F467359

General Info

Members Datasets Scaffolds Average Seq Length
594 283 1188 75

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0893502|Ga0451793_0893502_16_273
Length 85
Sequence MDDRINAVAKGFAAYSAEFAATEQAEVRVGLNETLGLSGSLRSAVHDIEAKLKDDTSRARANQVVSSVLDALATAREIRLKTRIS

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
249 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.73
Nodule 0
Rhizoplane 2.53
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_0893502 3300041452 Bacteria 620
2 JGI24743J22301_10037859 3300001991 Unclassified 962
3 JGI24744J21845_10016645 3300002077 Unclassified 1463
4 JGI24035J26624_1009520 3300002126 Bacteria 958
5 JGI24751J29686_10010960 3300002459 Bacteria 1869
6 Ga0065712_10020126 3300005290 Bacteria 2039
7 Ga0065712_10080658 3300005290 Bacteria 3081
8 Ga0065712_10098612 3300005290 Bacteria 2114
9 Ga0065712_10248884 3300005290 Bacteria 961
10 Ga0065712_10267040 3300005290 Unclassified 918
11 Ga0065712_10361550 3300005290 Bacteria 774
12 Ga0065712_10725849 3300005290 Unclassified 501
13 Ga0065715_10106023 3300005293 Bacteria 2856
14 Ga0065715_10134975 3300005293 Bacteria 1935
15 Ga0065715_10158008 3300005293 Bacteria 1650
16 Ga0065715_10178053 3300005293 Bacteria 1497
17 Ga0065715_10242354 3300005293 Bacteria 1195
18 Ga0065715_10472038 3300005293 Unclassified 805
19 Ga0065707_10001684 3300005295 Bacteria 8973
20 Ga0065707_10254657 3300005295 Bacteria 1114
21 Ga0065707_10575415 3300005295 Unclassified 705
22 Ga0070658_11005788 3300005327 Unclassified 725
23 Ga0070676_10036819 3300005328 Bacteria 2820
24 Ga0070676_10942181 3300005328 Bacteria 645
25 Ga0070676_11128984 3300005328 Bacteria 593
26 Ga0070683_100560642 3300005329 Bacteria 1092
27 Ga0070683_101185938 3300005329 Unclassified 734
28 Ga0070690_100115552 3300005330 Bacteria 1795
29 Ga0070690_100982960 3300005330 Bacteria 664
30 Ga0070670_100065178 3300005331 Bacteria 3125
31 Ga0070670_100314323 3300005331 Bacteria 1372
32 Ga0070670_100635493 3300005331 Unclassified 957
33 Ga0070677_10712638 3300005333 Unclassified 566
34 Ga0068869_100117276 3300005334 Bacteria 2032
35 Ga0068869_101909981 3300005334 Bacteria 532
36 Ga0070666_10210812 3300005335 Bacteria 1368
37 Ga0070666_10271988 3300005335 Bacteria 1203
38 Ga0070682_100792734 3300005337 Bacteria 769
39 Ga0070682_101389206 3300005337 Bacteria 600
40 Ga0068868_100150625 3300005338 Bacteria 1915
41 Ga0068868_100788013 3300005338 Unclassified 857
42 Ga0068868_101438096 3300005338 Bacteria 644
43 Ga0070660_100458828 3300005339 Bacteria 1058
44 Ga0070660_100465130 3300005339 Bacteria 1050
45 Ga0070660_100747810 3300005339 Bacteria 821
46 Ga0070660_101755486 3300005339 Bacteria 529
47 Ga0070689_100704133 3300005340 Unclassified 882
48 Ga0070691_10448709 3300005341 Bacteria 736
49 Ga0070691_10557832 3300005341 Unclassified 670
50 Ga0070687_100303625 3300005343 Bacteria 1014
51 Ga0070661_100500328 3300005344 Bacteria 973
52 Ga0070661_101426092 3300005344 Unclassified 583
53 Ga0070668_101455142 3300005347 Bacteria 626
54 Ga0070669_100055499 3300005353 Bacteria 2903
55 Ga0070669_100059857 3300005353 Bacteria 2797
56 Ga0070669_100243027 3300005353 Bacteria 1431
57 Ga0070669_100768694 3300005353 Bacteria 817
58 Ga0070675_100291185 3300005354 Bacteria 1437
59 Ga0070675_100359203 3300005354 Bacteria 1293
60 Ga0070675_100563792 3300005354 Bacteria 1031
61 Ga0070675_101960979 3300005354 Bacteria 540
62 Ga0070671_100170366 3300005355 Bacteria 1841
63 Ga0070671_102128494 3300005355 Bacteria 500
64 Ga0070674_100037637 3300005356 Bacteria 3255
65 Ga0070674_100054476 3300005356 Bacteria 2766
66 Ga0070674_100226196 3300005356 Bacteria 1458
67 Ga0070674_100276634 3300005356 Bacteria 1329
68 Ga0070674_100421942 3300005356 Unclassified 1095
69 Ga0070674_100444128 3300005356 Bacteria 1069
70 Ga0070674_100915187 3300005356 Bacteria 765
71 Ga0070674_101448401 3300005356 Bacteria 616
72 Ga0070674_101472635 3300005356 Bacteria 611
73 Ga0070674_101850295 3300005356 Unclassified 548
74 Ga0070673_100076241 3300005364 Bacteria 2707
75 Ga0070673_100205774 3300005364 Bacteria 1697
76 Ga0070673_100896744 3300005364 Bacteria 822
77 Ga0070673_101558160 3300005364 Bacteria 624
78 Ga0070673_101954111 3300005364 Bacteria 557
79 Ga0070688_100490715 3300005365 Bacteria 925
80 Ga0070659_100080007 3300005366 Bacteria 2609
81 Ga0070659_100477445 3300005366 Bacteria 1060
82 Ga0070667_100241737 3300005367 Bacteria 1612
83 Ga0070667_102077605 3300005367 Unclassified 535
84 Ga0070703_10546323 3300005406 Bacteria 528
85 Ga0070709_11376453 3300005434 Unclassified 571
86 Ga0070713_100270524 3300005436 Bacteria 1556
87 Ga0070713_101897892 3300005436 Unclassified 578
88 Ga0070701_10041767 3300005438 Bacteria 2338
89 Ga0070701_10534476 3300005438 Bacteria 766
90 Ga0070705_100117382 3300005440 Bacteria 1712
91 Ga0070700_100039193 3300005441 Bacteria 2893
92 Ga0070700_100088938 3300005441 Bacteria 2011
93 Ga0070694_100731733 3300005444 Unclassified 807
94 Ga0070694_101537863 3300005444 Unclassified 564
95 Ga0070708_102127896 3300005445 Bacteria 519
96 Ga0070663_100135363 3300005455 Bacteria 1875
97 Ga0070663_100501673 3300005455 Bacteria 1008
98 Ga0070663_100958181 3300005455 Bacteria 742
99 Ga0070678_100119932 3300005456 Bacteria 2072
100 Ga0070678_100132463 3300005456 Bacteria 1983
101 Ga0070678_100132619 3300005456 Bacteria 1982
102 Ga0070678_101253444 3300005456 Bacteria 689
103 Ga0070662_100100214 3300005457 Bacteria 2191
104 Ga0070662_100709971 3300005457 Unclassified 851
105 Ga0070662_100967774 3300005457 Bacteria 728
106 Ga0070662_101613455 3300005457 Bacteria 560
107 Ga0070681_10178803 3300005458 Bacteria 2043
108 Ga0070681_10878796 3300005458 Bacteria 814
109 Ga0070681_11283366 3300005458 Unclassified 655
110 Ga0068867_101705242 3300005459 Unclassified 591
111 Ga0070685_10135140 3300005466 Bacteria 1546
112 Ga0070685_11541212 3300005466 Unclassified 513
113 Ga0070706_100054324 3300005467 Bacteria 3697
114 Ga0070699_100185532 3300005518 Bacteria 1847
115 Ga0070699_100285516 3300005518 Bacteria 1479
116 Ga0070679_100088377 3300005530 Bacteria 3086
117 Ga0070679_100296772 3300005530 Bacteria 1567
118 Ga0070679_100427377 3300005530 Bacteria 1270
119 Ga0070684_100102554 3300005535 Bacteria 2558
120 Ga0068853_100433001 3300005539 Bacteria 1235
121 Ga0068853_100820444 3300005539 Unclassified 891
122 Ga0070672_100607368 3300005543 Bacteria 953
123 Ga0070686_100827181 3300005544 Unclassified 748
124 Ga0070695_100154900 3300005545 Bacteria 1603
125 Ga0070695_101156637 3300005545 Bacteria 635
126 Ga0070696_100544500 3300005546 Unclassified 929
127 Ga0070696_100927000 3300005546 Bacteria 724
128 Ga0070665_100334922 3300005548 Bacteria 1518
129 Ga0070665_101142955 3300005548 Unclassified 790
130 Ga0070665_102627461 3300005548 Unclassified 504
131 Ga0070704_100057880 3300005549 Bacteria 2759
132 Ga0070704_100443842 3300005549 Bacteria 1116
133 Ga0070704_100755988 3300005549 Bacteria 866
134 Ga0070704_101915567 3300005549 Bacteria 549
135 Ga0068855_100595393 3300005563 Bacteria 1193
136 Ga0068855_102412729 3300005563 Bacteria 525
137 Ga0070664_100038031 3300005564 Bacteria 4049
138 Ga0070664_100151858 3300005564 Bacteria 2045
139 Ga0070664_100343716 3300005564 Bacteria 1356
140 Ga0070664_100681635 3300005564 Bacteria 957
141 Ga0068854_100433118 3300005578 Bacteria 1095
142 Ga0068854_100571719 3300005578 Bacteria 961
143 Ga0068854_100647914 3300005578 Bacteria 907
144 Ga0068854_100877858 3300005578 Bacteria 787
145 Ga0068856_100846174 3300005614 Bacteria 934
146 Ga0068856_102146666 3300005614 Bacteria 568
147 Ga0070702_100086441 3300005615 Bacteria 1891
148 Ga0068852_100261961 3300005616 Bacteria 1660
149 Ga0068852_101081002 3300005616 Bacteria 822
150 Ga0068852_102086563 3300005616 Bacteria 589
151 Ga0068859_100197614 3300005617 Bacteria 2095
152 Ga0068859_100579374 3300005617 Bacteria 1216
153 Ga0068864_100065315 3300005618 Bacteria 3157
154 Ga0068864_100276946 3300005618 Bacteria 1565
155 Ga0068864_100422108 3300005618 Bacteria 1271
156 Ga0068864_100833456 3300005618 Bacteria 908
157 Ga0068864_101589369 3300005618 Bacteria 658
158 Ga0068861_100483854 3300005719 Bacteria 1116
159 Ga0068861_102354322 3300005719 Bacteria 535
160 Ga0068851_11009503 3300005834 Bacteria 525
161 Ga0068863_100495509 3300005841 Bacteria 1203
162 Ga0068863_102081353 3300005841 Bacteria 578
163 Ga0068858_100076487 3300005842 Bacteria 3108
164 Ga0068860_100069982 3300005843 Bacteria 3335
165 Ga0068860_101154271 3300005843 Unclassified 794
166 Ga0068862_101592830 3300005844 Bacteria 660
167 Ga0075365_10275318 3300006038 Bacteria 1184
168 Ga0075368_10103693 3300006042 Bacteria 1170
169 Ga0075363_100029356 3300006048 Bacteria 2838
170 Ga0075364_10026880 3300006051 Bacteria 3674
171 Ga0075364_10065310 3300006051 Bacteria 2389
172 Ga0075362_10000275 3300006177 Bacteria 14383
173 Ga0075367_10041419 3300006178 Bacteria 2692
174 Ga0075367_10786670 3300006178 Bacteria 606
175 Ga0075369_10080396 3300006186 Bacteria 1445
176 Ga0075366_10027634 3300006195 Bacteria 3330
177 Ga0075366_10576022 3300006195 Bacteria 697
178 Ga0075366_10758504 3300006195 Bacteria 603
179 Ga0097621_101257447 3300006237 Unclassified 698
180 Ga0075370_10011459 3300006353 Bacteria 4659
181 Ga0068871_101441656 3300006358 Bacteria 650
182 Ga0075428_100001117 3300006844 Bacteria 28618
183 Ga0075428_102077004 3300006844 Unclassified 588
184 Ga0075428_102359250 3300006844 Unclassified 547
185 Ga0075430_100000389 3300006846 Bacteria 32344
186 Ga0075430_100014828 3300006846 Bacteria 6635
187 Ga0075430_100085794 3300006846 Bacteria 2636
188 Ga0075431_100081225 3300006847 Bacteria 3347
189 Ga0075431_101034204 3300006847 Unclassified 787
190 Ga0075431_101765151 3300006847 Unclassified 575
191 Ga0075433_10058999 3300006852 Bacteria 3357
192 Ga0075433_10107078 3300006852 Bacteria 2478
193 Ga0075433_11047499 3300006852 Unclassified 710
194 Ga0075434_100225240 3300006871 Bacteria 1895
195 Ga0075434_100348041 3300006871 Unclassified 1503
196 Ga0075434_100350766 3300006871 Unclassified 1497
197 Ga0075429_100042254 3300006880 Bacteria 3968
198 Ga0075429_100189919 3300006880 Bacteria 1800
199 Ga0068865_100078828 3300006881 Unclassified 2357
200 Ga0068865_100566400 3300006881 Bacteria 956
201 Ga0068865_102165388 3300006881 Bacteria 506
202 Ga0097620_100197612 3300006931 Bacteria 2095
203 Ga0097620_100579415 3300006931 Bacteria 1216
204 Ga0075435_100061994 3300007076 Bacteria 3034
205 Ga0075435_100106301 3300007076 Bacteria 2330
206 Ga0075435_100768841 3300007076 Unclassified 838
207 Ga0105240_10054621 3300009093 Bacteria 5005
208 Ga0105240_10160767 3300009093 Bacteria 2667
209 Ga0105240_10973045 3300009093 Bacteria 909
210 Ga0111539_10149987 3300009094 Bacteria 2729
211 Ga0111539_10303031 3300009094 Bacteria 1859
212 Ga0111539_10661917 3300009094 Bacteria 1216
213 Ga0111539_10883258 3300009094 Bacteria 1040
214 Ga0111539_10921726 3300009094 Unclassified 1016
215 Ga0111539_13341600 3300009094 Bacteria 516
216 Ga0105245_10116852 3300009098 Bacteria 2487
217 Ga0105245_10679220 3300009098 Bacteria 1062
218 Ga0105247_11868811 3300009101 Unclassified 502
219 Ga0114129_10004951 3300009147 Bacteria 18787
220 Ga0114129_10009181 3300009147 Bacteria 14099
221 Ga0114129_10016652 3300009147 Bacteria 10468
222 Ga0114129_10031269 3300009147 Bacteria 7528
223 Ga0114129_10442686 3300009147 Bacteria 1706
224 Ga0105243_10950588 3300009148 Bacteria 858
225 Ga0105243_11050038 3300009148 Bacteria 820
226 Ga0105243_12838209 3300009148 Bacteria 525
227 Ga0105241_10115262 3300009174 Bacteria 2157
228 Ga0105241_10538950 3300009174 Bacteria 1046
229 Ga0105242_10041930 3300009176 Bacteria 3694
230 Ga0105248_10540939 3300009177 Bacteria 1314
231 Ga0105248_11899561 3300009177 Unclassified 676
232 Ga0105249_10082422 3300009553 Bacteria 2993
233 Ga0105249_10166143 3300009553 Unclassified 2136
234 Ga0105249_10533732 3300009553 Bacteria 1222
235 Ga0105239_10656149 3300010375 Bacteria 1198
236 Ga0105239_11249322 3300010375 Bacteria 856
237 Ga0105246_10232917 3300011119 Bacteria 1451
238 Ga0105246_10682891 3300011119 Unclassified 898
239 Ga0157373_11586769 3300013100 Bacteria 501
240 Ga0157370_10125199 3300013104 Unclassified 2399
241 Ga0157370_10532769 3300013104 Bacteria 1077
242 Ga0157374_10800594 3300013296 Bacteria 958
243 Ga0157378_10147857 3300013297 Bacteria 2187
244 Ga0157378_10515107 3300013297 Bacteria 1197
245 Ga0163162_11096898 3300013306 Bacteria 902
246 Ga0157372_10125970 3300013307 Bacteria 2945
247 Ga0157372_12556340 3300013307 Bacteria 586
248 Ga0163163_10110865 3300014325 Bacteria 2772
249 Ga0163163_11844287 3300014325 Bacteria 665
250 Ga0157380_10463008 3300014326 Bacteria 1221
251 Ga0157380_11001439 3300014326 Bacteria 869
252 Ga0157380_11389569 3300014326 Bacteria 752
253 Ga0157380_13532985 3300014326 Unclassified 501
254 Ga0157377_10206641 3300014745 Bacteria 1250
255 Ga0157377_10981727 3300014745 Bacteria 638
256 Ga0157377_11094194 3300014745 Unclassified 610
257 Ga0157376_11127814 3300014969 Bacteria 811
258 Ga0157376_12048609 3300014969 Bacteria 610
259 Ga0157376_12964352 3300014969 Bacteria 514
260 Ga0163161_10461838 3300017792 Bacteria 1028
261 Ga0206356_10484810 3300020070 Bacteria 1689
262 Ga0206354_11093753 3300020081 Unclassified 1500
263 Ga0206353_10657662 3300020082 Unclassified 1580
264 Ga0207666_1064103 3300025271 Unclassified 589
265 Ga0207697_10005161 3300025315 Bacteria 6099
266 Ga0207697_10026349 3300025315 Bacteria 2377
267 Ga0207656_10054237 3300025321 Bacteria 1742
268 Ga0207653_10278187 3300025885 Bacteria 646
269 Ga0207682_10121357 3300025893 Bacteria 1159
270 Ga0207688_10752009 3300025901 Bacteria 617
271 Ga0207680_10153948 3300025903 Bacteria 1535
272 Ga0207680_11059146 3300025903 Unclassified 580
273 Ga0207699_10468382 3300025906 Bacteria 906
274 Ga0207645_10028691 3300025907 Bacteria 3591
275 Ga0207684_10235562 3300025910 Bacteria 1579
276 Ga0207654_10046114 3300025911 Bacteria 2484
277 Ga0207707_10194378 3300025912 Bacteria 1770
278 Ga0207707_10734064 3300025912 Bacteria 827
279 Ga0207695_10131299 3300025913 Bacteria 2462
280 Ga0207695_10311877 3300025913 Bacteria 1463
281 Ga0207693_10546457 3300025915 Bacteria 903
282 Ga0207662_10008329 3300025918 Bacteria 5676
283 Ga0207662_10708175 3300025918 Bacteria 706
284 Ga0207657_10925606 3300025919 Bacteria 671
285 Ga0207649_10735471 3300025920 Bacteria 767
286 Ga0207649_10779931 3300025920 Bacteria 745
287 Ga0207652_10113086 3300025921 Bacteria 2409
288 Ga0207652_10802255 3300025921 Unclassified 836
289 Ga0207681_10229525 3300025923 Bacteria 1440
290 Ga0207681_10426330 3300025923 Bacteria 1075
291 Ga0207681_10666883 3300025923 Bacteria 863
292 Ga0207650_10186735 3300025925 Bacteria 1654
293 Ga0207650_10209543 3300025925 Bacteria 1565
294 Ga0207650_10292888 3300025925 Bacteria 1327
295 Ga0207659_10249160 3300025926 Bacteria 1441
296 Ga0207659_10650379 3300025926 Bacteria 901
297 Ga0207659_11235591 3300025926 Bacteria 642
298 Ga0207687_11511954 3300025927 Bacteria 577
299 Ga0207700_10182363 3300025928 Bacteria 1759
300 Ga0207644_10486758 3300025931 Bacteria 1016
301 Ga0207644_11326771 3300025931 Bacteria 605
302 Ga0207644_11650578 3300025931 Bacteria 537
303 Ga0207706_11324391 3300025933 Bacteria 594
304 Ga0207686_10441521 3300025934 Bacteria 999
305 Ga0207709_10332010 3300025935 Bacteria 1141
306 Ga0207709_10411991 3300025935 Bacteria 1036
307 Ga0207709_11019304 3300025935 Unclassified 677
308 Ga0207669_10052420 3300025937 Bacteria 2451
309 Ga0207669_10063541 3300025937 Bacteria 2279
310 Ga0207669_10556517 3300025937 Bacteria 926
311 Ga0207669_10606434 3300025937 Bacteria 890
312 Ga0207669_10623731 3300025937 Bacteria 879
313 Ga0207669_11674851 3300025937 Unclassified 543
314 Ga0207704_10127298 3300025938 Bacteria 1756
315 Ga0207704_10346124 3300025938 Bacteria 1156
316 Ga0207665_11066870 3300025939 Unclassified 644
317 Ga0207691_10592268 3300025940 Bacteria 939
318 Ga0207691_10727706 3300025940 Unclassified 836
319 Ga0207689_10135018 3300025942 Bacteria 2031
320 Ga0207689_10289974 3300025942 Bacteria 1355
321 Ga0207661_10157410 3300025944 Bacteria 1969
322 Ga0207661_10307711 3300025944 Unclassified 1422
323 Ga0207661_10517218 3300025944 Unclassified 1091
324 Ga0207679_10023859 3300025945 Bacteria 4188
325 Ga0207679_10168344 3300025945 Bacteria 1801
326 Ga0207679_10641960 3300025945 Unclassified 960
327 Ga0207679_10773841 3300025945 Bacteria 874
328 Ga0207679_10824696 3300025945 Bacteria 846
329 Ga0207679_10953754 3300025945 Unclassified 786
330 Ga0207679_11390380 3300025945 Bacteria 644
331 Ga0207667_10527407 3300025949 Bacteria 1196
332 Ga0207667_11681539 3300025949 Bacteria 602
333 Ga0207651_10463863 3300025960 Bacteria 1089
334 Ga0207651_10578360 3300025960 Bacteria 979
335 Ga0207712_10072304 3300025961 Bacteria 2483
336 Ga0207712_10193995 3300025961 Bacteria 1605
337 Ga0207668_10283696 3300025972 Bacteria 1359
338 Ga0207668_10329008 3300025972 Bacteria 1271
339 Ga0207668_11192701 3300025972 Bacteria 684
340 Ga0207640_10297547 3300025981 Bacteria 1275
341 Ga0207640_10489438 3300025981 Unclassified 1022
342 Ga0207640_11122813 3300025981 Bacteria 696
343 Ga0207640_11988823 3300025981 Bacteria 526
344 Ga0207658_10224850 3300025986 Bacteria 1581
345 Ga0207703_10799650 3300026035 Bacteria 900
346 Ga0207639_10864015 3300026041 Bacteria 845
347 Ga0207639_11826570 3300026041 Unclassified 568
348 Ga0207678_10112354 3300026067 Bacteria 2324
349 Ga0207678_10171807 3300026067 Bacteria 1851
350 Ga0207678_10317379 3300026067 Bacteria 1340
351 Ga0207678_11582762 3300026067 Bacteria 577
352 Ga0207708_10143921 3300026075 Bacteria 1872
353 Ga0207708_10156385 3300026075 Bacteria 1798
354 Ga0207702_10411580 3300026078 Bacteria 1306
355 Ga0207702_11675593 3300026078 Bacteria 629
356 Ga0207641_10101389 3300026088 Bacteria 2537
357 Ga0207641_10307747 3300026088 Bacteria 1499
358 Ga0207648_10003828 3300026089 Bacteria 15712
359 Ga0207676_10249130 3300026095 Bacteria 1598
360 Ga0207676_10643073 3300026095 Bacteria 1023
361 Ga0207676_10698008 3300026095 Unclassified 983
362 Ga0207676_11691586 3300026095 Unclassified 631
363 Ga0207674_10812485 3300026116 Bacteria 902
364 Ga0207675_100041917 3300026118 Bacteria 4274
365 Ga0207675_100227853 3300026118 Unclassified 1797
366 Ga0207675_100882655 3300026118 Bacteria 910
367 Ga0207675_101559779 3300026118 Bacteria 681
368 Ga0207683_10030441 3300026121 Bacteria 4677
369 Ga0207683_10032065 3300026121 Bacteria 4563
370 Ga0207683_10063788 3300026121 Bacteria 3246
371 Ga0207683_10212252 3300026121 Unclassified 1762
372 Ga0207683_10325022 3300026121 Bacteria 1409
373 Ga0207683_12097577 3300026121 Bacteria 513
374 Ga0207698_10705401 3300026142 Bacteria 1004
375 Ga0207698_10900828 3300026142 Bacteria 892
376 Ga0209971_1047565 3300027682 Bacteria 1035
377 Ga0209971_1160311 3300027682 Bacteria 555
378 Ga0209813_10151650 3300027866 Bacteria 831
379 Ga0209813_10373867 3300027866 Bacteria 569
380 Ga0209974_10203419 3300027876 Unclassified 732
381 Ga0268266_10210741 3300028379 Bacteria 1782
382 Ga0268266_11555670 3300028379 Bacteria 637
383 Ga0268265_12061164 3300028380 Bacteria 578
384 Ga0268265_12149412 3300028380 Bacteria 565
385 Ga0268264_10239165 3300028381 Bacteria 1681
386 Ga0307408_100091180 3300031548 Bacteria 2301
387 Ga0307408_101300443 3300031548 Bacteria 681
388 Ga0307405_10324421 3300031731 Unclassified 1177
389 Ga0307413_10076186 3300031824 Bacteria 2131
390 Ga0307413_10837684 3300031824 Bacteria 776
391 Ga0307410_10466456 3300031852 Bacteria 1033
392 Ga0307406_10710084 3300031901 Bacteria 840
393 Ga0307407_10061154 3300031903 Bacteria 2200
394 Ga0307409_100294477 3300031995 Unclassified 1506
395 Ga0307409_102193849 3300031995 Bacteria 582
396 Ga0307416_100075529 3300032002 Bacteria 2820
397 Ga0307416_100110057 3300032002 Bacteria 2425
398 Ga0307416_100429053 3300032002 Bacteria 1368
399 Ga0307416_101706354 3300032002 Unclassified 734
400 Ga0307416_102999294 3300032002 Bacteria 565
401 Ga0307416_103496434 3300032002 Unclassified 526
402 Ga0307416_103822463 3300032002 Unclassified 504
403 Ga0307414_10620766 3300032004 Bacteria 972
404 Ga0307411_10062825 3300032005 Bacteria 2479
405 Ga0307411_10139172 3300032005 Bacteria 1787
406 Ga0307411_11669796 3300032005 Bacteria 589
407 Ga0307415_100042542 3300032126 Bacteria 3024
408 Ga0373959_0201443 3300034820 Bacteria 526
409 Ga0373926_0130201 3300035083 Bacteria 952
410 Ga0373940_0033417 3300035088 Bacteria 1383
411 Ga0373940_0152347 3300035088 Bacteria 737
412 Ga0373941_0217589 3300035115 Unclassified 733
413 Ga0373931_0137716 3300035691 Bacteria 1411
414 Ga0373935_0332170 3300035692 Bacteria 1081
415 Ga0373935_0338807 3300035692 Bacteria 1070
416 Ga0373947_0531892 3300035725 Unclassified 800
417 Ga0373925_0022874 3300037068 Bacteria 4561
418 Ga0439461_0011953 3300041410 Unclassified 1618
419 Ga0451800_0490329 3300041459 Unclassified 564
420 Ga0451849_0769402 3300041505 Unclassified 509
421 Ga0451853_3318460 3300041512 Unclassified 707
422 Ga0439431_0068563 3300041997 Bacteria 942
423 Ga0439431_0079152 3300041997 Bacteria 884
424 Ga0439433_0004260 3300041999 Bacteria 3075
425 Ga0439443_049955 3300042003 Unclassified 730
426 Ga0439448_0365313 3300042005 Unclassified 515
427 Ga0439449_0028879 3300042007 Unclassified 2067
428 Ga0439455_0145333 3300042012 Bacteria 673
429 Ga0439457_045037 3300042014 Bacteria 985
430 Ga0439462_0103192 3300042015 Unclassified 787
431 Ga0439446_0236144 3300042156 Unclassified 627
432 Ga0439435_0002642 3300042436 Bacteria 3601
433 Ga0439435_0041672 3300042436 Unclassified 1287
434 Ga0439464_0046434 3300042439 Unclassified 1248
435 Ga0439460_0009464 3300042461 Bacteria 2476
436 Ga0451577_0088293 3300042876 Bacteria 2766
437 Ga0466967_0501562 3300045976 Bacteria 1191
438 Ga0495603_0063701 3300046455 Bacteria 2175
439 Ga0495629_0160285 3300046459 Unclassified 1563
440 Ga0495594_0317362 3300046499 Bacteria 888
441 Ga0495656_0042470 3300046615 Bacteria 1904
442 Ga0495668_0495649 3300046616 Bacteria 673
443 Ga0495668_0497347 3300046616 Unclassified 672
444 Ga0495676_0758024 3300047321 Unclassified 626
445 Ga0496102_1042996 3300048905 Unclassified 738
446 Ga0496102_1054965 3300048905 Bacteria 733
447 Ga0496105_0116725 3300048908 Bacteria 2202
448 Ga0496105_0754055 3300048908 Unclassified 743
449 Ga0496106_0199608 3300048909 Bacteria 1592
450 Ga0496108_1536642 3300048911 Unclassified 553
451 Ga0496109_0089237 3300048912 Bacteria 2850
452 Ga0496110_0193677 3300048913 Bacteria 1846
453 Ga0496111_1114682 3300048914 Bacteria 562
454 Ga0496112_0086532 3300048915 Bacteria 3101
455 Ga0496113_0063143 3300048916 Bacteria 2799
456 Ga0496113_0927468 3300048916 Unclassified 688
457 Ga0496113_0968029 3300048916 Bacteria 671
458 Ga0501032_0349379 3300049569 Unclassified 953
459 Ga0501034_0441650 3300049571 Bacteria 1220
460 Ga0501036_0099263 3300049572 Bacteria 2462
461 Ga0501036_1063974 3300049572 Bacteria 661
462 Ga0501037_0217398 3300049573 Bacteria 1346
463 Ga0501037_0384654 3300049573 Unclassified 964
464 Ga0501037_0659588 3300049573 Unclassified 699
465 Ga0501038_0797581 3300049574 Bacteria 702
466 Ga0501038_1000045 3300049574 Unclassified 614
467 Ga0501039_0171483 3300049575 Bacteria 1706
468 Ga0501039_1179702 3300049575 Unclassified 592
469 Ga0501040_0798262 3300049576 Unclassified 683
470 Ga0501040_1013175 3300049576 Bacteria 602
471 Ga0501040_1184331 3300049576 Unclassified 554
472 Ga0501040_1359000 3300049576 Unclassified 516
473 Ga0501041_0036924 3300049577 Bacteria 2960
474 Ga0501041_0072979 3300049577 Bacteria 2109
475 Ga0501041_0429497 3300049577 Unclassified 838
476 Ga0501041_0983613 3300049577 Unclassified 543
477 Ga0501041_1075646 3300049577 Unclassified 518
478 Ga0501042_0955835 3300049578 Bacteria 624
479 Ga0501042_1008107 3300049578 Unclassified 607
480 Ga0501042_1290000 3300049578 Unclassified 532
481 Ga0501048_0032577 3300049582 Bacteria 3766
482 Ga0501048_0664571 3300049582 Bacteria 748
483 Ga0501067_0269900 3300049583 Bacteria 947
484 Ga0501068_0321974 3300049584 Bacteria 991
485 Ga0501069_0521311 3300049585 Unclassified 710
486 Ga0501070_1119624 3300049586 Unclassified 607
487 Ga0501070_1286632 3300049586 Unclassified 559
488 Ga0501071_0144914 3300049587 Bacteria 1770
489 Ga0501071_0531403 3300049587 Bacteria 903
490 Ga0501072_0027221 3300049588 Bacteria 4462
491 Ga0501072_0099665 3300049588 Bacteria 2309
492 Ga0501072_0213034 3300049588 Unclassified 1539
493 Ga0501072_0217835 3300049588 Unclassified 1521
494 Ga0501072_0842065 3300049588 Unclassified 717
495 Ga0501073_0508877 3300049589 Bacteria 832
496 Ga0501073_0974557 3300049589 Unclassified 583
497 Ga0501074_0012948 3300049590 Bacteria 6065
498 Ga0501074_0253223 3300049590 Bacteria 1252
499 Ga0501075_0011153 3300049591 Bacteria 6351
500 Ga0501075_0019626 3300049591 Bacteria 4906
501 Ga0501075_0067638 3300049591 Bacteria 2697
502 Ga0501075_0459697 3300049591 Bacteria 971
503 Ga0501076_0016835 3300049592 Bacteria 5549
504 Ga0501076_0132475 3300049592 Bacteria 2022
505 Ga0501076_0347802 3300049592 Unclassified 1217
506 Ga0501076_0965797 3300049592 Unclassified 702
507 Ga0501199_021405 3300049650 Bacteria 753
508 Ga0501217_194865 3300049661 Bacteria 628
509 Ga0501221_256813 3300049704 Bacteria 504
510 Ga0501079_0767311 3300049741 Bacteria 759
511 Ga0501079_0882919 3300049741 Unclassified 704
512 Ga0501080_0337148 3300049742 Unclassified 1363
513 Ga0501080_0564448 3300049742 Unclassified 1013
514 Ga0501081_0055831 3300049743 Unclassified 2729
515 Ga0501081_0272991 3300049743 Bacteria 1237
516 Ga0501081_0559076 3300049743 Bacteria 855
517 Ga0501083_0393407 3300049744 Unclassified 902
518 Ga0501035_0302975 3300049822 Bacteria 1346
519 Ga0501035_0666300 3300049822 Unclassified 842
520 Ga0501035_1562127 3300049822 Bacteria 502
521 Ga0501045_0075245 3300049824 Bacteria 2487
522 nmdc:mga03683_168755_c1 3300050489 Bacteria 994
523 nmdc:mga03n38_211453_c1 3300050490 Bacteria 1008
524 nmdc:mga00v17_23586_c1 3300050491 Bacteria 3560
525 nmdc:mga00v17_4706_c1 3300050491 Bacteria 7130
526 nmdc:mga00v17_56107_c1 3300050491 Bacteria 2407
527 nmdc:mga0yw44_23869_c1 3300050492 Bacteria 3452
528 nmdc:mga0yw44_25882_c1 3300050492 Bacteria 3344
529 nmdc:mga0yw44_393932_c1 3300050492 Bacteria 936
530 nmdc:mga0yw44_595001_c1 3300050492 Bacteria 751
531 nmdc:mga0k408_13290_c2 3300050493 Bacteria 3438
532 nmdc:mga0k408_149489_c1 3300050493 Bacteria 1391
533 nmdc:mga0k408_2218_c1 3300050493 Bacteria 10410
534 nmdc:mga0k408_8825_c1 3300050493 Bacteria 4877
535 nmdc:mga06z11_121844_c1 3300050494 Bacteria 1456
536 nmdc:mga06z11_791150_c1 3300050494 Bacteria 578
537 nmdc:mga06z11_83114_c1 3300050494 Bacteria 1723
538 nmdc:mga04h51_15100_c1 3300050495 Bacteria 2220
539 nmdc:mga04h51_173901_c1 3300050495 Bacteria 835
540 nmdc:mga04h51_315881_c1 3300050495 Bacteria 639
541 nmdc:mga04h51_471986_c1 3300050495 Bacteria 533
542 nmdc:mga07m45_11282_c1 3300050496 Bacteria 4691
543 nmdc:mga07m45_714127_c1 3300050496 Bacteria 576
544 nmdc:mga05p37_101584_c1 3300050507 Bacteria 3541
545 nmdc:mga05p37_213153_c1 3300050507 Bacteria 2334
546 nmdc:mga05p37_414433_c1 3300050507 Bacteria 1569
547 nmdc:mga05p37_78848_c1 3300050507 Bacteria 4056
548 nmdc:mga05p37_989_c1 3300050507 Bacteria 32388
549 nmdc:mga09592_35994_c1 3300050508 Bacteria 4146
550 nmdc:mga09592_466043_c1 3300050508 Unclassified 1089
551 nmdc:mga09592_581124_c1 3300050508 Bacteria 961
552 nmdc:mga0qj67_1123957_c1 3300050509 Unclassified 613
553 nmdc:mga0qj67_5062_c1 3300050509 Bacteria 9589
554 nmdc:mga0qj67_80525_c1 3300050509 Bacteria 2609
555 nmdc:mga06r32_330986_c1 3300050510 Bacteria 1508
556 nmdc:mga06r32_782586_c1 3300050510 Bacteria 916
557 nmdc:mga08y16_1576345_c1 3300050511 Bacteria 615
558 nmdc:mga08y16_852663_c1 3300050511 Bacteria 900
559 nmdc:mga08y16_89946_c1 3300050511 Bacteria 3199
560 nmdc:mga0n895_120068_c1 3300050512 Bacteria 2650
561 nmdc:mga0n895_146372_c1 3300050512 Bacteria 2392
562 nmdc:mga0n895_66665_c1 3300050512 Bacteria 3564
563 nmdc:mga0rr50_51964_c1 3300050513 Bacteria 3043
564 nmdc:mga0rr50_645849_c1 3300050513 Unclassified 903
565 nmdc:mga0rr50_73525_c1 3300050513 Bacteria 2614
566 nmdc:mga0a205_158265_c1 3300050515 Unclassified 2163
567 nmdc:mga0a205_18706_c1 3300050515 Bacteria 6519
568 nmdc:mga0a205_407429_c1 3300050515 Unclassified 1223
569 nmdc:mga0a205_7723_c1 3300050515 Bacteria 9762
570 nmdc:mga0a205_79527_c1 3300050515 Bacteria 3168
571 nmdc:mga0sz30_43087_c1 3300050516 Bacteria 1899
572 Ga0500628_008338 3300053129 Bacteria 1799
573 Ga0500658_0529156 3300053134 Bacteria 532
574 Ga0501084_0037404 3300054114 Bacteria 4055
575 Ga0501084_0043466 3300054114 Bacteria 3759
576 Ga0501084_0064504 3300054114 Bacteria 3065
577 Ga0501084_0542982 3300054114 Bacteria 982
578 Ga0501084_0617481 3300054114 Bacteria 916
579 Ga0501084_1737789 3300054114 Bacteria 521
580 Ga0590071_146233 3300059421 Unclassified 611
581 Ga0590071_203341 3300059421 Unclassified 521
582 Ga0590074_019861 3300059423 Bacteria 1154
583 Ga0590075_005385 3300059424 Bacteria 3020
584 Ga0590077_009043 3300059426 Bacteria 2039
585 Ga0590077_113327 3300059426 Bacteria 638
586 Ga0587111_0158058 3300060346 Bacteria 614
587 Ga0501082_0224122 3300060353 Bacteria 1636
588 Ga0501082_0230329 3300060353 Bacteria 1612
589 Ga0501082_0414585 3300060353 Unclassified 1176
590 Ga0501082_0893366 3300060353 Unclassified 777
591 Ga0530510_0014638 3300061734 Bacteria 5537
592 Ga0530510_0139146 3300061734 Bacteria 1788
593 Ga0530510_0325383 3300061734 Unclassified 1153
594 Ga0530510_0901575 3300061734 Bacteria 676
595 Ga0451793_0893502
596 JGI24743J22301_10037859
597 JGI24744J21845_10016645
598 JGI24035J26624_1009520
599 JGI24751J29686_10010960
600 Ga0065712_10020126
601 Ga0065712_10080658
602 Ga0065712_10098612
603 Ga0065712_10248884
604 Ga0065712_10267040
605 Ga0065712_10361550
606 Ga0065712_10725849
607 Ga0065715_10106023
608 Ga0065715_10134975
609 Ga0065715_10158008
610 Ga0065715_10178053
611 Ga0065715_10242354
612 Ga0065715_10472038
613 Ga0065707_10001684
614 Ga0065707_10254657
615 Ga0065707_10575415
616 Ga0070658_11005788
617 Ga0070676_10036819
618 Ga0070676_10942181
619 Ga0070676_11128984
620 Ga0070683_100560642
621 Ga0070683_101185938
622 Ga0070690_100115552
623 Ga0070690_100982960
624 Ga0070670_100065178
625 Ga0070670_100314323
626 Ga0070670_100635493
627 Ga0070677_10712638
628 Ga0068869_100117276
629 Ga0068869_101909981
630 Ga0070666_10210812
631 Ga0070666_10271988
632 Ga0070682_100792734
633 Ga0070682_101389206
634 Ga0068868_100150625
635 Ga0068868_100788013
636 Ga0068868_101438096
637 Ga0070660_100458828
638 Ga0070660_100465130
639 Ga0070660_100747810
640 Ga0070660_101755486
641 Ga0070689_100704133
642 Ga0070691_10448709
643 Ga0070691_10557832
644 Ga0070687_100303625
645 Ga0070661_100500328
646 Ga0070661_101426092
647 Ga0070668_101455142
648 Ga0070669_100055499
649 Ga0070669_100059857
650 Ga0070669_100243027
651 Ga0070669_100768694
652 Ga0070675_100291185
653 Ga0070675_100359203
654 Ga0070675_100563792
655 Ga0070675_101960979
656 Ga0070671_100170366
657 Ga0070671_102128494
658 Ga0070674_100037637
659 Ga0070674_100054476
660 Ga0070674_100226196
661 Ga0070674_100276634
662 Ga0070674_100421942
663 Ga0070674_100444128
664 Ga0070674_100915187
665 Ga0070674_101448401
666 Ga0070674_101472635
667 Ga0070674_101850295
668 Ga0070673_100076241
669 Ga0070673_100205774
670 Ga0070673_100896744
671 Ga0070673_101558160
672 Ga0070673_101954111
673 Ga0070688_100490715
674 Ga0070659_100080007
675 Ga0070659_100477445
676 Ga0070667_100241737
677 Ga0070667_102077605
678 Ga0070703_10546323
679 Ga0070709_11376453
680 Ga0070713_100270524
681 Ga0070713_101897892
682 Ga0070701_10041767
683 Ga0070701_10534476
684 Ga0070705_100117382
685 Ga0070700_100039193
686 Ga0070700_100088938
687 Ga0070694_100731733
688 Ga0070694_101537863
689 Ga0070708_102127896
690 Ga0070663_100135363
691 Ga0070663_100501673
692 Ga0070663_100958181
693 Ga0070678_100119932
694 Ga0070678_100132463
695 Ga0070678_100132619
696 Ga0070678_101253444
697 Ga0070662_100100214
698 Ga0070662_100709971
699 Ga0070662_100967774
700 Ga0070662_101613455
701 Ga0070681_10178803
702 Ga0070681_10878796
703 Ga0070681_11283366
704 Ga0068867_101705242
705 Ga0070685_10135140
706 Ga0070685_11541212
707 Ga0070706_100054324
708 Ga0070699_100185532
709 Ga0070699_100285516
710 Ga0070679_100088377
711 Ga0070679_100296772
712 Ga0070679_100427377
713 Ga0070684_100102554
714 Ga0068853_100433001
715 Ga0068853_100820444
716 Ga0070672_100607368
717 Ga0070686_100827181
718 Ga0070695_100154900
719 Ga0070695_101156637
720 Ga0070696_100544500
721 Ga0070696_100927000
722 Ga0070665_100334922
723 Ga0070665_101142955
724 Ga0070665_102627461
725 Ga0070704_100057880
726 Ga0070704_100443842
727 Ga0070704_100755988
728 Ga0070704_101915567
729 Ga0068855_100595393
730 Ga0068855_102412729
731 Ga0070664_100038031
732 Ga0070664_100151858
733 Ga0070664_100343716
734 Ga0070664_100681635
735 Ga0068854_100433118
736 Ga0068854_100571719
737 Ga0068854_100647914
738 Ga0068854_100877858
739 Ga0068856_100846174
740 Ga0068856_102146666
741 Ga0070702_100086441
742 Ga0068852_100261961
743 Ga0068852_101081002
744 Ga0068852_102086563
745 Ga0068859_100197614
746 Ga0068859_100579374
747 Ga0068864_100065315
748 Ga0068864_100276946
749 Ga0068864_100422108
750 Ga0068864_100833456
751 Ga0068864_101589369
752 Ga0068861_100483854
753 Ga0068861_102354322
754 Ga0068851_11009503
755 Ga0068863_100495509
756 Ga0068863_102081353
757 Ga0068858_100076487
758 Ga0068860_100069982
759 Ga0068860_101154271
760 Ga0068862_101592830
761 Ga0075365_10275318
762 Ga0075368_10103693
763 Ga0075363_100029356
764 Ga0075364_10026880
765 Ga0075364_10065310
766 Ga0075362_10000275
767 Ga0075367_10041419
768 Ga0075367_10786670
769 Ga0075369_10080396
770 Ga0075366_10027634
771 Ga0075366_10576022
772 Ga0075366_10758504
773 Ga0097621_101257447
774 Ga0075370_10011459
775 Ga0068871_101441656
776 Ga0075428_100001117
777 Ga0075428_102077004
778 Ga0075428_102359250
779 Ga0075430_100000389
780 Ga0075430_100014828
781 Ga0075430_100085794
782 Ga0075431_100081225
783 Ga0075431_101034204
784 Ga0075431_101765151
785 Ga0075433_10058999
786 Ga0075433_10107078
787 Ga0075433_11047499
788 Ga0075434_100225240
789 Ga0075434_100348041
790 Ga0075434_100350766
791 Ga0075429_100042254
792 Ga0075429_100189919
793 Ga0068865_100078828
794 Ga0068865_100566400
795 Ga0068865_102165388
796 Ga0097620_100197612
797 Ga0097620_100579415
798 Ga0075435_100061994
799 Ga0075435_100106301
800 Ga0075435_100768841
801 Ga0105240_10054621
802 Ga0105240_10160767
803 Ga0105240_10973045
804 Ga0111539_10149987
805 Ga0111539_10303031
806 Ga0111539_10661917
807 Ga0111539_10883258
808 Ga0111539_10921726
809 Ga0111539_13341600
810 Ga0105245_10116852
811 Ga0105245_10679220
812 Ga0105247_11868811
813 Ga0114129_10004951
814 Ga0114129_10009181
815 Ga0114129_10016652
816 Ga0114129_10031269
817 Ga0114129_10442686
818 Ga0105243_10950588
819 Ga0105243_11050038
820 Ga0105243_12838209
821 Ga0105241_10115262
822 Ga0105241_10538950
823 Ga0105242_10041930
824 Ga0105248_10540939
825 Ga0105248_11899561
826 Ga0105249_10082422
827 Ga0105249_10166143
828 Ga0105249_10533732
829 Ga0105239_10656149
830 Ga0105239_11249322
831 Ga0105246_10232917
832 Ga0105246_10682891
833 Ga0157373_11586769
834 Ga0157370_10125199
835 Ga0157370_10532769
836 Ga0157374_10800594
837 Ga0157378_10147857
838 Ga0157378_10515107
839 Ga0163162_11096898
840 Ga0157372_10125970
841 Ga0157372_12556340
842 Ga0163163_10110865
843 Ga0163163_11844287
844 Ga0157380_10463008
845 Ga0157380_11001439
846 Ga0157380_11389569
847 Ga0157380_13532985
848 Ga0157377_10206641
849 Ga0157377_10981727
850 Ga0157377_11094194
851 Ga0157376_11127814
852 Ga0157376_12048609
853 Ga0157376_12964352
854 Ga0163161_10461838
855 Ga0206356_10484810
856 Ga0206354_11093753
857 Ga0206353_10657662
858 Ga0207666_1064103
859 Ga0207697_10005161
860 Ga0207697_10026349
861 Ga0207656_10054237
862 Ga0207653_10278187
863 Ga0207682_10121357
864 Ga0207688_10752009
865 Ga0207680_10153948
866 Ga0207680_11059146
867 Ga0207699_10468382
868 Ga0207645_10028691
869 Ga0207684_10235562
870 Ga0207654_10046114
871 Ga0207707_10194378
872 Ga0207707_10734064
873 Ga0207695_10131299
874 Ga0207695_10311877
875 Ga0207693_10546457
876 Ga0207662_10008329
877 Ga0207662_10708175
878 Ga0207657_10925606
879 Ga0207649_10735471
880 Ga0207649_10779931
881 Ga0207652_10113086
882 Ga0207652_10802255
883 Ga0207681_10229525
884 Ga0207681_10426330
885 Ga0207681_10666883
886 Ga0207650_10186735
887 Ga0207650_10209543
888 Ga0207650_10292888
889 Ga0207659_10249160
890 Ga0207659_10650379
891 Ga0207659_11235591
892 Ga0207687_11511954
893 Ga0207700_10182363
894 Ga0207644_10486758
895 Ga0207644_11326771
896 Ga0207644_11650578
897 Ga0207706_11324391
898 Ga0207686_10441521
899 Ga0207709_10332010
900 Ga0207709_10411991
901 Ga0207709_11019304
902 Ga0207669_10052420
903 Ga0207669_10063541
904 Ga0207669_10556517
905 Ga0207669_10606434
906 Ga0207669_10623731
907 Ga0207669_11674851
908 Ga0207704_10127298
909 Ga0207704_10346124
910 Ga0207665_11066870
911 Ga0207691_10592268
912 Ga0207691_10727706
913 Ga0207689_10135018
914 Ga0207689_10289974
915 Ga0207661_10157410
916 Ga0207661_10307711
917 Ga0207661_10517218
918 Ga0207679_10023859
919 Ga0207679_10168344
920 Ga0207679_10641960
921 Ga0207679_10773841
922 Ga0207679_10824696
923 Ga0207679_10953754
924 Ga0207679_11390380
925 Ga0207667_10527407
926 Ga0207667_11681539
927 Ga0207651_10463863
928 Ga0207651_10578360
929 Ga0207712_10072304
930 Ga0207712_10193995
931 Ga0207668_10283696
932 Ga0207668_10329008
933 Ga0207668_11192701
934 Ga0207640_10297547
935 Ga0207640_10489438
936 Ga0207640_11122813
937 Ga0207640_11988823
938 Ga0207658_10224850
939 Ga0207703_10799650
940 Ga0207639_10864015
941 Ga0207639_11826570
942 Ga0207678_10112354
943 Ga0207678_10171807
944 Ga0207678_10317379
945 Ga0207678_11582762
946 Ga0207708_10143921
947 Ga0207708_10156385
948 Ga0207702_10411580
949 Ga0207702_11675593
950 Ga0207641_10101389
951 Ga0207641_10307747
952 Ga0207648_10003828
953 Ga0207676_10249130
954 Ga0207676_10643073
955 Ga0207676_10698008
956 Ga0207676_11691586
957 Ga0207674_10812485
958 Ga0207675_100041917
959 Ga0207675_100227853
960 Ga0207675_100882655
961 Ga0207675_101559779
962 Ga0207683_10030441
963 Ga0207683_10032065
964 Ga0207683_10063788
965 Ga0207683_10212252
966 Ga0207683_10325022
967 Ga0207683_12097577
968 Ga0207698_10705401
969 Ga0207698_10900828
970 Ga0209971_1047565
971 Ga0209971_1160311
972 Ga0209813_10151650
973 Ga0209813_10373867
974 Ga0209974_10203419
975 Ga0268266_10210741
976 Ga0268266_11555670
977 Ga0268265_12061164
978 Ga0268265_12149412
979 Ga0268264_10239165
980 Ga0307408_100091180
981 Ga0307408_101300443
982 Ga0307405_10324421
983 Ga0307413_10076186
984 Ga0307413_10837684
985 Ga0307410_10466456
986 Ga0307406_10710084
987 Ga0307407_10061154
988 Ga0307409_100294477
989 Ga0307409_102193849
990 Ga0307416_100075529
991 Ga0307416_100110057
992 Ga0307416_100429053
993 Ga0307416_101706354
994 Ga0307416_102999294
995 Ga0307416_103496434
996 Ga0307416_103822463
997 Ga0307414_10620766
998 Ga0307411_10062825
999 Ga0307411_10139172
1000 Ga0307411_11669796
1001 Ga0307415_100042542
1002 Ga0373959_0201443
1003 Ga0373926_0130201
1004 Ga0373940_0033417
1005 Ga0373940_0152347
1006 Ga0373941_0217589
1007 Ga0373931_0137716
1008 Ga0373935_0332170
1009 Ga0373935_0338807
1010 Ga0373947_0531892
1011 Ga0373925_0022874
1012 Ga0439461_0011953
1013 Ga0451800_0490329
1014 Ga0451849_0769402
1015 Ga0451853_3318460
1016 Ga0439431_0068563
1017 Ga0439431_0079152
1018 Ga0439433_0004260
1019 Ga0439443_049955
1020 Ga0439448_0365313
1021 Ga0439449_0028879
1022 Ga0439455_0145333
1023 Ga0439457_045037
1024 Ga0439462_0103192
1025 Ga0439446_0236144
1026 Ga0439435_0002642
1027 Ga0439435_0041672
1028 Ga0439464_0046434
1029 Ga0439460_0009464
1030 Ga0451577_0088293
1031 Ga0466967_0501562
1032 Ga0495603_0063701
1033 Ga0495629_0160285
1034 Ga0495594_0317362
1035 Ga0495656_0042470
1036 Ga0495668_0495649
1037 Ga0495668_0497347
1038 Ga0495676_0758024
1039 Ga0496102_1042996
1040 Ga0496102_1054965
1041 Ga0496105_0116725
1042 Ga0496105_0754055
1043 Ga0496106_0199608
1044 Ga0496108_1536642
1045 Ga0496109_0089237
1046 Ga0496110_0193677
1047 Ga0496111_1114682
1048 Ga0496112_0086532
1049 Ga0496113_0063143
1050 Ga0496113_0927468
1051 Ga0496113_0968029
1052 Ga0501032_0349379
1053 Ga0501034_0441650
1054 Ga0501036_0099263
1055 Ga0501036_1063974
1056 Ga0501037_0217398
1057 Ga0501037_0384654
1058 Ga0501037_0659588
1059 Ga0501038_0797581
1060 Ga0501038_1000045
1061 Ga0501039_0171483
1062 Ga0501039_1179702
1063 Ga0501040_0798262
1064 Ga0501040_1013175
1065 Ga0501040_1184331
1066 Ga0501040_1359000
1067 Ga0501041_0036924
1068 Ga0501041_0072979
1069 Ga0501041_0429497
1070 Ga0501041_0983613
1071 Ga0501041_1075646
1072 Ga0501042_0955835
1073 Ga0501042_1008107
1074 Ga0501042_1290000
1075 Ga0501048_0032577
1076 Ga0501048_0664571
1077 Ga0501067_0269900
1078 Ga0501068_0321974
1079 Ga0501069_0521311
1080 Ga0501070_1119624
1081 Ga0501070_1286632
1082 Ga0501071_0144914
1083 Ga0501071_0531403
1084 Ga0501072_0027221
1085 Ga0501072_0099665
1086 Ga0501072_0213034
1087 Ga0501072_0217835
1088 Ga0501072_0842065
1089 Ga0501073_0508877
1090 Ga0501073_0974557
1091 Ga0501074_0012948
1092 Ga0501074_0253223
1093 Ga0501075_0011153
1094 Ga0501075_0019626
1095 Ga0501075_0067638
1096 Ga0501075_0459697
1097 Ga0501076_0016835
1098 Ga0501076_0132475
1099 Ga0501076_0347802
1100 Ga0501076_0965797
1101 Ga0501199_021405
1102 Ga0501217_194865
1103 Ga0501221_256813
1104 Ga0501079_0767311
1105 Ga0501079_0882919
1106 Ga0501080_0337148
1107 Ga0501080_0564448
1108 Ga0501081_0055831
1109 Ga0501081_0272991
1110 Ga0501081_0559076
1111 Ga0501083_0393407
1112 Ga0501035_0302975
1113 Ga0501035_0666300
1114 Ga0501035_1562127
1115 Ga0501045_0075245
1116 nmdc:mga03683_168755_c1
1117 nmdc:mga03n38_211453_c1
1118 nmdc:mga00v17_23586_c1
1119 nmdc:mga00v17_4706_c1
1120 nmdc:mga00v17_56107_c1
1121 nmdc:mga0yw44_23869_c1
1122 nmdc:mga0yw44_25882_c1
1123 nmdc:mga0yw44_393932_c1
1124 nmdc:mga0yw44_595001_c1
1125 nmdc:mga0k408_13290_c2
1126 nmdc:mga0k408_149489_c1
1127 nmdc:mga0k408_2218_c1
1128 nmdc:mga0k408_8825_c1
1129 nmdc:mga06z11_121844_c1
1130 nmdc:mga06z11_791150_c1
1131 nmdc:mga06z11_83114_c1
1132 nmdc:mga04h51_15100_c1
1133 nmdc:mga04h51_173901_c1
1134 nmdc:mga04h51_315881_c1
1135 nmdc:mga04h51_471986_c1
1136 nmdc:mga07m45_11282_c1
1137 nmdc:mga07m45_714127_c1
1138 nmdc:mga05p37_101584_c1
1139 nmdc:mga05p37_213153_c1
1140 nmdc:mga05p37_414433_c1
1141 nmdc:mga05p37_78848_c1
1142 nmdc:mga05p37_989_c1
1143 nmdc:mga09592_35994_c1
1144 nmdc:mga09592_466043_c1
1145 nmdc:mga09592_581124_c1
1146 nmdc:mga0qj67_1123957_c1
1147 nmdc:mga0qj67_5062_c1
1148 nmdc:mga0qj67_80525_c1
1149 nmdc:mga06r32_330986_c1
1150 nmdc:mga06r32_782586_c1
1151 nmdc:mga08y16_1576345_c1
1152 nmdc:mga08y16_852663_c1
1153 nmdc:mga08y16_89946_c1
1154 nmdc:mga0n895_120068_c1
1155 nmdc:mga0n895_146372_c1
1156 nmdc:mga0n895_66665_c1
1157 nmdc:mga0rr50_51964_c1
1158 nmdc:mga0rr50_645849_c1
1159 nmdc:mga0rr50_73525_c1
1160 nmdc:mga0a205_158265_c1
1161 nmdc:mga0a205_18706_c1
1162 nmdc:mga0a205_407429_c1
1163 nmdc:mga0a205_7723_c1
1164 nmdc:mga0a205_79527_c1
1165 nmdc:mga0sz30_43087_c1
1166 Ga0500628_008338
1167 Ga0500658_0529156
1168 Ga0501084_0037404
1169 Ga0501084_0043466
1170 Ga0501084_0064504
1171 Ga0501084_0542982
1172 Ga0501084_0617481
1173 Ga0501084_1737789
1174 Ga0590071_146233
1175 Ga0590071_203341
1176 Ga0590074_019861
1177 Ga0590075_005385
1178 Ga0590077_009043
1179 Ga0590077_113327
1180 Ga0587111_0158058
1181 Ga0501082_0224122
1182 Ga0501082_0230329
1183 Ga0501082_0414585
1184 Ga0501082_0893366
1185 Ga0530510_0014638
1186 Ga0530510_0139146
1187 Ga0530510_0325383
1188 Ga0530510_0901575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mft-assembly1.cif.gz_A crystal structure of four-helix bundle model 0.946 14 62
6cfw-assembly1.cif.gz_D cryoem structure of a respiratory membrane-bound hydrogenase 0.9455 15 59
6z16-assembly1.cif.gz_f structure of the mrp antiporter complex 0.9421 15 65
7s5k-assembly1.cif.gz_B m. xanthus ferritin-like protein encb 0.9394 15 62
8ap6-assembly1.cif.gz_H1 trypanosoma brucei mitochondrial f1fo atp synthase dimer 0.9393 20 61
ID Description Score Start End Superfamily
af_P23839_203_287_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9722 15 60 1.20.58.220
af_Q57950_59_179_2.60.120.1040 Mainly Beta;Sandwich;Jelly Rolls;ZPR1, A/B domain 0.9702 20 56 2.60.120.1040
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9641 18 61 1.20.5.1930
af_O94265_285_498_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9512 19 65 1.20.910.10
4fxdB06 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.9506 15 58 1.10.287.690
ID Description Score Start End GO Terms
AF-A0A7Y4SMB9-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 1 11 70
AF-A0A2V8EL66-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.9962 10 69
AF-A0A1F2TXH4-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.9838 11 69
AF-W0A4R9-F1-model_v4 Uncharacterized protein 0.9569 12 68
AF-A0A3Q0NFD1-F1-model_v4 Uncharacterized protein 0.9566 11 71 GO:0016020

Map