | Ga0395898_0742938_70_735 | 219 |
| 584 | 3300037853 | Ga0436364_0075557 | Ga0436364_0075557_8171_8845 | 219 |
| 585 | 3300046472 | Ga0495580_0373031 | Ga0495580_0373031_84_785 | 219 |
| 586 | 3300046507 | Ga0495606_0005580 | Ga0495606_0005580_10614_11306 | 219 |
| 587 | 3300047319 | Ga0495674_0586613 | Ga0495674_0586613_104_805 | 219 |
| 588 | 3300048905 | Ga0496102_0397934 | Ga0496102_0397934_154_813 | 219 |
| 589 | 3300048928 | Ga0496125_0004318 | Ga0496125_0004318_6836_7555 | 219 |
| 590 | 3300048929 | Ga0496126_0100701 | Ga0496126_0100701_1661_2359 | 219 |
| 591 | 3300048929 | Ga0496126_0218628 | Ga0496126_0218628_375_1034 | 219 |
| 592 | 3300048929 | Ga0496126_0495796 | Ga0496126_0495796_265_960 | 219 |
| 593 | 3300049571 | Ga0501034_0004261 | Ga0501034_0004261_12674_13360 | 219 |
| 594 | 3300049581 | Ga0501047_0081221 | Ga0501047_0081221_493_1197 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.9318 | 17 | 216 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.8176 | 17 | 218 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.8159 | 17 | 216 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.7604 | 17 | 218 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.7478 | 17 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9285 | 17 | 216 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8765 | 7 | 216 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8383 | 7 | 216 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8159 | 17 | 216 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.808 | 17 | 218 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q2IWV2-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9999 | 22 | 218 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A1M3ADW1-F1-model_v4 | deleted | 0.9994 | 22 | 179 |
|
| AF-A0A257XB46-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9988 | 14 | 191 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A537NUU7-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9974 | 14 | 206 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A3D2L3Z4-F1-model_v4 | Uracil-DNA glycosylase | 0.9968 | 24 | 155 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar