F467389

General Info

Members Datasets Scaffolds Average Seq Length
594 399 520 220

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0343298|Ga0496121_0343298_91_753
Length 220
Sequence VVATAISAGTSTDPGRDCPLCARLVEYRTELRAREPDGFNAPVPSFGGPDAQLLIVGLAPGAQGANRTGRPFTGDYAGDLLYDTLLHFGFAEGTFLARPDDGLTLTNSRITNAVRCVPPQNKPLPVEITTCRPFLIATMETMPNLRAIVLLGRVAHDTMLKTLGIRAVTAPFGHGAVHDAGRFKLYDSYHCSRYNTNTGVLTPEMFRAVFARVKKDLAET

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
12 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
13 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
16 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
17 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
18 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
19 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
20 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
21 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
22 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
23 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
24 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
25 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
26 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
27 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
28 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
29 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
30 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
31 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
32 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
33 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
34 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
35 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
36 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
37 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
38 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
39 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
40 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
41 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
42 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
43 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
44 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
45 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
46 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
47 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
48 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
49 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
50 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
51 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
52 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
53 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
54 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
234 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
362 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
363 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
364 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
365 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
372 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
373 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
376 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
385 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
386 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
387 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
388 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
389 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
390 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
391 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
392 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
393 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
394 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
395 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
396 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
397 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
398 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
399 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.97
Metatranscriptomes 0.17
Isolates 11.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.26
Nodule 9.6
Rhizoplane 7.74
Rhizosphere 67
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1011751 3300003214 Bacteria 1244
2 JGI25153J46596_10013737 3300003215 Bacteria 3406
3 JGI25153J46596_10034134 3300003215 Bacteria 1667
4 Ga0055525_1006398 3300003759 Bacteria 997
5 Ga0055526_1018611 3300003771 Bacteria 2583
6 Ga0055536_1000643 3300003781 Bacteria 23754
7 Ga0055536_1000792 3300003781 Bacteria 21010
8 Ga0065165_1002461 3300005262 Bacteria 15609
9 Ga0065715_10016906 3300005293 Bacteria 2258
10 Ga0070658_10054028 3300005327 Bacteria 3261
11 Ga0070658_10234085 3300005327 Bacteria 1556
12 Ga0070660_100345609 3300005339 Bacteria 1224
13 Ga0070691_10040017 3300005341 Bacteria 2215
14 Ga0070691_10128741 3300005341 Bacteria 1281
15 Ga0070661_100085416 3300005344 Bacteria 2332
16 Ga0070669_100235528 3300005353 Bacteria 1453
17 Ga0070674_100013377 3300005356 Bacteria 5071
18 Ga0070674_100123527 3300005356 Bacteria 1919
19 Ga0070674_100414320 3300005356 Bacteria 1104
20 Ga0070688_100252835 3300005365 Bacteria 1255
21 Ga0070667_100033552 3300005367 Bacteria 4292
22 Ga0070703_10002959 3300005406 Bacteria 4853
23 Ga0070709_10444045 3300005434 Bacteria 976
24 Ga0070714_100058060 3300005435 Bacteria 3314
25 Ga0070713_100047485 3300005436 Bacteria 3529
26 Ga0070701_10259451 3300005438 Bacteria 1053
27 Ga0070705_100000171 3300005440 Bacteria 37880
28 Ga0070705_100577981 3300005440 Bacteria 866
29 Ga0070700_100002232 3300005441 Bacteria 9855
30 Ga0070694_100000555 3300005444 Bacteria 20563
31 Ga0070708_100053574 3300005445 Bacteria 3580
32 Ga0070663_100002218 3300005455 Bacteria 10873
33 Ga0070663_100105639 3300005455 Bacteria 2108
34 Ga0070663_100399668 3300005455 Bacteria 1123
35 Ga0070681_10004750 3300005458 Bacteria 13015
36 Ga0070681_10054076 3300005458 Bacteria 4000
37 Ga0068867_100203869 3300005459 Bacteria 1585
38 Ga0070706_100305857 3300005467 Bacteria 1483
39 Ga0070699_100000167 3300005518 Bacteria 63239
40 Ga0070686_100018540 3300005544 Bacteria 4088
41 Ga0070695_100000722 3300005545 Bacteria 17637
42 Ga0070696_100000097 3300005546 Bacteria 44009
43 Ga0070696_100098339 3300005546 Bacteria 2093
44 Ga0070693_100023657 3300005547 Bacteria 3286
45 Ga0070693_100175755 3300005547 Bacteria 1375
46 Ga0070693_100404262 3300005547 Bacteria 948
47 Ga0070665_100513659 3300005548 Bacteria 1210
48 Ga0070704_100007113 3300005549 Bacteria 6645
49 Ga0068855_100051875 3300005563 Bacteria 4831
50 Ga0070664_100213309 3300005564 Bacteria 1726
51 Ga0068857_100009356 3300005577 Bacteria 8508
52 Ga0068854_100568276 3300005578 Bacteria 964
53 Ga0068856_100602324 3300005614 Bacteria 1120
54 Ga0070702_100083117 3300005615 Bacteria 1923
55 Ga0068859_100001658 3300005617 Bacteria 22662
56 Ga0068866_10011028 3300005718 Bacteria 3894
57 Ga0068861_100023275 3300005719 Bacteria 4467
58 Ga0068861_100026465 3300005719 Bacteria 4217
59 Ga0068870_10037186 3300005840 Bacteria 2508
60 Ga0068863_100001297 3300005841 Bacteria 24954
61 Ga0068863_100057437 3300005841 Bacteria 3683
62 Ga0068860_100000623 3300005843 Bacteria 41934
63 Ga0068860_100001592 3300005843 Bacteria 24376
64 Ga0068860_100299305 3300005843 Bacteria 1575
65 Ga0068862_100000194 3300005844 Bacteria 67126
66 Ga0068862_100001428 3300005844 Bacteria 22066
67 Ga0068862_100021469 3300005844 Bacteria 5395
68 Ga0081455_10000230 3300005937 Bacteria 72112
69 Ga0081455_10005420 3300005937 Bacteria 13994
70 Ga0081455_10065103 3300005937 Bacteria 3050
71 Ga0081455_10209285 3300005937 Bacteria 1454
72 Ga0081540_1000423 3300005983 Bacteria 41829
73 Ga0081539_10000231 3300005985 Bacteria 131197
74 Ga0081539_10047511 3300005985 Bacteria 2450
75 Ga0070717_10031151 3300006028 Bacteria 4289
76 Ga0075365_10005236 3300006038 Bacteria 6978
77 Ga0075364_10379242 3300006051 Bacteria 964
78 Ga0075367_10353769 3300006178 Bacteria 927
79 Ga0075369_10044754 3300006186 Bacteria 1902
80 Ga0075366_10118075 3300006195 Bacteria 1598
81 Ga0075366_10538257 3300006195 Bacteria 723
82 Ga0075428_100101601 3300006844 Bacteria 3135
83 Ga0075430_100030537 3300006846 Bacteria 4577
84 Ga0075430_100036840 3300006846 Bacteria 4146
85 Ga0075430_100153798 3300006846 Bacteria 1915
86 Ga0075431_100000652 3300006847 Bacteria 29451
87 Ga0075431_100000793 3300006847 Bacteria 27547
88 Ga0075431_100036187 3300006847 Bacteria 5084
89 Ga0075431_100102126 3300006847 Bacteria 2959
90 Ga0075433_10308314 3300006852 Bacteria 1401
91 Ga0075434_100139069 3300006871 Bacteria 2448
92 Ga0075434_100485302 3300006871 Bacteria 1257
93 Ga0075434_100706249 3300006871 Bacteria 1026
94 Ga0075429_100013169 3300006880 Bacteria 7175
95 Ga0068865_100026656 3300006881 Bacteria 3812
96 Ga0097620_100001658 3300006931 Bacteria 22662
97 Ga0097620_100018941 3300006931 Bacteria 6914
98 Ga0075435_100576554 3300007076 Bacteria 975
99 Ga0075435_100917974 3300007076 Bacteria 764
100 Ga0105240_10081849 3300009093 Bacteria 3965
101 Ga0111539_10001024 3300009094 Bacteria 36666
102 Ga0111539_10266125 3300009094 Bacteria 1995
103 Ga0111539_10749462 3300009094 Bacteria 1137
104 Ga0105245_10376994 3300009098 Bacteria 1412
105 Ga0114129_10031876 3300009147 Bacteria 7451
106 Ga0114129_10268648 3300009147 Bacteria 2282
107 Ga0114129_10767437 3300009147 Bacteria 1233
108 Ga0105243_10278187 3300009148 Bacteria 1506
109 Ga0105241_10145219 3300009174 Bacteria 1935
110 Ga0105241_10533436 3300009174 Bacteria 1051
111 Ga0105242_10098895 3300009176 Bacteria 2468
112 Ga0105237_10197231 3300009545 Bacteria 2013
113 Ga0105237_10440220 3300009545 Bacteria 1309
114 Ga0105237_10619298 3300009545 Bacteria 1089
115 Ga0105249_10000135 3300009553 Bacteria 96943
116 Ga0105249_10040803 3300009553 Bacteria 4217
117 Ga0105249_10817366 3300009553 Bacteria 996
118 Ga0105239_10321194 3300010375 Bacteria 1746
119 Ga0105239_10619079 3300010375 Bacteria 1235
120 Ga0105239_10752637 3300010375 Bacteria 1115
121 Ga0105239_11059718 3300010375 Bacteria 933
122 Ga0105246_10043734 3300011119 Bacteria 3040
123 Ga0105246_10228958 3300011119 Bacteria 1462
124 Ga0157369_10027642 3300013105 Bacteria 6285
125 Ga0157378_10025383 3300013297 Bacteria 5219
126 Ga0157378_10025603 3300013297 Bacteria 5194
127 Ga0157378_10139457 3300013297 Bacteria 2250
128 Ga0157378_10335847 3300013297 Bacteria 1472
129 Ga0163163_10413721 3300014325 Bacteria 1407
130 Ga0157380_10288056 3300014326 Bacteria 1506
131 Ga0157380_10732823 3300014326 Bacteria 998
132 Ga0157377_10114456 3300014745 Bacteria 1626
133 Ga0157377_10119862 3300014745 Bacteria 1593
134 Ga0157379_10572245 3300014968 Bacteria 1052
135 Ga0157376_10564819 3300014969 Bacteria 1128
136 Ga0163161_10049221 3300017792 Bacteria 3045
137 Ga0213872_10065815 3300021361 Bacteria 1636
138 Ga0213876_10184440 3300021384 Bacteria 1110
139 Ga0213875_10021595 3300021388 Bacteria 3081
140 Ga0213871_10007602 3300021441 Bacteria 2353
141 Ga0209563_101101 3300025230 Bacteria 7740
142 Ga0209677_102497 3300025253 Bacteria 6870
143 Ga0209233_1026715 3300025261 Bacteria 1407
144 Ga0209673_1039315 3300025273 Bacteria 1366
145 Ga0209676_1000070 3300025292 Bacteria 312074
146 Ga0209564_1002681 3300025295 Bacteria 13500
147 Ga0209564_1017449 3300025295 Bacteria 2796
148 Ga0209758_1003040 3300025297 Bacteria 15973
149 Ga0209758_1003616 3300025297 Bacteria 13830
150 Ga0209256_1003151 3300025299 Bacteria 11994
151 Ga0207426_1000596 3300025302 Bacteria 47621
152 Ga0207426_1001063 3300025302 Bacteria 25997
153 Ga0207653_10001766 3300025885 Bacteria 6908
154 Ga0207653_10056818 3300025885 Bacteria 1313
155 Ga0207642_10026215 3300025899 Bacteria 2369
156 Ga0207699_10578280 3300025906 Bacteria 816
157 Ga0207643_10438421 3300025908 Bacteria 830
158 Ga0207684_10108118 3300025910 Bacteria 2380
159 Ga0207654_10232377 3300025911 Bacteria 1229
160 Ga0207707_10014508 3300025912 Bacteria 6861
161 Ga0207707_10044293 3300025912 Bacteria 3880
162 Ga0207695_10081357 3300025913 Bacteria 3278
163 Ga0207663_10381973 3300025916 Bacteria 1073
164 Ga0207660_10005384 3300025917 Bacteria 8309
165 Ga0207662_10116581 3300025918 Bacteria 1670
166 Ga0207657_10042204 3300025919 Bacteria 4026
167 Ga0207652_10676329 3300025921 Bacteria 922
168 Ga0207681_10118411 3300025923 Bacteria 1939
169 Ga0207681_10240798 3300025923 Bacteria 1408
170 Ga0207694_10012988 3300025924 Bacteria 6271
171 Ga0207687_10462458 3300025927 Bacteria 1054
172 Ga0207664_10142487 3300025929 Bacteria 2029
173 Ga0207690_10150091 3300025932 Bacteria 1727
174 Ga0207706_10027494 3300025933 Bacteria 5086
175 Ga0207706_10046897 3300025933 Bacteria 3825
176 Ga0207706_10296554 3300025933 Bacteria 1409
177 Ga0207686_10701537 3300025934 Bacteria 804
178 Ga0207709_10060686 3300025935 Bacteria 2359
179 Ga0207669_10128014 3300025937 Bacteria 1739
180 Ga0207689_10144623 3300025942 Bacteria 1959
181 Ga0207661_10307155 3300025944 Bacteria 1423
182 Ga0207667_10007941 3300025949 Bacteria 12666
183 Ga0207712_10000101 3300025961 Bacteria 96961
184 Ga0207712_10001350 3300025961 Bacteria 16801
185 Ga0207668_10040749 3300025972 Bacteria 3135
186 Ga0207668_10507438 3300025972 Bacteria 1038
187 Ga0207658_10212172 3300025986 Bacteria 1623
188 Ga0207703_10286456 3300026035 Bacteria 1498
189 Ga0207639_10054034 3300026041 Bacteria 3067
190 Ga0207678_10005726 3300026067 Bacteria 11092
191 Ga0207678_10097086 3300026067 Bacteria 2518
192 Ga0207678_10386905 3300026067 Bacteria 1210
193 Ga0207708_10000296 3300026075 Bacteria 39206
194 Ga0207708_10032322 3300026075 Bacteria 3974
195 Ga0207702_10171271 3300026078 Bacteria 1991
196 Ga0207702_10800954 3300026078 Bacteria 931
197 Ga0207641_10044646 3300026088 Bacteria 3728
198 Ga0207641_10097239 3300026088 Bacteria 2587
199 Ga0207648_10083975 3300026089 Bacteria 2777
200 Ga0207648_10901589 3300026089 Bacteria 826
201 Ga0207674_10004822 3300026116 Bacteria 16164
202 Ga0207675_100040969 3300026118 Bacteria 4326
203 Ga0207675_100106809 3300026118 Bacteria 2639
204 Ga0207675_100112912 3300026118 Bacteria 2565
205 Ga0207683_10080458 3300026121 Bacteria 2891
206 Ga0207428_10046390 3300027907 Bacteria 3495
207 Ga0207428_10704229 3300027907 Bacteria 722
208 Ga0268266_10095574 3300028379 Bacteria 2610
209 Ga0268266_10460187 3300028379 Bacteria 1210
210 Ga0268266_10653362 3300028379 Bacteria 1012
211 Ga0268265_10000151 3300028380 Bacteria 85523
212 Ga0268265_10000508 3300028380 Bacteria 40027
213 Ga0268265_10026653 3300028380 Bacteria 4114
214 Ga0268265_10293529 3300028380 Bacteria 1460
215 Ga0268264_10000303 3300028381 Bacteria 79730
216 Ga0268264_10003796 3300028381 Bacteria 12956
217 Ga0268264_10059275 3300028381 Bacteria 3207
218 Ga0265332_10010810 3300031238 Bacteria 4056
219 Ga0265320_10008942 3300031240 Bacteria 6084
220 Ga0265340_10021278 3300031247 Bacteria 3327
221 Ga0265340_10131148 3300031247 Bacteria 1149
222 Ga0265339_10276108 3300031249 Bacteria 807
223 Ga0265316_10188380 3300031344 Bacteria 1534
224 Ga0265316_10463540 3300031344 Bacteria 908
225 Ga0307408_100207219 3300031548 Bacteria 1591
226 Ga0307408_100385808 3300031548 Bacteria 1199
227 Ga0265313_10027832 3300031595 Bacteria 2952
228 Ga0265314_10053865 3300031711 Bacteria 2787
229 Ga0265342_10019647 3300031712 Bacteria 4350
230 Ga0265342_10227084 3300031712 Bacteria 1004
231 Ga0316578_10070719 3300031728 Bacteria 2066
232 Ga0307405_10205343 3300031731 Bacteria 1434
233 Ga0307407_10256931 3300031903 Bacteria 1200
234 Ga0307414_10532487 3300032004 Bacteria 1044
235 Ga0307415_100755715 3300032126 Bacteria 883
236 Ga0307510_10031031 3300033180 Bacteria 6046
237 Ga0307510_10042319 3300033180 Bacteria 4965
238 Ga0307510_10285351 3300033180 Bacteria 1119
239 Ga0316596_1016560 3300033541 Bacteria 1848
240 Ga0316215_1007363 3300033544 Bacteria 1072
241 Ga0373958_0014878 3300034819 Bacteria 1366
242 Ga0373938_0068776 3300034957 Bacteria 842
243 Ga0373929_0025233 3300035085 Bacteria 1233
244 Ga0373951_0016900 3300035091 Bacteria 1649
245 Ga0373939_0006111 3300035114 Bacteria 2894
246 Ga0373941_0001972 3300035115 Bacteria 4449
247 Ga0373960_0021196 3300035121 Bacteria 1726
248 Ga0373946_0380141 3300035171 Bacteria 710
249 Ga0316574_0197754 3300035398 Bacteria 1292
250 Ga0373924_0027381 3300035410 Bacteria 2266
251 Ga0373931_0004666 3300035691 Bacteria 6271
252 Ga0373927_0038409 3300035695 Bacteria 3108
253 Ga0373927_0118770 3300035695 Bacteria 1725
254 Ga0373933_0082406 3300035724 Bacteria 1974
255 Ga0373937_0006904 3300036401 Bacteria 9799
256 Ga0316584_0036211 3300036712 Bacteria 3661
257 Ga0373925_0056161 3300037068 Bacteria 2949
258 Ga0395898_0408602 3300037466 Bacteria 1294
259 Ga0395898_0573656 3300037466 Bacteria 1071
260 Ga0395898_0742938 3300037466 Bacteria 923
261 Ga0436364_0075557 3300037853 Bacteria 10295
262 Ga0436364_0954368 3300037853 Unclassified 2285
263 Ga0395901_0776576 3300038443 Bacteria 949
264 Ga0436365_1501284 3300039437 Bacteria 4389
265 Ga0436365_1673354 3300039437 Bacteria 1151
266 Ga0436361_0431438 3300039447 Bacteria 7452
267 Ga0451802_0229276 3300041460 Bacteria 1545
268 Ga0439455_0005605 3300042012 Bacteria 2559
269 Ga0451577_0084229 3300042876 Bacteria 2837
270 Ga0451577_0147776 3300042876 Bacteria 2114
271 Ga0466969_0042037 3300044656 Bacteria 2284
272 Ga0466966_0125763 3300044684 Bacteria 1572
273 Ga0466961_0075292 3300044693 Bacteria 2140
274 Ga0453684_0000031 3300044712 Bacteria 752632
275 Ga0466971_0078708 3300044719 Bacteria 1502
276 Ga0466959_0019584 3300045049 Bacteria 4977
277 Ga0451576_0027187 3300045051 Bacteria 6146
278 Ga0451576_0110064 3300045051 Bacteria 2867
279 Ga0466967_0082999 3300045976 Bacteria 2897
280 Ga0495592_0123465 3300046454 Bacteria 1819
281 Ga0495603_0052164 3300046455 Bacteria 2429
282 Ga0495590_0043258 3300046457 Bacteria 1571
283 Ga0495629_0004968 3300046459 Bacteria 9975
284 Ga0495653_0073743 3300046463 Bacteria 2546
285 Ga0495580_0373031 3300046472 Bacteria 965
286 Ga0495582_0276643 3300046473 Bacteria 964
287 Ga0495582_0424562 3300046473 Bacteria 767
288 Ga0495605_0055791 3300046474 Bacteria 1907
289 Ga0495664_0000874 3300046477 Bacteria 15509
290 Ga0495583_0041932 3300046506 Bacteria 2141
291 Ga0495606_0005580 3300046507 Bacteria 11983
292 Ga0495606_0155650 3300046507 Bacteria 1337
293 Ga0495608_0124875 3300046511 Bacteria 1649
294 Ga0495616_0037479 3300046513 Bacteria 2494
295 Ga0495618_0207985 3300046514 Bacteria 1237
296 Ga0495628_0168719 3300046516 Bacteria 1660
297 Ga0495648_0044488 3300046524 Bacteria 2771
298 Ga0495648_0232528 3300046524 Bacteria 901
299 Ga0495654_0186340 3300046530 Bacteria 896
300 Ga0495665_0037382 3300046531 Bacteria 2591
301 Ga0495665_0344006 3300046531 Bacteria 760
302 Ga0495640_0007811 3300046533 Bacteria 8414
303 Ga0495587_0145172 3300046536 Bacteria 1353
304 Ga0495645_0007670 3300046543 Bacteria 7506
305 Ga0495622_0028661 3300046557 Bacteria 2600
306 Ga0495656_0021282 3300046615 Bacteria 2523
307 Ga0495668_0244147 3300046616 Bacteria 983
308 Ga0495611_0037715 3300046648 Bacteria 2148
309 Ga0495611_0192823 3300046648 Bacteria 951
310 Ga0495625_0194413 3300046660 Bacteria 1342
311 Ga0495635_0021418 3300046663 Bacteria 4504
312 Ga0495635_0038378 3300046663 Bacteria 3316
313 Ga0495657_0082366 3300046675 Bacteria 2080
314 Ga0495623_0155529 3300046679 Bacteria 1348
315 Ga0495646_0080631 3300046680 Bacteria 1898
316 Ga0495658_0334451 3300046683 Bacteria 961
317 Ga0495669_0002716 3300046684 Bacteria 7250
318 Ga0495613_0074903 3300046689 Bacteria 2464
319 Ga0495624_0123530 3300046690 Bacteria 1589
320 Ga0495670_0116490 3300046691 Bacteria 1386
321 Ga0495671_0109872 3300046692 Bacteria 1347
322 Ga0495649_0038722 3300046694 Bacteria 2615
323 Ga0495649_0041881 3300046694 Bacteria 2503
324 Ga0495589_0061902 3300046794 Bacteria 1836
325 Ga0495600_0050462 3300046809 Bacteria 2715
326 Ga0495600_0290597 3300046809 Bacteria 1033
327 Ga0495581_0174708 3300047315 Bacteria 1256
328 Ga0495674_0055498 3300047319 Bacteria 3474
329 Ga0495674_0586613 3300047319 Bacteria 884
330 Ga0495672_0024387 3300047320 Bacteria 3898
331 Ga0495676_0032128 3300047321 Bacteria 4434
332 Ga0495676_0352167 3300047321 Bacteria 984
333 Ga0495673_0009492 3300047469 Bacteria 5385
334 Ga0495673_0110508 3300047469 Bacteria 1099
335 Ga0495673_0167862 3300047469 Bacteria 838
336 Ga0495684_0038027 3300047471 Bacteria 3691
337 Ga0495686_0170559 3300047472 Bacteria 1266
338 Ga0495593_0080837 3300047673 Bacteria 1681
339 Ga0495615_0085706 3300048090 Bacteria 871
340 Ga0496100_0067734 3300048903 Bacteria 2372
341 Ga0496101_0163936 3300048904 Bacteria 1706
342 Ga0496102_0003290 3300048905 Bacteria 13702
343 Ga0496102_0025292 3300048905 Bacteria 5284
344 Ga0496102_0063257 3300048905 Bacteria 3388
345 Ga0496102_0397934 3300048905 Bacteria 1295
346 Ga0496103_0124712 3300048906 Bacteria 1642
347 Ga0496103_0314140 3300048906 Bacteria 1008
348 Ga0496104_0000182 3300048907 Bacteria 56117
349 Ga0496104_0040114 3300048907 Bacteria 4387
350 Ga0496104_0150280 3300048907 Bacteria 2236
351 Ga0496104_0152048 3300048907 Bacteria 2221
352 Ga0496104_0328973 3300048907 Bacteria 1441
353 Ga0496105_0016358 3300048908 Bacteria 5921
354 Ga0496105_0110087 3300048908 Bacteria 2273
355 Ga0496105_0252568 3300048908 Bacteria 1428
356 Ga0496106_0004830 3300048909 Bacteria 9971
357 Ga0496106_0739694 3300048909 Bacteria 782
358 Ga0496107_0001227 3300048910 Bacteria 15652
359 Ga0496107_0096715 3300048910 Bacteria 2161
360 Ga0496108_0001152 3300048911 Bacteria 20646
361 Ga0496108_0092022 3300048911 Bacteria 2578
362 Ga0496109_0002055 3300048912 Bacteria 16695
363 Ga0496109_0131046 3300048912 Bacteria 2340
364 Ga0496109_0378231 3300048912 Bacteria 1338
365 Ga0496110_0008254 3300048913 Bacteria 8373
366 Ga0496110_0036848 3300048913 Bacteria 4249
367 Ga0496110_0088176 3300048913 Bacteria 2771
368 Ga0496110_0578586 3300048913 Bacteria 1020
369 Ga0496110_0606120 3300048913 Bacteria 993
370 Ga0496111_0012429 3300048914 Bacteria 5764
371 Ga0496112_0013651 3300048915 Bacteria 7506
372 Ga0496113_0020005 3300048916 Bacteria 4696
373 Ga0496113_0086437 3300048916 Bacteria 2410
374 Ga0496113_0235526 3300048916 Bacteria 1460
375 Ga0496114_0124231 3300048917 Bacteria 2223
376 Ga0496114_0162081 3300048917 Bacteria 1945
377 Ga0496114_0200420 3300048917 Bacteria 1748
378 Ga0496115_0037216 3300048918 Bacteria 3856
379 Ga0496115_0096864 3300048918 Bacteria 2416
380 Ga0496115_0137187 3300048918 Bacteria 2017
381 Ga0496115_0162457 3300048918 Bacteria 1846
382 Ga0496115_0168281 3300048918 Bacteria 1812
383 Ga0496115_0460152 3300048918 Bacteria 1026
384 Ga0496116_0232006 3300048919 Bacteria 935
385 Ga0496118_0207789 3300048921 Bacteria 1152
386 Ga0496119_0016935 3300048922 Bacteria 5514
387 Ga0496120_0124632 3300048923 Bacteria 1327
388 Ga0496121_0343298 3300048924 Bacteria 997
389 Ga0496124_0016861 3300048927 Bacteria 6922
390 Ga0496124_0152553 3300048927 Bacteria 1810
391 Ga0496125_0004318 3300048928 Bacteria 16505
392 Ga0496125_0096968 3300048928 Bacteria 2187
393 Ga0496125_0296150 3300048928 Bacteria 994
394 Ga0496126_0100701 3300048929 Bacteria 2528
395 Ga0496126_0218628 3300048929 Bacteria 1602
396 Ga0496126_0495796 3300048929 Bacteria 977
397 Ga0495682_0040447 3300049460 Bacteria 1709
398 Ga0501031_0089058 3300049568 Bacteria 2012
399 Ga0501032_0077494 3300049569 Bacteria 2213
400 Ga0501033_0150139 3300049570 Bacteria 1681
401 Ga0501033_0609990 3300049570 Bacteria 748
402 Ga0501034_0000391 3300049571 Bacteria 74631
403 Ga0501034_0004261 3300049571 Bacteria 15956
404 Ga0501034_0025458 3300049571 Bacteria 6024
405 Ga0501034_0119775 3300049571 Bacteria 2619
406 Ga0501034_0228348 3300049571 Bacteria 1811
407 Ga0501034_0348572 3300049571 Bacteria 1409
408 Ga0501034_0369283 3300049571 Bacteria 1361
409 Ga0501034_0418102 3300049571 Bacteria 1262
410 Ga0501036_0062691 3300049572 Bacteria 3149
411 Ga0501036_0223254 3300049572 Bacteria 1582
412 Ga0501038_0112787 3300049574 Bacteria 2250
413 Ga0501038_0149649 3300049574 Bacteria 1904
414 Ga0501038_0423432 3300049574 Bacteria 1027
415 Ga0501039_0000070 3300049575 Bacteria 77967
416 Ga0501039_0184135 3300049575 Bacteria 1642
417 Ga0501040_0210412 3300049576 Bacteria 1383
418 Ga0501043_0044532 3300049579 Bacteria 3489
419 Ga0501046_0007046 3300049580 Bacteria 9904
420 Ga0501047_0000102 3300049581 Bacteria 104950
421 Ga0501047_0081221 3300049581 Bacteria 3116
422 Ga0501047_0206645 3300049581 Bacteria 1823
423 Ga0501047_0331608 3300049581 Bacteria 1360
424 Ga0501047_0374238 3300049581 Unclassified 1259
425 Ga0501067_0005270 3300049583 Bacteria 7183
426 Ga0501067_0042856 3300049583 Bacteria 2513
427 Ga0501067_0106615 3300049583 Bacteria 1557
428 Ga0501067_0347843 3300049583 Bacteria 826
429 Ga0501070_0021105 3300049586 Bacteria 5465
430 Ga0501070_0362359 3300049586 Bacteria 1176
431 Ga0501070_0369030 3300049586 Bacteria 1164
432 Ga0501071_0234134 3300049587 Bacteria 1384
433 Ga0501073_0243585 3300049589 Bacteria 1241
434 Ga0501073_0285079 3300049589 Bacteria 1139
435 Ga0501073_0382170 3300049589 Bacteria 973
436 Ga0501074_0296866 3300049590 Bacteria 1148
437 Ga0501076_0012958 3300049592 Bacteria 6242
438 Ga0501076_0033571 3300049592 Bacteria 4007
439 Ga0501076_0101815 3300049592 Bacteria 2315
440 Ga0501077_0029077 3300049593 Bacteria 3513
441 Ga0501079_0494257 3300049741 Bacteria 962
442 Ga0501079_0582879 3300049741 Bacteria 880
443 Ga0501080_0000028 3300049742 Bacteria 88948
444 Ga0501080_0132220 3300049742 Bacteria 2310
445 Ga0501080_0252385 3300049742 Bacteria 1608
446 Ga0501080_0496433 3300049742 Bacteria 1091
447 Ga0501083_0005111 3300049744 Bacteria 9291
448 Ga0501083_0010351 3300049744 Bacteria 6565
449 Ga0501083_0038864 3300049744 Bacteria 3233
450 Ga0501035_0000020 3300049822 Bacteria 221605
451 Ga0501035_0143338 3300049822 Bacteria 2076
452 Ga0501035_0191759 3300049822 Bacteria 1757
453 Ga0501035_0444766 3300049822 Bacteria 1073
454 Ga0501035_0467243 3300049822 Bacteria 1042
455 Ga0501044_0000007 3300049823 Bacteria 283429
456 Ga0501044_0130995 3300049823 Bacteria 2502
457 Ga0501044_0198096 3300049823 Bacteria 1967
458 Ga0501044_0464765 3300049823 Bacteria 1170
459 Ga0501044_0775571 3300049823 Unclassified 839
460 Ga0501045_0076772 3300049824 Bacteria 2462
461 Ga0501045_0084042 3300049824 Bacteria 2348
462 nmdc:mga00v17_172718_c1 3300050491 Bacteria 1394
463 nmdc:mga0yw44_304098_c1 3300050492 Bacteria 1069
464 nmdc:mga0yw44_45596_c1 3300050492 Bacteria 2629
465 nmdc:mga0k408_132933_c1 3300050493 Bacteria 1477
466 nmdc:mga05p37_243473_c1 3300050507 Bacteria 2161
467 nmdc:mga09592_15142_c1 3300050508 Bacteria 6301
468 nmdc:mga09592_280333_c1 3300050508 Bacteria 1446
469 nmdc:mga0qj67_130987_c1 3300050509 Bacteria 2031
470 nmdc:mga0qj67_171880_c1 3300050509 Bacteria 1760
471 nmdc:mga0qj67_39723_c1 3300050509 Bacteria 3697
472 nmdc:mga06r32_1040_c1 3300050510 Bacteria 25051
473 nmdc:mga06r32_212204_c1 3300050510 Bacteria 1924
474 nmdc:mga06r32_88502_c1 3300050510 Bacteria 3023
475 nmdc:mga08y16_140659_c1 3300050511 Bacteria 2509
476 nmdc:mga08y16_371687_c1 3300050511 Bacteria 1466
477 nmdc:mga08y16_5279_c1 3300050511 Bacteria 13507
478 nmdc:mga08y16_654463_c1 3300050511 Bacteria 1054
479 nmdc:mga0rr50_369426_c1 3300050513 Bacteria 1208
480 nmdc:mga0a205_235383_c1 3300050515 Bacteria 1713
481 nmdc:mga0sz30_18114_c1 3300050516 Bacteria 2815
482 Ga0495601_0013287 3300053077 Bacteria 4949
483 Ga0495655_0089423 3300053083 Bacteria 895
484 Ga0495595_0165554 3300053084 Bacteria 1093
485 Ga0495619_0593264 3300053085 Bacteria 758
486 Ga0500578_0106784 3300053086 Bacteria 1768
487 Ga0500643_000025 3300053087 Bacteria 259605
488 Ga0500644_0032464 3300053088 Bacteria 1669
489 Ga0500641_0065665 3300053096 Bacteria 1518
490 Ga0500650_0202708 3300053098 Bacteria 903
491 Ga0500555_002304 3300053103 Bacteria 5557
492 Ga0500569_018641 3300053109 Bacteria 1795
493 Ga0500572_034326 3300053111 Bacteria 1436
494 Ga0500607_027067 3300053121 Bacteria 3183
495 Ga0500614_045766 3300053123 Bacteria 1130
496 Ga0500642_0007503 3300053130 Bacteria 3670
497 Ga0500655_043209 3300053133 Bacteria 887
498 Ga0500658_0133994 3300053134 Bacteria 1107
499 Ga0500559_0034055 3300053136 Bacteria 2195
500 Ga0500559_0035588 3300053136 Bacteria 2151
501 Ga0500568_0008868 3300053139 Bacteria 4815
502 Ga0500589_134775 3300053147 Bacteria 1026
503 Ga0500603_002147 3300053150 Bacteria 4359
504 Ga0500619_000868 3300053154 Bacteria 5160
505 Ga0500627_0008486 3300053158 Bacteria 3653
506 Ga0500633_0020495 3300053160 Bacteria 1996
507 Ga0500638_011578 3300053162 Bacteria 3919
508 Ga0500636_0284226 3300053177 Bacteria 824
509 Ga0500645_082044 3300053730 Bacteria 919
510 Ga0501084_0009497 3300054114 Bacteria 8049
511 Ga0501084_0026219 3300054114 Bacteria 4862
512 Ga0501084_0065205 3300054114 Bacteria 3047
513 Ga0501084_0312302 3300054114 Bacteria 1327
514 Ga0501084_0466113 3300054114 Bacteria 1068
515 Ga0590071_002138 3300059421 Bacteria 5034
516 Ga0590075_031176 3300059424 Bacteria 1351
517 Ga0501082_0007775 3300060353 Bacteria 9250
518 Ga0501082_0051487 3300060353 Bacteria 3549
519 Ga0501082_0110894 3300060353 Bacteria 2374
520 Ga0530510_0136303 3300061734 Bacteria 1807

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0582879 Ga0501079_0582879_28_651 194
2 3300005367 Ga0070667_100033552 Ga0070667_1000335522 206
3 3300006178 Ga0075367_10353769 Ga0075367_103537692 206
4 3300009176 Ga0105242_10098895 Ga0105242_100988954 206
5 3300035171 Ga0373946_0380141 Ga0373946_0380141_31_684 206
6 3300042012 Ga0439455_0005605 Ga0439455_0005605_252_881 206
7 3300046463 Ga0495653_0073743 Ga0495653_0073743_989_1642 206
8 3300046477 Ga0495664_0000874 Ga0495664_0000874_14450_15103 206
9 3300046531 Ga0495665_0037382 Ga0495665_0037382_1710_2363 206
10 3300046533 Ga0495640_0007811 Ga0495640_0007811_811_1464 206
11 3300046543 Ga0495645_0007670 Ga0495645_0007670_6831_7484 206
12 3300046663 Ga0495635_0038378 Ga0495635_0038378_1579_2232 206
13 3300047319 Ga0495674_0055498 Ga0495674_0055498_290_943 206
14 3300047321 Ga0495676_0352167 Ga0495676_0352167_173_820 206
15 3300047471 Ga0495684_0038027 Ga0495684_0038027_262_915 206
16 3300053077 Ga0495601_0013287 Ga0495601_0013287_4124_4777 206
17 3300053084 Ga0495595_0165554 Ga0495595_0165554_333_986 206
18 3300005293 Ga0065715_10016906 Ga0065715_100169062 207
19 3300005356 Ga0070674_100123527 Ga0070674_1001235272 207
20 3300007076 Ga0075435_100576554 Ga0075435_1005765541 207
21 3300009147 Ga0114129_10268648 Ga0114129_102686482 207
22 3300010375 Ga0105239_11059718 Ga0105239_110597182 207
23 3300025921 Ga0207652_10676329 Ga0207652_106763292 207
24 3300025934 Ga0207686_10701537 Ga0207686_107015372 207
25 3300026118 Ga0207675_100106809 Ga0207675_1001068093 207
26 3300028380 Ga0268265_10293529 Ga0268265_102935292 207
27 3300037466 Ga0395898_0573656 Ga0395898_0573656_370_1008 207
28 3300048913 Ga0496110_0606120 Ga0496110_0606120_324_953 207
29 3300049589 Ga0501073_0382170 Ga0501073_0382170_295_927 207
30 3300050515 nmdc:mga0a205_235383_c1 nmdc:mga0a205_235383_c1_302_931 207
31 3300054114 Ga0501084_0065205 Ga0501084_0065205_1848_2474 207
32 3300059421 Ga0590071_002138 Ga0590071_002138_2161_2787 207
33 3300059424 Ga0590075_031176 Ga0590075_031176_386_1012 207
34 3300005455 Ga0070663_100399668 Ga0070663_1003996681 208
35 3300005719 Ga0068861_100026465 Ga0068861_1000264654 208
36 3300026118 Ga0207675_100040969 Ga0207675_1000409693 208
37 3300031240 Ga0265320_10008942 Ga0265320_100089423 208
38 3300031548 Ga0307408_100385808 Ga0307408_1003858081 208
39 3300031711 Ga0265314_10053865 Ga0265314_100538653 208
40 3300047469 Ga0495673_0009492 Ga0495673_0009492_3013_3648 208
41 3300049571 Ga0501034_0119775 Ga0501034_0119775_1019_1663 208
42 3300049823 Ga0501044_0464765 Ga0501044_0464765_261_890 208
43 3300003771 Ga0055526_1018611 Ga0055526_10186112 209
44 3300003781 Ga0055536_1000643 Ga0055536_10006437 209
45 3300009545 Ga0105237_10440220 Ga0105237_104402202 209
46 3300025292 Ga0209676_1000070 Ga0209676_1000070198 209
47 3300031247 Ga0265340_10021278 Ga0265340_100212782 209
48 3300031595 Ga0265313_10027832 Ga0265313_100278322 209
49 3300031712 Ga0265342_10019647 Ga0265342_100196472 209
50 3300031728 Ga0316578_10070719 Ga0316578_100707193 209
51 3300032004 Ga0307414_10532487 Ga0307414_105324872 209
52 3300033541 Ga0316596_1016560 Ga0316596_10165602 209
53 3300035398 Ga0316574_0197754 Ga0316574_0197754_220_876 209
54 3300042876 Ga0451577_0084229 Ga0451577_0084229_1122_1754 209
55 3300044712 Ga0453684_0000031 Ga0453684_0000031_307967_308599 209
56 3300048921 Ga0496118_0207789 Ga0496118_0207789_178_834 209
57 3300048924 Ga0496121_0343298 Ga0496121_0343298_91_753 209
58 3300049568 Ga0501031_0089058 Ga0501031_0089058_1205_1861 209
59 3300049570 Ga0501033_0150139 Ga0501033_0150139_492_1148 209
60 3300049571 Ga0501034_0025458 Ga0501034_0025458_1186_1842 209
61 3300049571 Ga0501034_0348572 Ga0501034_0348572_235_870 209
62 3300049571 Ga0501034_0418102 Ga0501034_0418102_132_767 209
63 3300049581 Ga0501047_0206645 Ga0501047_0206645_281_943 209
64 3300049583 Ga0501067_0042856 Ga0501067_0042856_1316_1951 209
65 3300049583 Ga0501067_0106615 Ga0501067_0106615_807_1442 209
66 3300049583 Ga0501067_0347843 Ga0501067_0347843_164_799 209
67 3300049589 Ga0501073_0243585 Ga0501073_0243585_563_1198 209
68 3300049589 Ga0501073_0285079 Ga0501073_0285079_17_655 209
69 3300049592 Ga0501076_0101815 Ga0501076_0101815_1377_2012 209
70 3300049741 Ga0501079_0494257 Ga0501079_0494257_41_676 209
71 3300049742 Ga0501080_0132220 Ga0501080_0132220_227_862 209
72 3300049742 Ga0501080_0252385 Ga0501080_0252385_810_1445 209
73 3300049744 Ga0501083_0005111 Ga0501083_0005111_1497_2135 209
74 3300049744 Ga0501083_0010351 Ga0501083_0010351_4961_5596 209
75 3300049744 Ga0501083_0038864 Ga0501083_0038864_1113_1748 209
76 3300049822 Ga0501035_0191759 Ga0501035_0191759_312_965 209
77 3300049822 Ga0501035_0444766 Ga0501035_0444766_323_985 209
78 3300049823 Ga0501044_0130995 Ga0501044_0130995_1536_2183 209
79 3300049823 Ga0501044_0198096 Ga0501044_0198096_828_1484 209
80 3300050509 nmdc:mga0qj67_130987_c1 nmdc:mga0qj67_130987_c1_1220_1858 209
81 3300054114 Ga0501084_0009497 Ga0501084_0009497_1919_2554 209
82 3300054114 Ga0501084_0312302 Ga0501084_0312302_636_1271 209
83 3300054114 Ga0501084_0466113 Ga0501084_0466113_61_702 209
84 3300060353 Ga0501082_0007775 Ga0501082_0007775_246_881 209
85 3300060353 Ga0501082_0110894 Ga0501082_0110894_404_1039 209
86 iso_pu_bacteria 2524023250 2524610297 209
87 3300005327 Ga0070658_10234085 Ga0070658_102340852 210
88 3300005458 Ga0070681_10054076 Ga0070681_100540765 210
89 3300005563 Ga0068855_100051875 Ga0068855_1000518753 210
90 3300005614 Ga0068856_100602324 Ga0068856_1006023241 210
91 3300009093 Ga0105240_10081849 Ga0105240_100818495 210
92 3300009174 Ga0105241_10145219 Ga0105241_101452194 210
93 3300009545 Ga0105237_10619298 Ga0105237_106192982 210
94 3300010375 Ga0105239_10321194 Ga0105239_103211942 210
95 3300013105 Ga0157369_10027642 Ga0157369_100276426 210
96 3300025911 Ga0207654_10232377 Ga0207654_102323772 210
97 3300025912 Ga0207707_10044293 Ga0207707_100442932 210
98 3300025913 Ga0207695_10081357 Ga0207695_100813575 210
99 3300025916 Ga0207663_10381973 Ga0207663_103819732 210
100 3300025924 Ga0207694_10012988 Ga0207694_100129884 210
101 3300025949 Ga0207667_10007941 Ga0207667_100079419 210
102 3300026078 Ga0207702_10171271 Ga0207702_101712713 210
103 3300048907 Ga0496104_0328973 Ga0496104_0328973_49_717 210
104 3300048913 Ga0496110_0578586 Ga0496110_0578586_154_822 210
105 3300049574 Ga0501038_0149649 Ga0501038_0149649_455_1099 210
106 iso_pu_bacteria 2671180139 2671694560 210
107 3300005341 Ga0070691_10040017 Ga0070691_100400172 211
108 3300005406 Ga0070703_10002959 Ga0070703_100029595 211
109 3300005440 Ga0070705_100000171 Ga0070705_1000001713 211
110 3300005441 Ga0070700_100002232 Ga0070700_1000022322 211
111 3300005444 Ga0070694_100000555 Ga0070694_10000055516 211
112 3300005445 Ga0070708_100053574 Ga0070708_1000535742 211
113 3300005455 Ga0070663_100002218 Ga0070663_10000221810 211
114 3300005458 Ga0070681_10004750 Ga0070681_100047509 211
115 3300005467 Ga0070706_100305857 Ga0070706_1003058572 211
116 3300005518 Ga0070699_100000167 Ga0070699_10000016735 211
117 3300005545 Ga0070695_100000722 Ga0070695_10000072214 211
118 3300005546 Ga0070696_100000097 Ga0070696_10000009712 211
119 3300005547 Ga0070693_100023657 Ga0070693_1000236572 211
120 3300005549 Ga0070704_100007113 Ga0070704_1000071132 211
121 3300005577 Ga0068857_100009356 Ga0068857_10000935610 211
122 3300005617 Ga0068859_100001658 Ga0068859_10000165815 211
123 3300005840 Ga0068870_10037186 Ga0068870_100371864 211
124 3300005843 Ga0068860_100001592 Ga0068860_10000159212 211
125 3300005844 Ga0068862_100001428 Ga0068862_10000142813 211
126 3300005937 Ga0081455_10209285 Ga0081455_102092852 211
127 3300006846 Ga0075430_100030537 Ga0075430_1000305372 211
128 3300006847 Ga0075431_100000652 Ga0075431_10000065215 211
129 3300006847 Ga0075431_100000793 Ga0075431_1000007936 211
130 3300006880 Ga0075429_100013169 Ga0075429_1000131697 211
131 3300006931 Ga0097620_100001658 Ga0097620_10000165815 211
132 3300009545 Ga0105237_10197231 Ga0105237_101972312 211
133 3300009553 Ga0105249_10040803 Ga0105249_100408034 211
134 3300011119 Ga0105246_10043734 Ga0105246_100437344 211
135 3300013297 Ga0157378_10025383 Ga0157378_100253832 211
136 3300014745 Ga0157377_10119862 Ga0157377_101198622 211
137 3300021361 Ga0213872_10065815 Ga0213872_100658151 211
138 3300021441 Ga0213871_10007602 Ga0213871_100076022 211
139 3300025885 Ga0207653_10001766 Ga0207653_100017662 211
140 3300025908 Ga0207643_10438421 Ga0207643_104384212 211
141 3300025910 Ga0207684_10108118 Ga0207684_101081183 211
142 3300025912 Ga0207707_10014508 Ga0207707_100145082 211
143 3300025917 Ga0207660_10005384 Ga0207660_100053842 211
144 3300025933 Ga0207706_10027494 Ga0207706_100274945 211
145 3300025942 Ga0207689_10144623 Ga0207689_101446232 211
146 3300025961 Ga0207712_10001350 Ga0207712_100013503 211
147 3300026041 Ga0207639_10054034 Ga0207639_100540344 211
148 3300026067 Ga0207678_10005726 Ga0207678_1000572610 211
149 3300026075 Ga0207708_10000296 Ga0207708_1000029630 211
150 3300026116 Ga0207674_10004822 Ga0207674_1000482213 211
151 3300028380 Ga0268265_10000508 Ga0268265_1000050823 211
152 3300028381 Ga0268264_10003796 Ga0268264_100037962 211
153 3300039447 Ga0436361_0431438 Ga0436361_0431438_3786_4433 211
154 3300048903 Ga0496100_0067734 Ga0496100_0067734_355_1014 211
155 3300048904 Ga0496101_0163936 Ga0496101_0163936_705_1364 211
156 3300048905 Ga0496102_0003290 Ga0496102_0003290_5093_5752 211
157 3300048907 Ga0496104_0150280 Ga0496104_0150280_1465_2124 211
158 3300048909 Ga0496106_0004830 Ga0496106_0004830_880_1539 211
159 3300048910 Ga0496107_0001227 Ga0496107_0001227_10739_11398 211
160 3300048918 Ga0496115_0037216 Ga0496115_0037216_466_1125 211
161 3300049571 Ga0501034_0228348 Ga0501034_0228348_673_1311 211
162 3300049742 Ga0501080_0496433 Ga0501080_0496433_399_1043 211
163 3300050508 nmdc:mga09592_15142_c1 nmdc:mga09592_15142_c1_1121_1777 211
164 3300050510 nmdc:mga06r32_1040_c1 nmdc:mga06r32_1040_c1_5390_6046 211
165 3300005434 Ga0070709_10444045 Ga0070709_104440451 212
166 3300005841 Ga0068863_100057437 Ga0068863_1000574375 212
167 3300005937 Ga0081455_10000230 Ga0081455_1000023014 212
168 3300006844 Ga0075428_100101601 Ga0075428_1001016015 212
169 3300009094 Ga0111539_10001024 Ga0111539_1000102428 212
170 3300009094 Ga0111539_10266125 Ga0111539_102661254 212
171 3300009147 Ga0114129_10031876 Ga0114129_100318768 212
172 3300009147 Ga0114129_10767437 Ga0114129_107674372 212
173 3300009553 Ga0105249_10817366 Ga0105249_108173662 212
174 3300014326 Ga0157380_10288056 Ga0157380_102880562 212
175 3300025906 Ga0207699_10578280 Ga0207699_105782801 212
176 3300026088 Ga0207641_10044646 Ga0207641_100446464 212
177 3300027907 Ga0207428_10046390 Ga0207428_100463902 212
178 3300035724 Ga0373933_0082406 Ga0373933_0082406_36_689 212
179 3300036401 Ga0373937_0006904 Ga0373937_0006904_625_1278 212
180 3300044656 Ga0466969_0042037 Ga0466969_0042037_115_807 212
181 3300044684 Ga0466966_0125763 Ga0466966_0125763_317_1009 212
182 3300044693 Ga0466961_0075292 Ga0466961_0075292_843_1535 212
183 3300044719 Ga0466971_0078708 Ga0466971_0078708_693_1385 212
184 3300045049 Ga0466959_0019584 Ga0466959_0019584_2841_3533 212
185 3300045976 Ga0466967_0082999 Ga0466967_0082999_298_966 212
186 3300046516 Ga0495628_0168719 Ga0495628_0168719_431_1084 212
187 3300046809 Ga0495600_0290597 Ga0495600_0290597_205_858 212
188 3300050507 nmdc:mga05p37_243473_c1 nmdc:mga05p37_243473_c1_40_687 212
189 3300050511 nmdc:mga08y16_140659_c1 nmdc:mga08y16_140659_c1_368_1015 212
190 3300050511 nmdc:mga08y16_5279_c1 nmdc:mga08y16_5279_c1_2633_3280 212
191 iso_pu_bacteria 2791355199 2793081803 212
192 iso_pu_bacteria 2876808645 2876808905 212
193 iso_pu_bacteria 2879110137 2879110303 212
194 iso_pu_bacteria 2889033259 2889040737 212
195 iso_pu_bacteria 8056673599 8056678086 212
196 3300006038 Ga0075365_10005236 Ga0075365_100052364 213
197 3300006846 Ga0075430_100153798 Ga0075430_1001537982 213
198 3300006847 Ga0075431_100036187 Ga0075431_1000361875 213
199 3300031344 Ga0265316_10188380 Ga0265316_101883802 213
200 3300037068 Ga0373925_0056161 Ga0373925_0056161_798_1442 213
201 3300048907 Ga0496104_0000182 Ga0496104_0000182_18448_19095 213
202 3300048908 Ga0496105_0016358 Ga0496105_0016358_4542_5189 213
203 3300048911 Ga0496108_0001152 Ga0496108_0001152_14104_14751 213
204 3300048912 Ga0496109_0002055 Ga0496109_0002055_8773_9420 213
205 3300048913 Ga0496110_0008254 Ga0496110_0008254_483_1130 213
206 3300048914 Ga0496111_0012429 Ga0496111_0012429_4564_5211 213
207 3300048915 Ga0496112_0013651 Ga0496112_0013651_2299_2946 213
208 3300048916 Ga0496113_0020005 Ga0496113_0020005_3648_4295 213
209 3300049571 Ga0501034_0369283 Ga0501034_0369283_359_1018 213
210 3300049572 Ga0501036_0223254 Ga0501036_0223254_163_822 213
211 3300049822 Ga0501035_0467243 Ga0501035_0467243_344_1003 213
212 3300050492 nmdc:mga0yw44_45596_c1 nmdc:mga0yw44_45596_c1_436_1083 213
213 3300003781 Ga0055536_1000792 Ga0055536_10007922 214
214 3300005365 Ga0070688_100252835 Ga0070688_1002528351 214
215 3300005438 Ga0070701_10259451 Ga0070701_102594512 214
216 3300005440 Ga0070705_100577981 Ga0070705_1005779812 214
217 3300005841 Ga0068863_100001297 Ga0068863_10000129729 214
218 3300005843 Ga0068860_100000623 Ga0068860_10000062334 214
219 3300005844 Ga0068862_100000194 Ga0068862_10000019445 214
220 3300005985 Ga0081539_10047511 Ga0081539_100475115 214
221 3300006051 Ga0075364_10379242 Ga0075364_103792421 214
222 3300006846 Ga0075430_100036840 Ga0075430_1000368402 214
223 3300006847 Ga0075431_100102126 Ga0075431_1001021264 214
224 3300006871 Ga0075434_100485302 Ga0075434_1004853022 214
225 3300006871 Ga0075434_100706249 Ga0075434_1007062492 214
226 3300006931 Ga0097620_100018941 Ga0097620_1000189414 214
227 3300007076 Ga0075435_100917974 Ga0075435_1009179741 214
228 3300009553 Ga0105249_10000135 Ga0105249_1000013570 214
229 3300010375 Ga0105239_10619079 Ga0105239_106190791 214
230 3300010375 Ga0105239_10752637 Ga0105239_107526372 214
231 3300013297 Ga0157378_10139457 Ga0157378_101394573 214
232 3300014326 Ga0157380_10732823 Ga0157380_107328232 214
233 3300021384 Ga0213876_10184440 Ga0213876_101844402 214
234 3300025885 Ga0207653_10056818 Ga0207653_100568182 214
235 3300025923 Ga0207681_10118411 Ga0207681_101184113 214
236 3300025933 Ga0207706_10296554 Ga0207706_102965542 214
237 3300025961 Ga0207712_10000101 Ga0207712_1000010131 214
238 3300026035 Ga0207703_10286456 Ga0207703_102864562 214
239 3300026088 Ga0207641_10097239 Ga0207641_100972393 214
240 3300026089 Ga0207648_10901589 Ga0207648_109015891 214
241 3300026118 Ga0207675_100112912 Ga0207675_1001129122 214
242 3300027907 Ga0207428_10704229 Ga0207428_107042291 214
243 3300028380 Ga0268265_10000151 Ga0268265_1000015169 214
244 3300028381 Ga0268264_10000303 Ga0268264_1000030363 214
245 3300039437 Ga0436365_1673354 Ga0436365_1673354_344_994 214
246 3300045051 Ga0451576_0027187 Ga0451576_0027187_1528_2205 214
247 3300045051 Ga0451576_0110064 Ga0451576_0110064_2043_2732 214
248 3300048905 Ga0496102_0063257 Ga0496102_0063257_2425_3081 214
249 3300048906 Ga0496103_0314140 Ga0496103_0314140_255_911 214
250 3300048907 Ga0496104_0152048 Ga0496104_0152048_913_1569 214
251 3300048908 Ga0496105_0252568 Ga0496105_0252568_200_856 214
252 3300048910 Ga0496107_0096715 Ga0496107_0096715_433_1089 214
253 3300048911 Ga0496108_0092022 Ga0496108_0092022_1072_1728 214
254 3300048912 Ga0496109_0131046 Ga0496109_0131046_273_929 214
255 3300048912 Ga0496109_0378231 Ga0496109_0378231_22_678 214
256 3300048913 Ga0496110_0036848 Ga0496110_0036848_281_937 214
257 3300048913 Ga0496110_0088176 Ga0496110_0088176_725_1381 214
258 3300048916 Ga0496113_0086437 Ga0496113_0086437_600_1256 214
259 3300048917 Ga0496114_0200420 Ga0496114_0200420_186_842 214
260 3300048918 Ga0496115_0168281 Ga0496115_0168281_1061_1717 214
261 3300049574 Ga0501038_0423432 Ga0501038_0423432_104_799 214
262 3300049575 Ga0501039_0184135 Ga0501039_0184135_436_1131 214
263 3300049576 Ga0501040_0210412 Ga0501040_0210412_486_1190 214
264 3300049586 Ga0501070_0362359 Ga0501070_0362359_394_1089 214
265 3300049587 Ga0501071_0234134 Ga0501071_0234134_226_921 214
266 3300049590 Ga0501074_0296866 Ga0501074_0296866_238_933 214
267 3300049592 Ga0501076_0012958 Ga0501076_0012958_559_1254 214
268 3300049593 Ga0501077_0029077 Ga0501077_0029077_1689_2384 214
269 3300049824 Ga0501045_0076772 Ga0501045_0076772_1114_1809 214
270 3300050508 nmdc:mga09592_280333_c1 nmdc:mga09592_280333_c1_498_1154 214
271 3300050509 nmdc:mga0qj67_171880_c1 nmdc:mga0qj67_171880_c1_425_1081 214
272 3300050509 nmdc:mga0qj67_39723_c1 nmdc:mga0qj67_39723_c1_2293_2949 214
273 3300050510 nmdc:mga06r32_212204_c1 nmdc:mga06r32_212204_c1_746_1402 214
274 3300050510 nmdc:mga06r32_88502_c1 nmdc:mga06r32_88502_c1_661_1317 214
275 3300050513 nmdc:mga0rr50_369426_c1 nmdc:mga0rr50_369426_c1_257_913 214
276 3300054114 Ga0501084_0026219 Ga0501084_0026219_2097_2792 214
277 3300005356 Ga0070674_100414320 Ga0070674_1004143201 215
278 3300005455 Ga0070663_100105639 Ga0070663_1001056392 215
279 3300005546 Ga0070696_100098339 Ga0070696_1000983392 215
280 3300005578 Ga0068854_100568276 Ga0068854_1005682762 215
281 3300009098 Ga0105245_10376994 Ga0105245_103769942 215
282 3300011119 Ga0105246_10228958 Ga0105246_102289581 215
283 3300025937 Ga0207669_10128014 Ga0207669_101280142 215
284 3300026067 Ga0207678_10386905 Ga0207678_103869052 215
285 3300026089 Ga0207648_10083975 Ga0207648_100839754 215
286 3300031548 Ga0307408_100207219 Ga0307408_1002072192 215
287 3300031731 Ga0307405_10205343 Ga0307405_102053432 215
288 3300031903 Ga0307407_10256931 Ga0307407_102569312 215
289 3300034819 Ga0373958_0014878 Ga0373958_0014878_454_1125 215
290 3300034957 Ga0373938_0068776 Ga0373938_0068776_17_688 215
291 3300035085 Ga0373929_0025233 Ga0373929_0025233_65_718 215
292 3300035091 Ga0373951_0016900 Ga0373951_0016900_947_1618 215
293 3300035114 Ga0373939_0006111 Ga0373939_0006111_1476_2132 215
294 3300035115 Ga0373941_0001972 Ga0373941_0001972_1424_2095 215
295 3300035121 Ga0373960_0021196 Ga0373960_0021196_205_876 215
296 3300035691 Ga0373931_0004666 Ga0373931_0004666_4253_4924 215
297 3300035695 Ga0373927_0118770 Ga0373927_0118770_102_755 215
298 3300046455 Ga0495603_0052164 Ga0495603_0052164_1458_2114 215
299 3300046457 Ga0495590_0043258 Ga0495590_0043258_265_921 215
300 3300046473 Ga0495582_0276643 Ga0495582_0276643_121_774 215
301 3300046473 Ga0495582_0424562 Ga0495582_0424562_19_675 215
302 3300046506 Ga0495583_0041932 Ga0495583_0041932_751_1407 215
303 3300046616 Ga0495668_0244147 Ga0495668_0244147_240_896 215
304 3300046648 Ga0495611_0037715 Ga0495611_0037715_584_1240 215
305 3300046694 Ga0495649_0041881 Ga0495649_0041881_1366_2022 215
306 3300046794 Ga0495589_0061902 Ga0495589_0061902_1067_1723 215
307 3300047320 Ga0495672_0024387 Ga0495672_0024387_1622_2278 215
308 3300047469 Ga0495673_0110508 Ga0495673_0110508_171_947 215
309 3300048927 Ga0496124_0016861 Ga0496124_0016861_4482_5150 215
310 3300050511 nmdc:mga08y16_371687_c1 nmdc:mga08y16_371687_c1_770_1438 215
311 3300053085 Ga0495619_0593264 Ga0495619_0593264_61_735 215
312 3300053098 Ga0500650_0202708 Ga0500650_0202708_57_713 215
313 3300053133 Ga0500655_043209 Ga0500655_043209_160_816 215
314 iso_pu_bacteria 2508501009 2508543532 215
315 iso_pu_bacteria 2508501042 2508698690 215
316 iso_pu_bacteria 2511231028 2511395151 215
317 iso_pu_bacteria 2513237096 2513656524 215
318 iso_pu_bacteria 2513237137 2513859592 215
319 iso_pu_bacteria 2513237145 2513917709 215
320 iso_pu_bacteria 2515154112 2515631317 215
321 iso_pu_bacteria 2517093001 2517106637 215
322 iso_pu_bacteria 2517572143 2517893218 215
323 iso_pu_bacteria 2523231067 2523467256 215
324 iso_pu_bacteria 2524023228 2524537228 215
325 iso_pu_bacteria 2667528175 2671117854 215
326 iso_pu_bacteria 2791355197 2793069915 215
327 iso_pu_bacteria 2824661429 2824666274 215
328 iso_pu_bacteria 2874590934 2874591915 215
329 iso_pu_bacteria 2874645413 2874651249 215
330 iso_pu_bacteria 2876771140 2876771506 215
331 iso_pu_bacteria 2876818435 2876819459 215
332 iso_pu_bacteria 2879074833 2879075911 215
333 iso_pu_bacteria 2885374607 2885374809 215
334 iso_pu_bacteria 2888388044 2888394724 215
335 iso_pu_bacteria 2903748898 2903755682 215
336 iso_pu_bacteria 2904699407 2904704187 215
337 iso_pu_bacteria 2906610324 2906617578 215
338 iso_pu_bacteria 2906635258 2906635777 215
339 iso_pu_bacteria 2906660503 2906667919 215
340 iso_pu_bacteria 2908739725 2908743611 215
341 iso_pu_bacteria 2922425934 2922429265 215
342 iso_pu_bacteria 2929615660 2929615661 215
343 iso_pu_bacteria 2929624759 2929630276 215
344 iso_pu_bacteria 2932828146 2932835980 215
345 iso_pu_bacteria 2933577622 2933579052 215
346 iso_pu_bacteria 2935630451 2935634155 215
347 iso_pu_bacteria 2935638405 2935647296 215
348 iso_pu_bacteria 2935648319 2935651697 215
349 iso_pu_bacteria 2935656913 2935660507 215
350 iso_pu_bacteria 2935665750 2935674398 215
351 iso_pu_bacteria 2935810662 2935818953 215
352 iso_pu_bacteria 2935827899 2935836673 215
353 iso_pu_bacteria 2935975950 2935980824 215
354 iso_pu_bacteria 2935984226 2935990308 215
355 iso_pu_bacteria 2936011229 2936014563 215
356 iso_pu_bacteria 2936019824 2936023641 215
357 iso_pu_bacteria 2936028420 2936032669 215
358 iso_pu_bacteria 2936037263 2936045667 215
359 iso_pu_bacteria 2936046547 2936050304 215
360 iso_pu_bacteria 2936055302 2936059204 215
361 iso_pu_bacteria 2941507105 2941511046 215
362 iso_pu_bacteria 2941515067 2941518430 215
363 iso_pu_bacteria 2941523033 2941527307 215
364 iso_pu_bacteria 3005474847 3005479429 215
365 iso_pu_bacteria 8006933436 8006941724 215
366 iso_pu_bacteria 8006973647 8006981438 215
367 iso_pu_bacteria 8016511872 8016514428 215
368 iso_pu_bacteria 8016583857 8016592949 215
369 iso_pu_bacteria 8016630954 8016632003 215
370 iso_pu_bacteria 8017057580 8017061997 215
371 iso_pu_bacteria 8019555841 8019557625 215
372 iso_pu_bacteria 8019619141 8019627172 215
373 iso_pu_bacteria 8019629233 8019635377 215
374 iso_pu_bacteria 8019638758 8019644327 215
375 iso_pu_bacteria 8019659431 8019663203 215
376 iso_pu_bacteria 8019668869 8019672810 215
377 iso_pu_bacteria 8019678201 8019683329 215
378 iso_pu_bacteria 8055742211 8055747309 215
379 iso_pu_bacteria 8056689827 8056690295 215
380 3300005341 Ga0070691_10128741 Ga0070691_101287412 216
381 3300005344 Ga0070661_100085416 Ga0070661_1000854163 216
382 3300005353 Ga0070669_100235528 Ga0070669_1002355281 216
383 3300005356 Ga0070674_100013377 Ga0070674_1000133776 216
384 3300005459 Ga0068867_100203869 Ga0068867_1002038691 216
385 3300005544 Ga0070686_100018540 Ga0070686_1000185402 216
386 3300005547 Ga0070693_100175755 Ga0070693_1001757552 216
387 3300005548 Ga0070665_100513659 Ga0070665_1005136592 216
388 3300005564 Ga0070664_100213309 Ga0070664_1002133091 216
389 3300005615 Ga0070702_100083117 Ga0070702_1000831172 216
390 3300005718 Ga0068866_10011028 Ga0068866_100110285 216
391 3300005719 Ga0068861_100023275 Ga0068861_1000232756 216
392 3300005843 Ga0068860_100299305 Ga0068860_1002993052 216
393 3300005844 Ga0068862_100021469 Ga0068862_1000214696 216
394 3300005937 Ga0081455_10005420 Ga0081455_100054205 216
395 3300005937 Ga0081455_10065103 Ga0081455_100651034 216
396 3300005983 Ga0081540_1000423 Ga0081540_100042338 216
397 3300006195 Ga0075366_10538257 Ga0075366_105382571 216
398 3300006881 Ga0068865_100026656 Ga0068865_1000266562 216
399 3300009094 Ga0111539_10749462 Ga0111539_107494621 216
400 3300009148 Ga0105243_10278187 Ga0105243_102781872 216
401 3300009174 Ga0105241_10533436 Ga0105241_105334361 216
402 3300014325 Ga0163163_10413721 Ga0163163_104137212 216
403 3300014745 Ga0157377_10114456 Ga0157377_101144562 216
404 3300014968 Ga0157379_10572245 Ga0157379_105722452 216
405 3300014969 Ga0157376_10564819 Ga0157376_105648192 216
406 3300017792 Ga0163161_10049221 Ga0163161_100492212 216
407 3300025899 Ga0207642_10026215 Ga0207642_100262152 216
408 3300025918 Ga0207662_10116581 Ga0207662_101165812 216
409 3300025923 Ga0207681_10240798 Ga0207681_102407982 216
410 3300025927 Ga0207687_10462458 Ga0207687_104624582 216
411 3300025932 Ga0207690_10150091 Ga0207690_101500913 216
412 3300025933 Ga0207706_10046897 Ga0207706_100468973 216
413 3300025935 Ga0207709_10060686 Ga0207709_100606861 216
414 3300025972 Ga0207668_10040749 Ga0207668_100407492 216
415 3300025972 Ga0207668_10507438 Ga0207668_105074382 216
416 3300026067 Ga0207678_10097086 Ga0207678_100970862 216
417 3300026075 Ga0207708_10032322 Ga0207708_100323224 216
418 3300026121 Ga0207683_10080458 Ga0207683_100804583 216
419 3300028379 Ga0268266_10460187 Ga0268266_104601872 216
420 3300028380 Ga0268265_10026653 Ga0268265_100266535 216
421 3300028381 Ga0268264_10059275 Ga0268264_100592752 216
422 3300039437 Ga0436365_1501284 Ga0436365_1501284_2990_3727 216
423 3300042876 Ga0451577_0147776 Ga0451577_0147776_638_1306 216
424 3300046474 Ga0495605_0055791 Ga0495605_0055791_409_1065 216
425 3300046513 Ga0495616_0037479 Ga0495616_0037479_1746_2402 216
426 3300046615 Ga0495656_0021282 Ga0495656_0021282_38_694 216
427 3300046684 Ga0495669_0002716 Ga0495669_0002716_4620_5276 216
428 3300046691 Ga0495670_0116490 Ga0495670_0116490_322_978 216
429 3300047472 Ga0495686_0170559 Ga0495686_0170559_307_963 216
430 3300048090 Ga0495615_0085706 Ga0495615_0085706_170_826 216
431 3300048905 Ga0496102_0025292 Ga0496102_0025292_639_1292 216
432 3300048906 Ga0496103_0124712 Ga0496103_0124712_928_1581 216
433 3300048909 Ga0496106_0739694 Ga0496106_0739694_71_727 216
434 3300048917 Ga0496114_0162081 Ga0496114_0162081_680_1336 216
435 3300048918 Ga0496115_0096864 Ga0496115_0096864_838_1494 216
436 3300048918 Ga0496115_0460152 Ga0496115_0460152_144_797 216
437 3300049581 Ga0501047_0331608 Ga0501047_0331608_74_733 216
438 3300049592 Ga0501076_0033571 Ga0501076_0033571_3212_3868 216
439 3300050492 nmdc:mga0yw44_304098_c1 nmdc:mga0yw44_304098_c1_389_1042 216
440 3300050511 nmdc:mga08y16_654463_c1 nmdc:mga08y16_654463_c1_353_1021 216
441 iso_pu_bacteria 2513237098 2513676801 216
442 3300005262 Ga0065165_1002461 Ga0065165_10024617 217
443 3300006852 Ga0075433_10308314 Ga0075433_103083142 217
444 3300006871 Ga0075434_100139069 Ga0075434_1001390692 217
445 3300025302 Ga0207426_1001063 Ga0207426_10010639 217
446 3300028379 Ga0268266_10095574 Ga0268266_100955742 217
447 3300037466 Ga0395898_0408602 Ga0395898_0408602_395_1054 217
448 3300038443 Ga0395901_0776576 Ga0395901_0776576_55_714 217
449 3300046524 Ga0495648_0232528 Ga0495648_0232528_144_821 217
450 3300046648 Ga0495611_0192823 Ga0495611_0192823_207_884 217
451 3300048917 Ga0496114_0124231 Ga0496114_0124231_889_1584 217
452 3300048918 Ga0496115_0137187 Ga0496115_0137187_180_875 217
453 3300049569 Ga0501032_0077494 Ga0501032_0077494_1401_2060 217
454 3300049581 Ga0501047_0374238 Ga0501047_0374238_60_719 217
455 3300049586 Ga0501070_0369030 Ga0501070_0369030_37_696 217
456 3300049822 Ga0501035_0143338 Ga0501035_0143338_1272_1931 217
457 3300049823 Ga0501044_0775571 Ga0501044_0775571_110_769 217
458 3300053087 Ga0500643_000025 Ga0500643_000025_99916_100593 217
459 3300053096 Ga0500641_0065665 Ga0500641_0065665_208_885 217
460 3300053103 Ga0500555_002304 Ga0500555_002304_560_1237 217
461 3300053130 Ga0500642_0007503 Ga0500642_0007503_1052_1729 217
462 3300053139 Ga0500568_0008868 Ga0500568_0008868_1917_2594 217
463 3300053147 Ga0500589_134775 Ga0500589_134775_256_933 217
464 3300053158 Ga0500627_0008486 Ga0500627_0008486_2820_3497 217
465 3300053730 Ga0500645_082044 Ga0500645_082044_158_835 217
466 3300003215 JGI25153J46596_10013737 JGI25153J46596_100137375 218
467 3300003215 JGI25153J46596_10034134 JGI25153J46596_100341342 218
468 3300003759 Ga0055525_1006398 Ga0055525_10063982 218
469 3300005327 Ga0070658_10054028 Ga0070658_100540284 218
470 3300005339 Ga0070660_100345609 Ga0070660_1003456092 218
471 3300005547 Ga0070693_100404262 Ga0070693_1004042622 218
472 3300006186 Ga0075369_10044754 Ga0075369_100447542 218
473 3300006195 Ga0075366_10118075 Ga0075366_101180752 218
474 3300013297 Ga0157378_10335847 Ga0157378_103358472 218
475 3300025230 Ga0209563_101101 Ga0209563_1011015 218
476 3300025253 Ga0209677_102497 Ga0209677_1024977 218
477 3300025273 Ga0209673_1039315 Ga0209673_10393152 218
478 3300025295 Ga0209564_1002681 Ga0209564_10026812 218
479 3300025295 Ga0209564_1017449 Ga0209564_10174495 218
480 3300025297 Ga0209758_1003040 Ga0209758_100304014 218
481 3300025297 Ga0209758_1003616 Ga0209758_10036169 218
482 3300025299 Ga0209256_1003151 Ga0209256_10031519 218
483 3300025302 Ga0207426_1000596 Ga0207426_100059626 218
484 3300025919 Ga0207657_10042204 Ga0207657_100422044 218
485 3300026078 Ga0207702_10800954 Ga0207702_108009542 218
486 3300033180 Ga0307510_10031031 Ga0307510_100310316 218
487 3300033180 Ga0307510_10042319 Ga0307510_100423196 218
488 3300033180 Ga0307510_10285351 Ga0307510_102853512 218
489 3300037853 Ga0436364_0954368 Ga0436364_0954368_36_716 218
490 3300041460 Ga0451802_0229276 Ga0451802_0229276_96_770 218
491 3300046454 Ga0495592_0123465 Ga0495592_0123465_603_1277 218
492 3300046459 Ga0495629_0004968 Ga0495629_0004968_3637_4311 218
493 3300046507 Ga0495606_0155650 Ga0495606_0155650_180_854 218
494 3300046511 Ga0495608_0124875 Ga0495608_0124875_194_868 218
495 3300046514 Ga0495618_0207985 Ga0495618_0207985_47_721 218
496 3300046524 Ga0495648_0044488 Ga0495648_0044488_1474_2148 218
497 3300046530 Ga0495654_0186340 Ga0495654_0186340_48_722 218
498 3300046531 Ga0495665_0344006 Ga0495665_0344006_44_718 218
499 3300046536 Ga0495587_0145172 Ga0495587_0145172_61_735 218
500 3300046557 Ga0495622_0028661 Ga0495622_0028661_891_1565 218
501 3300046660 Ga0495625_0194413 Ga0495625_0194413_204_878 218
502 3300046663 Ga0495635_0021418 Ga0495635_0021418_1065_1739 218
503 3300046675 Ga0495657_0082366 Ga0495657_0082366_1211_1885 218
504 3300046679 Ga0495623_0155529 Ga0495623_0155529_354_1028 218
505 3300046680 Ga0495646_0080631 Ga0495646_0080631_437_1111 218
506 3300046683 Ga0495658_0334451 Ga0495658_0334451_168_842 218
507 3300046689 Ga0495613_0074903 Ga0495613_0074903_1020_1694 218
508 3300046690 Ga0495624_0123530 Ga0495624_0123530_677_1351 218
509 3300046692 Ga0495671_0109872 Ga0495671_0109872_410_1084 218
510 3300046694 Ga0495649_0038722 Ga0495649_0038722_196_870 218
511 3300046809 Ga0495600_0050462 Ga0495600_0050462_1528_2202 218
512 3300047315 Ga0495581_0174708 Ga0495581_0174708_135_809 218
513 3300047321 Ga0495676_0032128 Ga0495676_0032128_2976_3650 218
514 3300047469 Ga0495673_0167862 Ga0495673_0167862_89_763 218
515 3300047673 Ga0495593_0080837 Ga0495593_0080837_692_1366 218
516 3300048907 Ga0496104_0040114 Ga0496104_0040114_2822_3496 218
517 3300048908 Ga0496105_0110087 Ga0496105_0110087_1210_1884 218
518 3300048916 Ga0496113_0235526 Ga0496113_0235526_387_1061 218
519 3300048918 Ga0496115_0162457 Ga0496115_0162457_282_956 218
520 3300048919 Ga0496116_0232006 Ga0496116_0232006_71_745 218
521 3300048922 Ga0496119_0016935 Ga0496119_0016935_3183_3857 218
522 3300048923 Ga0496120_0124632 Ga0496120_0124632_91_765 218
523 3300048927 Ga0496124_0152553 Ga0496124_0152553_503_1177 218
524 3300048928 Ga0496125_0096968 Ga0496125_0096968_516_1190 218
525 3300048928 Ga0496125_0296150 Ga0496125_0296150_72_746 218
526 3300049460 Ga0495682_0040447 Ga0495682_0040447_882_1556 218
527 3300049570 Ga0501033_0609990 Ga0501033_0609990_33_698 218
528 3300049571 Ga0501034_0000391 Ga0501034_0000391_55287_55952 218
529 3300049572 Ga0501036_0062691 Ga0501036_0062691_499_1164 218
530 3300049574 Ga0501038_0112787 Ga0501038_0112787_464_1129 218
531 3300049575 Ga0501039_0000070 Ga0501039_0000070_49127_49792 218
532 3300049579 Ga0501043_0044532 Ga0501043_0044532_1131_1796 218
533 3300049580 Ga0501046_0007046 Ga0501046_0007046_5391_6056 218
534 3300049581 Ga0501047_0000102 Ga0501047_0000102_20483_21148 218
535 3300049583 Ga0501067_0005270 Ga0501067_0005270_355_1020 218
536 3300049586 Ga0501070_0021105 Ga0501070_0021105_762_1427 218
537 3300049742 Ga0501080_0000028 Ga0501080_0000028_38039_38704 218
538 3300049822 Ga0501035_0000020 Ga0501035_0000020_57861_58526 218
539 3300049823 Ga0501044_0000007 Ga0501044_0000007_123041_123706 218
540 3300049824 Ga0501045_0084042 Ga0501045_0084042_171_836 218
541 3300050491 nmdc:mga00v17_172718_c1 nmdc:mga00v17_172718_c1_338_1012 218
542 3300050493 nmdc:mga0k408_132933_c1 nmdc:mga0k408_132933_c1_549_1223 218
543 3300050516 nmdc:mga0sz30_18114_c1 nmdc:mga0sz30_18114_c1_2063_2737 218
544 3300053083 Ga0495655_0089423 Ga0495655_0089423_185_859 218
545 3300053086 Ga0500578_0106784 Ga0500578_0106784_354_1028 218
546 3300053088 Ga0500644_0032464 Ga0500644_0032464_246_920 218
547 3300053109 Ga0500569_018641 Ga0500569_018641_1081_1755 218
548 3300053111 Ga0500572_034326 Ga0500572_034326_357_1031 218
549 3300053121 Ga0500607_027067 Ga0500607_027067_2446_3120 218
550 3300053123 Ga0500614_045766 Ga0500614_045766_421_1095 218
551 3300053134 Ga0500658_0133994 Ga0500658_0133994_352_1026 218
552 3300053136 Ga0500559_0034055 Ga0500559_0034055_1226_1900 218
553 3300053136 Ga0500559_0035588 Ga0500559_0035588_537_1211 218
554 3300053150 Ga0500603_002147 Ga0500603_002147_3263_3958 218
555 3300053154 Ga0500619_000868 Ga0500619_000868_3990_4664 218
556 3300053160 Ga0500633_0020495 Ga0500633_0020495_336_1013 218
557 3300053162 Ga0500638_011578 Ga0500638_011578_3224_3898 218
558 3300053177 Ga0500636_0284226 Ga0500636_0284226_48_722 218
559 3300060353 Ga0501082_0051487 Ga0501082_0051487_2299_2964 218
560 3300061734 Ga0530510_0136303 Ga0530510_0136303_333_1013 218
561 3300003214 JGI25165J46597_1011751 JGI25165J46597_10117512 219
562 3300005435 Ga0070714_100058060 Ga0070714_1000580602 219
563 3300005436 Ga0070713_100047485 Ga0070713_1000474853 219
564 3300005985 Ga0081539_10000231 Ga0081539_1000023181 219
565 3300006028 Ga0070717_10031151 Ga0070717_100311515 219
566 3300013297 Ga0157378_10025603 Ga0157378_100256032 219
567 3300021388 Ga0213875_10021595 Ga0213875_100215955 219
568 3300025261 Ga0209233_1026715 Ga0209233_10267152 219
569 3300025929 Ga0207664_10142487 Ga0207664_101424872 219
570 3300025944 Ga0207661_10307155 Ga0207661_103071551 219
571 3300025986 Ga0207658_10212172 Ga0207658_102121723 219
572 3300028379 Ga0268266_10653362 Ga0268266_106533622 219
573 3300031238 Ga0265332_10010810 Ga0265332_100108105 219
574 3300031247 Ga0265340_10131148 Ga0265340_101311482 219
575 3300031249 Ga0265339_10276108 Ga0265339_102761081 219
576 3300031344 Ga0265316_10463540 Ga0265316_104635402 219
577 3300031712 Ga0265342_10227084 Ga0265342_102270842 219
578 3300032126 Ga0307415_100755715 Ga0307415_1007557152 219
579 3300033544 Ga0316215_1007363 Ga0316215_10073631 219
580 3300035410 Ga0373924_0027381 Ga0373924_0027381_157_852 219
581 3300035695 Ga0373927_0038409 Ga0373927_0038409_1338_2033 219
582 3300036712 Ga0316584_0036211 Ga0316584_0036211_2891_3637 219
583 3300037466 Ga0395898_0742938 Ga0395898_0742938_70_735 219
584 3300037853 Ga0436364_0075557 Ga0436364_0075557_8171_8845 219
585 3300046472 Ga0495580_0373031 Ga0495580_0373031_84_785 219
586 3300046507 Ga0495606_0005580 Ga0495606_0005580_10614_11306 219
587 3300047319 Ga0495674_0586613 Ga0495674_0586613_104_805 219
588 3300048905 Ga0496102_0397934 Ga0496102_0397934_154_813 219
589 3300048928 Ga0496125_0004318 Ga0496125_0004318_6836_7555 219
590 3300048929 Ga0496126_0100701 Ga0496126_0100701_1661_2359 219
591 3300048929 Ga0496126_0218628 Ga0496126_0218628_375_1034 219
592 3300048929 Ga0496126_0495796 Ga0496126_0495796_265_960 219
593 3300049571 Ga0501034_0004261 Ga0501034_0004261_12674_13360 219
594 3300049581 Ga0501047_0081221 Ga0501047_0081221_493_1197 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

44

214

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9318 17 216
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.8176 17 218
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.8159 17 216
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7604 17 218
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7478 17 216
ID Description Score Start End Superfamily
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9285 17 216 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8765 7 216 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8383 7 216 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8159 17 216 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.808 17 218 3.40.470.10
ID Description Score Start End GO Terms
AF-Q2IWV2-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9999 22 218 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A1M3ADW1-F1-model_v4 deleted 0.9994 22 179
AF-A0A257XB46-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9988 14 191 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A537NUU7-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9974 14 206 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A3D2L3Z4-F1-model_v4 Uracil-DNA glycosylase 0.9968 24 155 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Feature Viewer

pLDDT pTM Quality
94.73 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map