F467319

General Info

Members Datasets Scaffolds Average Seq Length
594 259 1188 245

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100105009|Ga0075428_1001050092
Length 285
Sequence MAAEQGPPPRDPASSPPRPAKTRLDRLVVERGLAPSRERAQALILAGRVIVDGRPAGKPGGTVPGDAAIALLAPDHPFVGRGGLKLEGALTRLGVDPHGLVALDVGASTGGFTDCLLKRGARRVYALDVGTGQLDWSLRRDPRVVTMEGRNARHLRPEDLPEPVDLAVVDVSFISLALVLPPLRPLVKTGGTVLALVKPQFEVGRRDVGKGGIVRDPALHRGAVASVARSAAAAGYALLGGCRSPLPGAEGNVEFFLLLGPGPRAGAAGDAEALARSIVDEERGA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
175 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
176 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
177 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
178 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
179 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
180 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
181 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
182 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 1.18
Rhizosphere 92.93
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100105009 3300006844 Bacteria 3081
2 Ga0065704_10011361 3300005289 Bacteria 2816
3 Ga0065712_10069978 3300005290 Bacteria 6446
4 Ga0065712_10132884 3300005290 Bacteria 1529
5 Ga0065707_10012468 3300005295 Bacteria 1997
6 Ga0065707_10093698 3300005295 Bacteria 3591
7 Ga0070658_10126365 3300005327 Bacteria 2129
8 Ga0070658_10129742 3300005327 Bacteria 2100
9 Ga0070676_10032547 3300005328 Bacteria 2988
10 Ga0070676_10133568 3300005328 Bacteria 1572
11 Ga0070683_100010292 3300005329 Bacteria 8042
12 Ga0070690_100057026 3300005330 Bacteria 2506
13 Ga0070670_100041556 3300005331 Bacteria 3952
14 Ga0070670_100355967 3300005331 Bacteria 1286
15 Ga0070677_10019341 3300005333 Bacteria 2466
16 Ga0068869_100005463 3300005334 Bacteria 7997
17 Ga0068869_100037831 3300005334 Bacteria 3433
18 Ga0070666_10297468 3300005335 Bacteria 1149
19 Ga0068868_100070609 3300005338 Bacteria 2784
20 Ga0070689_100205075 3300005340 Bacteria 1611
21 Ga0070661_100214631 3300005344 Bacteria 1474
22 Ga0070692_10008324 3300005345 Bacteria 4623
23 Ga0070692_10060574 3300005345 Bacteria 1993
24 Ga0070668_100161619 3300005347 Bacteria 1818
25 Ga0070669_100002727 3300005353 Bacteria 12739
26 Ga0070675_100000537 3300005354 Bacteria 25951
27 Ga0070675_100003145 3300005354 Bacteria 12491
28 Ga0070675_100005031 3300005354 Bacteria 10091
29 Ga0070675_100013258 3300005354 Bacteria 6477
30 Ga0070675_100025213 3300005354 Bacteria 4767
31 Ga0070675_100031657 3300005354 Bacteria 4278
32 Ga0070675_100172017 3300005354 Bacteria 1868
33 Ga0070675_100318057 3300005354 Bacteria 1375
34 Ga0070671_100011390 3300005355 Bacteria 7149
35 Ga0070671_100071095 3300005355 Bacteria 2904
36 Ga0070671_100374825 3300005355 Bacteria 1216
37 Ga0070671_100444264 3300005355 Bacteria 1112
38 Ga0070674_100166798 3300005356 Bacteria 1676
39 Ga0070673_100006495 3300005364 Bacteria 7604
40 Ga0070673_100063489 3300005364 Bacteria 2939
41 Ga0070673_100064952 3300005364 Bacteria 2909
42 Ga0070673_100120743 3300005364 Bacteria 2186
43 Ga0070673_100163624 3300005364 Bacteria 1894
44 Ga0070673_100188075 3300005364 Bacteria 1772
45 Ga0070673_100213383 3300005364 Bacteria 1668
46 Ga0070688_100009604 3300005365 Bacteria 5301
47 Ga0070688_100045784 3300005365 Bacteria 2705
48 Ga0070688_100195494 3300005365 Bacteria 1412
49 Ga0070659_100239435 3300005366 Bacteria 1501
50 Ga0070713_100019968 3300005436 Bacteria 5128
51 Ga0070701_10004199 3300005438 Bacteria 5801
52 Ga0070701_10116811 3300005438 Bacteria 1498
53 Ga0070705_100001006 3300005440 Bacteria 15697
54 Ga0070705_100048356 3300005440 Bacteria 2463
55 Ga0070705_100121135 3300005440 Bacteria 1689
56 Ga0070700_100018136 3300005441 Bacteria 4041
57 Ga0070700_100019280 3300005441 Bacteria 3934
58 Ga0070700_100199496 3300005441 Bacteria 1405
59 Ga0070700_100246177 3300005441 Bacteria 1280
60 Ga0070700_100297835 3300005441 Bacteria 1176
61 Ga0070694_100001224 3300005444 Bacteria 14823
62 Ga0070694_100012256 3300005444 Bacteria 5326
63 Ga0070694_100166157 3300005444 Bacteria 1622
64 Ga0070694_100246467 3300005444 Bacteria 1350
65 Ga0070694_100286770 3300005444 Bacteria 1257
66 Ga0070694_100336625 3300005444 Bacteria 1165
67 Ga0070708_100475433 3300005445 Bacteria 1179
68 Ga0070663_100334795 3300005455 Bacteria 1221
69 Ga0070678_100022786 3300005456 Bacteria 4159
70 Ga0070678_100061573 3300005456 Bacteria 2767
71 Ga0070678_100117243 3300005456 Bacteria 2093
72 Ga0070678_100595112 3300005456 Bacteria 987
73 Ga0070662_100128894 3300005457 Bacteria 1948
74 Ga0070662_100153784 3300005457 Bacteria 1794
75 Ga0070662_100256708 3300005457 Bacteria 1407
76 Ga0070681_10025905 3300005458 Bacteria 5896
77 Ga0068867_100000147 3300005459 Bacteria 45184
78 Ga0068867_100003422 3300005459 Bacteria 11159
79 Ga0068867_100069525 3300005459 Bacteria 2630
80 Ga0070685_10073945 3300005466 Bacteria 2027
81 Ga0070706_100075147 3300005467 Bacteria 3127
82 Ga0070706_100190179 3300005467 Bacteria 1918
83 Ga0070707_100058411 3300005468 Bacteria 3699
84 Ga0070707_100428525 3300005468 Bacteria 1283
85 Ga0070707_100657118 3300005468 Bacteria 1011
86 Ga0070698_100010865 3300005471 Bacteria 9687
87 Ga0070698_100366801 3300005471 Bacteria 1372
88 Ga0070698_100537966 3300005471 Bacteria 1107
89 Ga0070699_100012945 3300005518 Bacteria 7190
90 Ga0070699_100033837 3300005518 Bacteria 4416
91 Ga0070699_100103320 3300005518 Bacteria 2499
92 Ga0070699_100160392 3300005518 Bacteria 1990
93 Ga0070699_100264340 3300005518 Bacteria 1539
94 Ga0070684_100015033 3300005535 Bacteria 6289
95 Ga0070684_100042317 3300005535 Bacteria 3932
96 Ga0070697_100048336 3300005536 Bacteria 3449
97 Ga0070697_100114919 3300005536 Bacteria 2247
98 Ga0068853_100756125 3300005539 Bacteria 929
99 Ga0070672_100003678 3300005543 Bacteria 9967
100 Ga0070672_100048688 3300005543 Bacteria 3295
101 Ga0070686_100056978 3300005544 Bacteria 2509
102 Ga0070695_100000425 3300005545 Bacteria 21837
103 Ga0070695_100045159 3300005545 Bacteria 2807
104 Ga0070695_100613726 3300005545 Bacteria 855
105 Ga0070696_100004775 3300005546 Bacteria 9057
106 Ga0070696_100021370 3300005546 Bacteria 4387
107 Ga0070696_100025156 3300005546 Bacteria 4046
108 Ga0070696_100034889 3300005546 Bacteria 3463
109 Ga0070696_100220573 3300005546 Bacteria 1423
110 Ga0070693_100160589 3300005547 Bacteria 1431
111 Ga0070665_100049461 3300005548 Bacteria 4217
112 Ga0070704_100007021 3300005549 Bacteria 6680
113 Ga0070704_100007503 3300005549 Bacteria 6493
114 Ga0070704_100143245 3300005549 Bacteria 1869
115 Ga0070704_100173123 3300005549 Bacteria 1719
116 Ga0070704_100645057 3300005549 Bacteria 934
117 Ga0070664_100010031 3300005564 Bacteria 7676
118 Ga0070664_100048511 3300005564 Bacteria 3589
119 Ga0070664_100227644 3300005564 Bacteria 1670
120 Ga0070702_100046537 3300005615 Bacteria 2459
121 Ga0070702_100124668 3300005615 Bacteria 1618
122 Ga0068859_100022329 3300005617 Bacteria 6345
123 Ga0068859_100084626 3300005617 Bacteria 3216
124 Ga0068859_100181943 3300005617 Bacteria 2185
125 Ga0068864_100039639 3300005618 Bacteria 4025
126 Ga0068864_100047539 3300005618 Bacteria 3686
127 Ga0068864_100264299 3300005618 Bacteria 1601
128 Ga0068861_100001293 3300005719 Bacteria 15634
129 Ga0068870_10030342 3300005840 Bacteria 2731
130 Ga0068863_100188851 3300005841 Bacteria 1980
131 Ga0068863_100368584 3300005841 Bacteria 1401
132 Ga0068858_100073634 3300005842 Bacteria 3170
133 Ga0068858_100215278 3300005842 Bacteria 1819
134 Ga0068860_100499012 3300005843 Bacteria 1215
135 Ga0068860_100505478 3300005843 Bacteria 1207
136 Ga0068862_100001293 3300005844 Bacteria 23404
137 Ga0068862_100600161 3300005844 Bacteria 1057
138 Ga0068862_100720402 3300005844 Bacteria 968
139 Ga0081455_10237064 3300005937 Bacteria 1343
140 Ga0081539_10000013 3300005985 Bacteria 432395
141 Ga0081539_10032125 3300005985 Bacteria 3220
142 Ga0075365_10297353 3300006038 Bacteria 1136
143 Ga0075368_10024950 3300006042 Bacteria 2292
144 Ga0075368_10040292 3300006042 Bacteria 1834
145 Ga0075363_100072672 3300006048 Bacteria 1871
146 Ga0075364_10071053 3300006051 Bacteria 2292
147 Ga0075367_10034183 3300006178 Bacteria 2935
148 Ga0075367_10117001 3300006178 Bacteria 1640
149 Ga0075367_10180982 3300006178 Bacteria 1314
150 Ga0075366_10011632 3300006195 Bacteria 4973
151 Ga0075366_10013078 3300006195 Bacteria 4719
152 Ga0075366_10087646 3300006195 Bacteria 1863
153 Ga0097621_100087395 3300006237 Bacteria 2603
154 Ga0075370_10190620 3300006353 Bacteria 1208
155 Ga0068871_100016184 3300006358 Bacteria 5607
156 Ga0075428_100004324 3300006844 Bacteria 15656
157 Ga0075428_100008303 3300006844 Bacteria 11509
158 Ga0075428_100038743 3300006844 Bacteria 5245
159 Ga0075428_100040404 3300006844 Bacteria 5132
160 Ga0075428_100042411 3300006844 Bacteria 5002
161 Ga0075428_100053808 3300006844 Bacteria 4411
162 Ga0075428_100057629 3300006844 Bacteria 4252
163 Ga0075428_100060840 3300006844 Bacteria 4135
164 Ga0075428_100367431 3300006844 Bacteria 1543
165 Ga0075430_100004526 3300006846 Bacteria 11712
166 Ga0075430_100018326 3300006846 Bacteria 5959
167 Ga0075430_100092119 3300006846 Bacteria 2534
168 Ga0075430_100192299 3300006846 Bacteria 1696
169 Ga0075431_100002953 3300006847 Bacteria 16460
170 Ga0075431_100009494 3300006847 Bacteria 9767
171 Ga0075431_100056258 3300006847 Bacteria 4058
172 Ga0075431_100072671 3300006847 Bacteria 3549
173 Ga0075431_100604365 3300006847 Bacteria 1080
174 Ga0075433_10002009 3300006852 Bacteria 15330
175 Ga0075433_10013571 3300006852 Bacteria 6631
176 Ga0075433_10107560 3300006852 Bacteria 2473
177 Ga0075433_10187483 3300006852 Bacteria 1840
178 Ga0075433_10490662 3300006852 Bacteria 1082
179 Ga0075434_100005716 3300006871 Bacteria 11358
180 Ga0075434_100433939 3300006871 Bacteria 1335
181 Ga0075434_100769468 3300006871 Bacteria 979
182 Ga0075429_100035210 3300006880 Bacteria 4354
183 Ga0075429_100073507 3300006880 Bacteria 2978
184 Ga0075429_100122384 3300006880 Bacteria 2274
185 Ga0075429_100132471 3300006880 Bacteria 2181
186 Ga0075429_100135230 3300006880 Bacteria 2157
187 Ga0068865_100051426 3300006881 Bacteria 2852
188 Ga0068865_100134842 3300006881 Bacteria 1854
189 Ga0068865_100451590 3300006881 Bacteria 1063
190 Ga0097620_100022326 3300006931 Bacteria 6345
191 Ga0097620_100084624 3300006931 Bacteria 3216
192 Ga0097620_100181947 3300006931 Bacteria 2185
193 Ga0075435_100013704 3300007076 Bacteria 6040
194 Ga0075435_100066812 3300007076 Bacteria 2927
195 Ga0075435_100526047 3300007076 Bacteria 1023
196 Ga0111539_10000044 3300009094 Bacteria 125347
197 Ga0111539_10001774 3300009094 Bacteria 28680
198 Ga0111539_10005848 3300009094 Bacteria 15900
199 Ga0111539_10022455 3300009094 Bacteria 7752
200 Ga0111539_10100674 3300009094 Bacteria 3393
201 Ga0111539_10121912 3300009094 Bacteria 3055
202 Ga0111539_10197042 3300009094 Bacteria 2349
203 Ga0105245_10161806 3300009098 Bacteria 2125
204 Ga0105245_10275532 3300009098 Bacteria 1642
205 Ga0105247_10015547 3300009101 Bacteria 4557
206 Ga0114129_10003198 3300009147 Bacteria 22984
207 Ga0114129_10003276 3300009147 Bacteria 22724
208 Ga0114129_10011221 3300009147 Bacteria 12771
209 Ga0114129_10018538 3300009147 Bacteria 9908
210 Ga0114129_10029480 3300009147 Bacteria 7773
211 Ga0114129_10034456 3300009147 Bacteria 7151
212 Ga0114129_10036817 3300009147 Bacteria 6909
213 Ga0114129_10043949 3300009147 Bacteria 6285
214 Ga0114129_10273399 3300009147 Bacteria 2260
215 Ga0114129_10651810 3300009147 Bacteria 1359
216 Ga0114129_10701960 3300009147 Bacteria 1300
217 Ga0114129_10793481 3300009147 Bacteria 1209
218 Ga0114129_11096099 3300009147 Bacteria 997
219 Ga0105243_10008157 3300009148 Bacteria 8043
220 Ga0105243_10627645 3300009148 Bacteria 1038
221 Ga0105243_10791601 3300009148 Bacteria 934
222 Ga0105243_10792470 3300009148 Bacteria 933
223 Ga0105242_10004358 3300009176 Bacteria 11013
224 Ga0105242_10029391 3300009176 Bacteria 4383
225 Ga0105248_10003474 3300009177 Bacteria 17498
226 Ga0105248_10338249 3300009177 Bacteria 1695
227 Ga0105248_10363162 3300009177 Bacteria 1630
228 Ga0105248_10856871 3300009177 Bacteria 1026
229 Ga0105249_10063260 3300009553 Bacteria 3399
230 Ga0105249_10433156 3300009553 Bacteria 1351
231 Ga0105239_10437219 3300010375 Bacteria 1483
232 Ga0105246_10098207 3300011119 Bacteria 2127
233 Ga0157378_10487593 3300013297 Bacteria 1229
234 Ga0163162_10384511 3300013306 Bacteria 1537
235 Ga0157375_10017681 3300013308 Bacteria 6443
236 Ga0157375_10068481 3300013308 Bacteria 3551
237 Ga0157375_10195509 3300013308 Bacteria 2178
238 Ga0157375_10319233 3300013308 Bacteria 1718
239 Ga0157375_11145456 3300013308 Bacteria 911
240 Ga0157375_11276215 3300013308 Bacteria 863
241 Ga0163163_10015191 3300014325 Bacteria 7111
242 Ga0163163_10015742 3300014325 Bacteria 7003
243 Ga0163163_10121289 3300014325 Bacteria 2648
244 Ga0163163_10314078 3300014325 Bacteria 1620
245 Ga0163163_10462909 3300014325 Bacteria 1328
246 Ga0157380_10033222 3300014326 Bacteria 3973
247 Ga0157380_10044245 3300014326 Bacteria 3488
248 Ga0157380_10053096 3300014326 Bacteria 3212
249 Ga0157380_10090524 3300014326 Bacteria 2524
250 Ga0157380_10840006 3300014326 Bacteria 939
251 Ga0157377_10155714 3300014745 Bacteria 1417
252 Ga0157379_10288603 3300014968 Bacteria 1494
253 Ga0157379_10370582 3300014968 Bacteria 1313
254 Ga0157376_10047026 3300014969 Bacteria 3561
255 Ga0157376_10241151 3300014969 Bacteria 1684
256 Ga0163161_10014143 3300017792 Bacteria 5557
257 Ga0163161_10184204 3300017792 Bacteria 1602
258 Ga0207653_10013145 3300025885 Bacteria 2591
259 Ga0207682_10029302 3300025893 Bacteria 2201
260 Ga0207682_10034493 3300025893 Bacteria 2040
261 Ga0207642_10066306 3300025899 Bacteria 1700
262 Ga0207688_10039718 3300025901 Bacteria 2614
263 Ga0207680_10099444 3300025903 Bacteria 1866
264 Ga0207645_10016937 3300025907 Bacteria 4815
265 Ga0207645_10177307 3300025907 Bacteria 1398
266 Ga0207643_10042739 3300025908 Bacteria 2556
267 Ga0207643_10077130 3300025908 Bacteria 1926
268 Ga0207684_10384094 3300025910 Bacteria 1208
269 Ga0207707_10116355 3300025912 Bacteria 2336
270 Ga0207693_10265189 3300025915 Bacteria 1346
271 Ga0207662_10009076 3300025918 Bacteria 5462
272 Ga0207649_10141182 3300025920 Bacteria 1648
273 Ga0207646_10449307 3300025922 Bacteria 1163
274 Ga0207681_10000566 3300025923 Bacteria 25276
275 Ga0207681_10020173 3300025923 Bacteria 4220
276 Ga0207681_10314482 3300025923 Bacteria 1243
277 Ga0207650_10018705 3300025925 Bacteria 4864
278 Ga0207650_10221565 3300025925 Bacteria 1523
279 Ga0207650_10344708 3300025925 Bacteria 1224
280 Ga0207659_10002762 3300025926 Bacteria 10460
281 Ga0207659_10003108 3300025926 Bacteria 9917
282 Ga0207659_10020717 3300025926 Bacteria 4352
283 Ga0207659_10038664 3300025926 Bacteria 3321
284 Ga0207659_10059612 3300025926 Bacteria 2744
285 Ga0207659_10081391 3300025926 Bacteria 2394
286 Ga0207659_10083870 3300025926 Bacteria 2363
287 Ga0207659_10193314 3300025926 Bacteria 1620
288 Ga0207644_10047281 3300025931 Bacteria 3070
289 Ga0207690_10063059 3300025932 Bacteria 2526
290 Ga0207706_10049318 3300025933 Bacteria 3721
291 Ga0207706_10049702 3300025933 Bacteria 3705
292 Ga0207706_10050355 3300025933 Bacteria 3681
293 Ga0207706_10094679 3300025933 Bacteria 2627
294 Ga0207686_10003148 3300025934 Bacteria 8874
295 Ga0207709_10062303 3300025935 Bacteria 2334
296 Ga0207709_10441900 3300025935 Bacteria 1003
297 Ga0207670_10202889 3300025936 Bacteria 1508
298 Ga0207669_10105729 3300025937 Bacteria 1873
299 Ga0207704_10031753 3300025938 Bacteria 2979
300 Ga0207704_10288333 3300025938 Bacteria 1251
301 Ga0207691_10008285 3300025940 Bacteria 9981
302 Ga0207691_10068031 3300025940 Bacteria 3218
303 Ga0207691_10078470 3300025940 Bacteria 2972
304 Ga0207691_10349406 3300025940 Bacteria 1265
305 Ga0207691_10373327 3300025940 Bacteria 1218
306 Ga0207691_10424512 3300025940 Bacteria 1133
307 Ga0207711_10108376 3300025941 Bacteria 2467
308 Ga0207711_10313138 3300025941 Bacteria 1449
309 Ga0207689_10005795 3300025942 Bacteria 10963
310 Ga0207661_10020477 3300025944 Bacteria 4945
311 Ga0207679_10062568 3300025945 Bacteria 2774
312 Ga0207679_10116972 3300025945 Bacteria 2115
313 Ga0207651_10020058 3300025960 Bacteria 4024
314 Ga0207651_10027555 3300025960 Bacteria 3570
315 Ga0207651_10260522 3300025960 Bacteria 1423
316 Ga0207712_10009450 3300025961 Bacteria 6170
317 Ga0207712_10226305 3300025961 Bacteria 1498
318 Ga0207668_10321407 3300025972 Bacteria 1284
319 Ga0207658_10255470 3300025986 Bacteria 1491
320 Ga0207677_10126569 3300026023 Bacteria 1932
321 Ga0207703_10089501 3300026035 Bacteria 2585
322 Ga0207678_10244306 3300026067 Bacteria 1537
323 Ga0207708_10034870 3300026075 Bacteria 3828
324 Ga0207708_10061141 3300026075 Bacteria 2875
325 Ga0207708_10088933 3300026075 Bacteria 2380
326 Ga0207708_10223248 3300026075 Bacteria 1510
327 Ga0207641_10091233 3300026088 Bacteria 2666
328 Ga0207641_10091854 3300026088 Bacteria 2658
329 Ga0207648_10000093 3300026089 Bacteria 84666
330 Ga0207648_10000446 3300026089 Bacteria 45706
331 Ga0207648_10053106 3300026089 Bacteria 3543
332 Ga0207648_10160251 3300026089 Bacteria 1987
333 Ga0207676_10016223 3300026095 Bacteria 5393
334 Ga0207676_10140872 3300026095 Bacteria 2064
335 Ga0207674_10050425 3300026116 Bacteria 4252
336 Ga0207674_10682553 3300026116 Bacteria 992
337 Ga0207675_100001058 3300026118 Bacteria 27297
338 Ga0207675_100331895 3300026118 Bacteria 1487
339 Ga0207683_10047333 3300026121 Bacteria 3766
340 Ga0207683_10162315 3300026121 Bacteria 2021
341 Ga0207683_10259687 3300026121 Bacteria 1586
342 Ga0207683_10330360 3300026121 Bacteria 1397
343 Ga0207683_10529888 3300026121 Bacteria 1089
344 Ga0207698_10081986 3300026142 Bacteria 2606
345 Ga0209813_10005694 3300027866 Bacteria 3039
346 Ga0209813_10054438 3300027866 Bacteria 1261
347 Ga0207428_10000224 3300027907 Bacteria 78533
348 Ga0207428_10000353 3300027907 Bacteria 59325
349 Ga0207428_10001835 3300027907 Bacteria 21713
350 Ga0207428_10004706 3300027907 Bacteria 12908
351 Ga0268266_10200670 3300028379 Bacteria 1825
352 Ga0268265_10000540 3300028380 Bacteria 38471
353 Ga0265320_10021010 3300031240 Bacteria 3522
354 Ga0307408_100552902 3300031548 Bacteria 1016
355 Ga0316575_10000379 3300031665 Bacteria 12680
356 Ga0316575_10008564 3300031665 Bacteria 3729
357 Ga0316575_10012085 3300031665 Bacteria 3205
358 Ga0316575_10055596 3300031665 Unclassified 1576
359 Ga0316579_10013095 3300031691 Bacteria 3566
360 Ga0316579_10037056 3300031691 Bacteria 2251
361 Ga0316579_10060175 3300031691 Bacteria 1786
362 Ga0316576_10032404 3300031727 Bacteria 3713
363 Ga0316576_10035139 3300031727 Bacteria 3576
364 Ga0316576_10313606 3300031727 Bacteria 1171
365 Ga0316578_10000571 3300031728 Bacteria 12755
366 Ga0316578_10027960 3300031728 Bacteria 3190
367 Ga0316578_10035279 3300031728 Bacteria 2874
368 Ga0316578_10059292 3300031728 Unclassified 2251
369 Ga0307405_10020130 3300031731 Bacteria 3723
370 Ga0307405_10071891 3300031731 Bacteria 2227
371 Ga0316577_10074878 3300031733 Unclassified 1890
372 Ga0316577_10155712 3300031733 Bacteria 1288
373 Ga0307413_10059301 3300031824 Bacteria 2351
374 Ga0307410_10009560 3300031852 Bacteria 5445
375 Ga0307407_10016332 3300031903 Bacteria 3694
376 Ga0307407_10052571 3300031903 Bacteria 2340
377 Ga0307407_10279336 3300031903 Bacteria 1156
378 Ga0307412_10010531 3300031911 Bacteria 5326
379 Ga0307412_10033995 3300031911 Bacteria 3246
380 Ga0307409_100011842 3300031995 Bacteria 5524
381 Ga0307416_100115339 3300032002 Bacteria 2378
382 Ga0307416_100162560 3300032002 Bacteria 2066
383 Ga0307416_100171326 3300032002 Bacteria 2021
384 Ga0307416_100176553 3300032002 Bacteria 1996
385 Ga0307416_100273146 3300032002 Bacteria 1661
386 Ga0307414_10019076 3300032004 Bacteria 4243
387 Ga0307411_10030763 3300032005 Bacteria 3295
388 Ga0307411_10112647 3300032005 Bacteria 1950
389 Ga0307415_100002028 3300032126 Bacteria 9981
390 Ga0307415_100009527 3300032126 Bacteria 5450
391 Ga0307415_100861007 3300032126 Bacteria 832
392 Ga0316583_10002748 3300032133 Bacteria 6156
393 Ga0316583_10009760 3300032133 Bacteria 3459
394 Ga0316585_10011269 3300032137 Unclassified 2635
395 Ga0316585_10028778 3300032137 Bacteria 1738
396 Ga0316585_10034624 3300032137 Unclassified 1597
397 Ga0316585_10035445 3300032137 Bacteria 1580
398 Ga0373956_0119238 3300035119 Bacteria 1232
399 Ga0316574_0000111 3300035398 Bacteria 24461
400 Ga0316574_0008211 3300035398 Bacteria 5783
401 Ga0316574_0081091 3300035398 Bacteria 2060
402 Ga0316574_0107077 3300035398 Bacteria 1791
403 Ga0316574_0224742 3300035398 Bacteria 1202
404 Ga0373933_0149501 3300035724 Bacteria 1479
405 Ga0373947_0272671 3300035725 Bacteria 1123
406 Ga0373937_0055238 3300036401 Bacteria 3645
407 Ga0316582_0002544 3300036647 Bacteria 8623
408 Ga0316582_0023037 3300036647 Bacteria 3706
409 Ga0316582_0023791 3300036647 Bacteria 3654
410 Ga0316582_0040281 3300036647 Bacteria 2915
411 Ga0316582_0095450 3300036647 Bacteria 1962
412 Ga0316582_0353758 3300036647 Unclassified 1010
413 Ga0316584_0051201 3300036712 Bacteria 3088
414 Ga0316584_0077969 3300036712 Unclassified 2481
415 Ga0316584_0124144 3300036712 Bacteria 1928
416 Ga0316584_0327678 3300036712 Bacteria 1103
417 Ga0316584_0352428 3300036712 Bacteria 1057
418 Ga0373925_0002431 3300037068 Bacteria 14944
419 Ga0373925_0120907 3300037068 Bacteria 2033
420 Ga0373925_0617754 3300037068 Bacteria 893
421 Ga0316581_0031379 3300037588 Unclassified 1602
422 Ga0400484_14695 3300038725 Bacteria 2468
423 Ga0400484_27053 3300038725 Bacteria 3702
424 Ga0400490_12009 3300038726 Bacteria 1860
425 Ga0400490_38045 3300038726 Bacteria 7092
426 Ga0400485_12512 3300038735 Bacteria 4090
427 Ga0400488_34107 3300038741 Bacteria 3335
428 Ga0400486_16214 3300038742 Bacteria 14722
429 Ga0400483_025546 3300039062 Bacteria 6159
430 Ga0400489_35601 3300039093 Bacteria 46445
431 Ga0400489_55815 3300039093 Bacteria 17250
432 Ga0400489_59518 3300039093 Bacteria 12727
433 Ga0400487_17402 3300039110 Bacteria 7095
434 Ga0436365_0629800 3300039437 Unclassified 3429
435 Ga0439439_0029153 3300041406 Bacteria 1400
436 Ga0451853_3243712 3300041512 Bacteria 879
437 Ga0450923_008783 3300042125 Bacteria 1750
438 Ga0450908_003053 3300042184 Bacteria 3262
439 Ga0450908_009613 3300042184 Bacteria 1793
440 Ga0439435_0004343 3300042436 Bacteria 3044
441 Ga0450918_023788 3300042531 Bacteria 1071
442 Ga0451577_0000195 3300042876 Bacteria 127456
443 Ga0453684_0000635 3300044712 Bacteria 127456
444 Ga0451576_0021675 3300045051 Bacteria 6980
445 Ga0451576_0077873 3300045051 Bacteria 3450
446 Ga0495629_0159581 3300046459 Bacteria 1567
447 Ga0495638_0006670 3300046460 Bacteria 8374
448 Ga0495580_0002904 3300046472 Bacteria 14727
449 Ga0495580_0091370 3300046472 Bacteria 2119
450 Ga0495584_0014394 3300046491 Bacteria 4029
451 Ga0495628_0156131 3300046516 Bacteria 1736
452 Ga0495642_0006205 3300046528 Bacteria 4588
453 Ga0495642_0192668 3300046528 Bacteria 888
454 Ga0495665_0212224 3300046531 Bacteria 1002
455 Ga0495598_0054750 3300046537 Bacteria 1212
456 Ga0495621_0000539 3300046539 Bacteria 9397
457 Ga0495621_0019350 3300046539 Bacteria 2223
458 Ga0495645_0003686 3300046543 Bacteria 10412
459 Ga0495622_0129124 3300046557 Bacteria 1152
460 Ga0495633_0087802 3300046558 Bacteria 1446
461 Ga0495656_0033424 3300046615 Bacteria 2099
462 Ga0495659_0193734 3300046664 Bacteria 831
463 Ga0495658_0032462 3300046683 Bacteria 2851
464 Ga0495658_0050078 3300046683 Bacteria 2362
465 Ga0495669_0007590 3300046684 Bacteria 4550
466 Ga0495669_0015198 3300046684 Bacteria 3295
467 Ga0495669_0197465 3300046684 Bacteria 961
468 Ga0495613_0083142 3300046689 Bacteria 2325
469 Ga0495613_0098235 3300046689 Bacteria 2116
470 Ga0495670_0007613 3300046691 Bacteria 5324
471 Ga0495604_0164068 3300047317 Bacteria 1568
472 Ga0495684_0297252 3300047471 Bacteria 1160
473 Ga0496102_0437913 3300048905 Bacteria 1227
474 Ga0496104_0326978 3300048907 Bacteria 1446
475 Ga0496105_0044014 3300048908 Bacteria 3681
476 Ga0496109_0026137 3300048912 Bacteria 5205
477 Ga0496109_0873911 3300048912 Bacteria 837
478 Ga0496114_0041357 3300048917 Bacteria 3820
479 Ga0496114_0187462 3300048917 Bacteria 1808
480 Ga0501032_0116247 3300049569 Bacteria 1769
481 Ga0501036_0185774 3300049572 Bacteria 1749
482 Ga0501038_0153273 3300049574 Bacteria 1878
483 Ga0501039_0015829 3300049575 Bacteria 5775
484 Ga0501039_0090042 3300049575 Bacteria 2391
485 Ga0501039_0172389 3300049575 Bacteria 1701
486 Ga0501040_0064480 3300049576 Bacteria 2522
487 Ga0501040_0064579 3300049576 Bacteria 2520
488 Ga0501041_0127046 3300049577 Bacteria 1587
489 Ga0501042_0002376 3300049578 Bacteria 11534
490 Ga0501042_0011703 3300049578 Bacteria 5928
491 Ga0501046_0016929 3300049580 Bacteria 6098
492 Ga0501046_0365340 3300049580 Bacteria 1046
493 Ga0501046_0493260 3300049580 Bacteria 878
494 Ga0501048_0014072 3300049582 Bacteria 5930
495 Ga0501048_0177608 3300049582 Bacteria 1509
496 Ga0501068_0119420 3300049584 Bacteria 1643
497 Ga0501070_0508685 3300049586 Bacteria 967
498 Ga0501072_0006039 3300049588 Bacteria 9240
499 Ga0501072_0069616 3300049588 Bacteria 2778
500 Ga0501072_0340237 3300049588 Bacteria 1192
501 Ga0501075_0014812 3300049591 Bacteria 5591
502 Ga0501075_0074054 3300049591 Bacteria 2576
503 Ga0501075_0172560 3300049591 Bacteria 1650
504 Ga0501076_0042575 3300049592 Bacteria 3575
505 Ga0501077_0163752 3300049593 Bacteria 1412
506 Ga0501077_0234519 3300049593 Bacteria 1166
507 Ga0501079_0032104 3300049741 Bacteria 4036
508 Ga0501079_0280326 3300049741 Bacteria 1303
509 Ga0501080_0439348 3300049742 Bacteria 1171
510 Ga0501081_0047448 3300049743 Bacteria 2955
511 Ga0501081_0411234 3300049743 Bacteria 1002
512 Ga0501035_0380131 3300049822 Bacteria 1178
513 Ga0501045_0023711 3300049824 Bacteria 4402
514 nmdc:mga00v17_41393_c1 3300050491 Bacteria 2767
515 nmdc:mga0k408_10084_c1 3300050493 Bacteria 5103
516 nmdc:mga04h51_14746_c1 3300050495 Bacteria 2240
517 nmdc:mga04h51_8245_c1 3300050495 Bacteria 2784
518 nmdc:mga04h51_8660_c1 3300050495 Bacteria 2727
519 nmdc:mga07m45_50616_c1 3300050496 Bacteria 2341
520 nmdc:mga07m45_95335_c1 3300050496 Bacteria 1707
521 nmdc:mga05p37_1185083_c1 3300050507 Bacteria 791
522 nmdc:mga05p37_221265_c1 3300050507 Bacteria 2284
523 nmdc:mga05p37_28799_c1 3300050507 Bacteria 6776
524 nmdc:mga05p37_35576_c2 3300050507 Bacteria 2854
525 nmdc:mga05p37_41077_c1 3300050507 Bacteria 5333
526 nmdc:mga05p37_494104_c1 3300050507 Bacteria 1406
527 nmdc:mga05p37_543215_c1 3300050507 Bacteria 1325
528 nmdc:mga05p37_637800_c1 3300050507 Bacteria 1196
529 nmdc:mga05p37_73718_c1 3300050507 Bacteria 4201
530 nmdc:mga05p37_744442_c1 3300050507 Bacteria 1081
531 nmdc:mga05p37_86226_c2 3300050507 Bacteria 3617
532 nmdc:mga09592_100232_c1 3300050508 Bacteria 2480
533 nmdc:mga09592_128189_c1 3300050508 Bacteria 2182
534 nmdc:mga09592_18887_c1 3300050508 Bacteria 5655
535 nmdc:mga09592_21646_c1 3300050508 Bacteria 5300
536 nmdc:mga09592_29197_c1 3300050508 Bacteria 4586
537 nmdc:mga09592_343167_c1 3300050508 Bacteria 1293
538 nmdc:mga09592_88971_c1 3300050508 Bacteria 2638
539 nmdc:mga0qj67_14582_c1 3300050509 Bacteria 4013
540 nmdc:mga0qj67_350903_c1 3300050509 Bacteria 1193
541 nmdc:mga0qj67_36224_c1 3300050509 Bacteria 3859
542 nmdc:mga0qj67_41368_c1 3300050509 Bacteria 3625
543 nmdc:mga0qj67_4306_c2 3300050509 Bacteria 8212
544 nmdc:mga06r32_13671_c1 3300050510 Bacteria 7361
545 nmdc:mga06r32_181496_c1 3300050510 Bacteria 2091
546 nmdc:mga06r32_44898_c1 3300050510 Bacteria 4210
547 nmdc:mga06r32_481770_c1 3300050510 Bacteria 1219
548 nmdc:mga06r32_62556_c1 3300050510 Bacteria 3586
549 nmdc:mga06r32_88622_c1 3300050510 Bacteria 3021
550 nmdc:mga08y16_164190_c1 3300050511 Bacteria 2307
551 nmdc:mga08y16_32226_c1 3300050511 Bacteria 5511
552 nmdc:mga08y16_34435_c1 3300050511 Bacteria 5320
553 nmdc:mga08y16_34682_c1 3300050511 Bacteria 5301
554 nmdc:mga08y16_530076_c1 3300050511 Bacteria 1194
555 nmdc:mga08y16_5828_c1 3300050511 Bacteria 12911
556 nmdc:mga08y16_6728_c1 3300050511 Bacteria 12051
557 nmdc:mga08y16_829056_c1 3300050511 Unclassified 916
558 nmdc:mga0n895_158346_c1 3300050512 Bacteria 2296
559 nmdc:mga0n895_237975_c1 3300050512 Bacteria 1848
560 nmdc:mga0n895_4485_c1 3300050512 Bacteria 11475
561 nmdc:mga0n895_6752_c1 3300050512 Bacteria 9788
562 nmdc:mga0rr50_204135_c1 3300050513 Bacteria 1626
563 nmdc:mga0rr50_371511_c1 3300050513 Bacteria 1205
564 nmdc:mga0a205_134492_c1 3300050515 Bacteria 2373
565 nmdc:mga0a205_197113_c1 3300050515 Bacteria 1905
566 nmdc:mga0a205_42998_c1 3300050515 Bacteria 4355
567 nmdc:mga0a205_44250_c1 3300050515 Bacteria 4291
568 nmdc:mga0a205_6501_c1 3300050515 Bacteria 10567
569 nmdc:mga0a205_73291_c1 3300050515 Bacteria 3308
570 nmdc:mga0a205_808_c1 3300050515 Bacteria 25457
571 Ga0495601_0027654 3300053077 Bacteria 3507
572 Ga0495601_0046729 3300053077 Bacteria 2725
573 Ga0495612_0128878 3300053078 Bacteria 1092
574 Ga0495619_0033144 3300053085 Bacteria 3354
575 Ga0495619_0176958 3300053085 Bacteria 1475
576 Ga0495619_0331042 3300053085 Bacteria 1054
577 Ga0501084_0022462 3300054114 Bacteria 5264
578 Ga0501084_0067796 3300054114 Bacteria 2987
579 Ga0590071_000198 3300059421 Bacteria 17604
580 Ga0590071_000207 3300059421 Bacteria 17379
581 Ga0590071_001255 3300059421 Bacteria 6825
582 Ga0590074_000161 3300059423 Bacteria 8148
583 Ga0590074_000467 3300059423 Bacteria 5921
584 Ga0590074_014175 3300059423 Bacteria 1348
585 Ga0590075_000997 3300059424 Bacteria 7333
586 Ga0590075_004629 3300059424 Bacteria 3258
587 Ga0590075_012701 3300059424 Bacteria 2047
588 Ga0590077_000049 3300059426 Bacteria 28044
589 Ga0590077_000317 3300059426 Bacteria 13647
590 Ga0590077_002943 3300059426 Bacteria 3568
591 Ga0590077_010917 3300059426 Bacteria 1872
592 Ga0501082_0006994 3300060353 Bacteria 9740
593 Ga0530510_0004934 3300061734 Bacteria 9214
594 Ga0530510_0131795 3300061734 Bacteria 1839
595 Ga0075428_100105009
596 Ga0065704_10011361
597 Ga0065712_10069978
598 Ga0065712_10132884
599 Ga0065707_10012468
600 Ga0065707_10093698
601 Ga0070658_10126365
602 Ga0070658_10129742
603 Ga0070676_10032547
604 Ga0070676_10133568
605 Ga0070683_100010292
606 Ga0070690_100057026
607 Ga0070670_100041556
608 Ga0070670_100355967
609 Ga0070677_10019341
610 Ga0068869_100005463
611 Ga0068869_100037831
612 Ga0070666_10297468
613 Ga0068868_100070609
614 Ga0070689_100205075
615 Ga0070661_100214631
616 Ga0070692_10008324
617 Ga0070692_10060574
618 Ga0070668_100161619
619 Ga0070669_100002727
620 Ga0070675_100000537
621 Ga0070675_100003145
622 Ga0070675_100005031
623 Ga0070675_100013258
624 Ga0070675_100025213
625 Ga0070675_100031657
626 Ga0070675_100172017
627 Ga0070675_100318057
628 Ga0070671_100011390
629 Ga0070671_100071095
630 Ga0070671_100374825
631 Ga0070671_100444264
632 Ga0070674_100166798
633 Ga0070673_100006495
634 Ga0070673_100063489
635 Ga0070673_100064952
636 Ga0070673_100120743
637 Ga0070673_100163624
638 Ga0070673_100188075
639 Ga0070673_100213383
640 Ga0070688_100009604
641 Ga0070688_100045784
642 Ga0070688_100195494
643 Ga0070659_100239435
644 Ga0070713_100019968
645 Ga0070701_10004199
646 Ga0070701_10116811
647 Ga0070705_100001006
648 Ga0070705_100048356
649 Ga0070705_100121135
650 Ga0070700_100018136
651 Ga0070700_100019280
652 Ga0070700_100199496
653 Ga0070700_100246177
654 Ga0070700_100297835
655 Ga0070694_100001224
656 Ga0070694_100012256
657 Ga0070694_100166157
658 Ga0070694_100246467
659 Ga0070694_100286770
660 Ga0070694_100336625
661 Ga0070708_100475433
662 Ga0070663_100334795
663 Ga0070678_100022786
664 Ga0070678_100061573
665 Ga0070678_100117243
666 Ga0070678_100595112
667 Ga0070662_100128894
668 Ga0070662_100153784
669 Ga0070662_100256708
670 Ga0070681_10025905
671 Ga0068867_100000147
672 Ga0068867_100003422
673 Ga0068867_100069525
674 Ga0070685_10073945
675 Ga0070706_100075147
676 Ga0070706_100190179
677 Ga0070707_100058411
678 Ga0070707_100428525
679 Ga0070707_100657118
680 Ga0070698_100010865
681 Ga0070698_100366801
682 Ga0070698_100537966
683 Ga0070699_100012945
684 Ga0070699_100033837
685 Ga0070699_100103320
686 Ga0070699_100160392
687 Ga0070699_100264340
688 Ga0070684_100015033
689 Ga0070684_100042317
690 Ga0070697_100048336
691 Ga0070697_100114919
692 Ga0068853_100756125
693 Ga0070672_100003678
694 Ga0070672_100048688
695 Ga0070686_100056978
696 Ga0070695_100000425
697 Ga0070695_100045159
698 Ga0070695_100613726
699 Ga0070696_100004775
700 Ga0070696_100021370
701 Ga0070696_100025156
702 Ga0070696_100034889
703 Ga0070696_100220573
704 Ga0070693_100160589
705 Ga0070665_100049461
706 Ga0070704_100007021
707 Ga0070704_100007503
708 Ga0070704_100143245
709 Ga0070704_100173123
710 Ga0070704_100645057
711 Ga0070664_100010031
712 Ga0070664_100048511
713 Ga0070664_100227644
714 Ga0070702_100046537
715 Ga0070702_100124668
716 Ga0068859_100022329
717 Ga0068859_100084626
718 Ga0068859_100181943
719 Ga0068864_100039639
720 Ga0068864_100047539
721 Ga0068864_100264299
722 Ga0068861_100001293
723 Ga0068870_10030342
724 Ga0068863_100188851
725 Ga0068863_100368584
726 Ga0068858_100073634
727 Ga0068858_100215278
728 Ga0068860_100499012
729 Ga0068860_100505478
730 Ga0068862_100001293
731 Ga0068862_100600161
732 Ga0068862_100720402
733 Ga0081455_10237064
734 Ga0081539_10000013
735 Ga0081539_10032125
736 Ga0075365_10297353
737 Ga0075368_10024950
738 Ga0075368_10040292
739 Ga0075363_100072672
740 Ga0075364_10071053
741 Ga0075367_10034183
742 Ga0075367_10117001
743 Ga0075367_10180982
744 Ga0075366_10011632
745 Ga0075366_10013078
746 Ga0075366_10087646
747 Ga0097621_100087395
748 Ga0075370_10190620
749 Ga0068871_100016184
750 Ga0075428_100004324
751 Ga0075428_100008303
752 Ga0075428_100038743
753 Ga0075428_100040404
754 Ga0075428_100042411
755 Ga0075428_100053808
756 Ga0075428_100057629
757 Ga0075428_100060840
758 Ga0075428_100367431
759 Ga0075430_100004526
760 Ga0075430_100018326
761 Ga0075430_100092119
762 Ga0075430_100192299
763 Ga0075431_100002953
764 Ga0075431_100009494
765 Ga0075431_100056258
766 Ga0075431_100072671
767 Ga0075431_100604365
768 Ga0075433_10002009
769 Ga0075433_10013571
770 Ga0075433_10107560
771 Ga0075433_10187483
772 Ga0075433_10490662
773 Ga0075434_100005716
774 Ga0075434_100433939
775 Ga0075434_100769468
776 Ga0075429_100035210
777 Ga0075429_100073507
778 Ga0075429_100122384
779 Ga0075429_100132471
780 Ga0075429_100135230
781 Ga0068865_100051426
782 Ga0068865_100134842
783 Ga0068865_100451590
784 Ga0097620_100022326
785 Ga0097620_100084624
786 Ga0097620_100181947
787 Ga0075435_100013704
788 Ga0075435_100066812
789 Ga0075435_100526047
790 Ga0111539_10000044
791 Ga0111539_10001774
792 Ga0111539_10005848
793 Ga0111539_10022455
794 Ga0111539_10100674
795 Ga0111539_10121912
796 Ga0111539_10197042
797 Ga0105245_10161806
798 Ga0105245_10275532
799 Ga0105247_10015547
800 Ga0114129_10003198
801 Ga0114129_10003276
802 Ga0114129_10011221
803 Ga0114129_10018538
804 Ga0114129_10029480
805 Ga0114129_10034456
806 Ga0114129_10036817
807 Ga0114129_10043949
808 Ga0114129_10273399
809 Ga0114129_10651810
810 Ga0114129_10701960
811 Ga0114129_10793481
812 Ga0114129_11096099
813 Ga0105243_10008157
814 Ga0105243_10627645
815 Ga0105243_10791601
816 Ga0105243_10792470
817 Ga0105242_10004358
818 Ga0105242_10029391
819 Ga0105248_10003474
820 Ga0105248_10338249
821 Ga0105248_10363162
822 Ga0105248_10856871
823 Ga0105249_10063260
824 Ga0105249_10433156
825 Ga0105239_10437219
826 Ga0105246_10098207
827 Ga0157378_10487593
828 Ga0163162_10384511
829 Ga0157375_10017681
830 Ga0157375_10068481
831 Ga0157375_10195509
832 Ga0157375_10319233
833 Ga0157375_11145456
834 Ga0157375_11276215
835 Ga0163163_10015191
836 Ga0163163_10015742
837 Ga0163163_10121289
838 Ga0163163_10314078
839 Ga0163163_10462909
840 Ga0157380_10033222
841 Ga0157380_10044245
842 Ga0157380_10053096
843 Ga0157380_10090524
844 Ga0157380_10840006
845 Ga0157377_10155714
846 Ga0157379_10288603
847 Ga0157379_10370582
848 Ga0157376_10047026
849 Ga0157376_10241151
850 Ga0163161_10014143
851 Ga0163161_10184204
852 Ga0207653_10013145
853 Ga0207682_10029302
854 Ga0207682_10034493
855 Ga0207642_10066306
856 Ga0207688_10039718
857 Ga0207680_10099444
858 Ga0207645_10016937
859 Ga0207645_10177307
860 Ga0207643_10042739
861 Ga0207643_10077130
862 Ga0207684_10384094
863 Ga0207707_10116355
864 Ga0207693_10265189
865 Ga0207662_10009076
866 Ga0207649_10141182
867 Ga0207646_10449307
868 Ga0207681_10000566
869 Ga0207681_10020173
870 Ga0207681_10314482
871 Ga0207650_10018705
872 Ga0207650_10221565
873 Ga0207650_10344708
874 Ga0207659_10002762
875 Ga0207659_10003108
876 Ga0207659_10020717
877 Ga0207659_10038664
878 Ga0207659_10059612
879 Ga0207659_10081391
880 Ga0207659_10083870
881 Ga0207659_10193314
882 Ga0207644_10047281
883 Ga0207690_10063059
884 Ga0207706_10049318
885 Ga0207706_10049702
886 Ga0207706_10050355
887 Ga0207706_10094679
888 Ga0207686_10003148
889 Ga0207709_10062303
890 Ga0207709_10441900
891 Ga0207670_10202889
892 Ga0207669_10105729
893 Ga0207704_10031753
894 Ga0207704_10288333
895 Ga0207691_10008285
896 Ga0207691_10068031
897 Ga0207691_10078470
898 Ga0207691_10349406
899 Ga0207691_10373327
900 Ga0207691_10424512
901 Ga0207711_10108376
902 Ga0207711_10313138
903 Ga0207689_10005795
904 Ga0207661_10020477
905 Ga0207679_10062568
906 Ga0207679_10116972
907 Ga0207651_10020058
908 Ga0207651_10027555
909 Ga0207651_10260522
910 Ga0207712_10009450
911 Ga0207712_10226305
912 Ga0207668_10321407
913 Ga0207658_10255470
914 Ga0207677_10126569
915 Ga0207703_10089501
916 Ga0207678_10244306
917 Ga0207708_10034870
918 Ga0207708_10061141
919 Ga0207708_10088933
920 Ga0207708_10223248
921 Ga0207641_10091233
922 Ga0207641_10091854
923 Ga0207648_10000093
924 Ga0207648_10000446
925 Ga0207648_10053106
926 Ga0207648_10160251
927 Ga0207676_10016223
928 Ga0207676_10140872
929 Ga0207674_10050425
930 Ga0207674_10682553
931 Ga0207675_100001058
932 Ga0207675_100331895
933 Ga0207683_10047333
934 Ga0207683_10162315
935 Ga0207683_10259687
936 Ga0207683_10330360
937 Ga0207683_10529888
938 Ga0207698_10081986
939 Ga0209813_10005694
940 Ga0209813_10054438
941 Ga0207428_10000224
942 Ga0207428_10000353
943 Ga0207428_10001835
944 Ga0207428_10004706
945 Ga0268266_10200670
946 Ga0268265_10000540
947 Ga0265320_10021010
948 Ga0307408_100552902
949 Ga0316575_10000379
950 Ga0316575_10008564
951 Ga0316575_10012085
952 Ga0316575_10055596
953 Ga0316579_10013095
954 Ga0316579_10037056
955 Ga0316579_10060175
956 Ga0316576_10032404
957 Ga0316576_10035139
958 Ga0316576_10313606
959 Ga0316578_10000571
960 Ga0316578_10027960
961 Ga0316578_10035279
962 Ga0316578_10059292
963 Ga0307405_10020130
964 Ga0307405_10071891
965 Ga0316577_10074878
966 Ga0316577_10155712
967 Ga0307413_10059301
968 Ga0307410_10009560
969 Ga0307407_10016332
970 Ga0307407_10052571
971 Ga0307407_10279336
972 Ga0307412_10010531
973 Ga0307412_10033995
974 Ga0307409_100011842
975 Ga0307416_100115339
976 Ga0307416_100162560
977 Ga0307416_100171326
978 Ga0307416_100176553
979 Ga0307416_100273146
980 Ga0307414_10019076
981 Ga0307411_10030763
982 Ga0307411_10112647
983 Ga0307415_100002028
984 Ga0307415_100009527
985 Ga0307415_100861007
986 Ga0316583_10002748
987 Ga0316583_10009760
988 Ga0316585_10011269
989 Ga0316585_10028778
990 Ga0316585_10034624
991 Ga0316585_10035445
992 Ga0373956_0119238
993 Ga0316574_0000111
994 Ga0316574_0008211
995 Ga0316574_0081091
996 Ga0316574_0107077
997 Ga0316574_0224742
998 Ga0373933_0149501
999 Ga0373947_0272671
1000 Ga0373937_0055238
1001 Ga0316582_0002544
1002 Ga0316582_0023037
1003 Ga0316582_0023791
1004 Ga0316582_0040281
1005 Ga0316582_0095450
1006 Ga0316582_0353758
1007 Ga0316584_0051201
1008 Ga0316584_0077969
1009 Ga0316584_0124144
1010 Ga0316584_0327678
1011 Ga0316584_0352428
1012 Ga0373925_0002431
1013 Ga0373925_0120907
1014 Ga0373925_0617754
1015 Ga0316581_0031379
1016 Ga0400484_14695
1017 Ga0400484_27053
1018 Ga0400490_12009
1019 Ga0400490_38045
1020 Ga0400485_12512
1021 Ga0400488_34107
1022 Ga0400486_16214
1023 Ga0400483_025546
1024 Ga0400489_35601
1025 Ga0400489_55815
1026 Ga0400489_59518
1027 Ga0400487_17402
1028 Ga0436365_0629800
1029 Ga0439439_0029153
1030 Ga0451853_3243712
1031 Ga0450923_008783
1032 Ga0450908_003053
1033 Ga0450908_009613
1034 Ga0439435_0004343
1035 Ga0450918_023788
1036 Ga0451577_0000195
1037 Ga0453684_0000635
1038 Ga0451576_0021675
1039 Ga0451576_0077873
1040 Ga0495629_0159581
1041 Ga0495638_0006670
1042 Ga0495580_0002904
1043 Ga0495580_0091370
1044 Ga0495584_0014394
1045 Ga0495628_0156131
1046 Ga0495642_0006205
1047 Ga0495642_0192668
1048 Ga0495665_0212224
1049 Ga0495598_0054750
1050 Ga0495621_0000539
1051 Ga0495621_0019350
1052 Ga0495645_0003686
1053 Ga0495622_0129124
1054 Ga0495633_0087802
1055 Ga0495656_0033424
1056 Ga0495659_0193734
1057 Ga0495658_0032462
1058 Ga0495658_0050078
1059 Ga0495669_0007590
1060 Ga0495669_0015198
1061 Ga0495669_0197465
1062 Ga0495613_0083142
1063 Ga0495613_0098235
1064 Ga0495670_0007613
1065 Ga0495604_0164068
1066 Ga0495684_0297252
1067 Ga0496102_0437913
1068 Ga0496104_0326978
1069 Ga0496105_0044014
1070 Ga0496109_0026137
1071 Ga0496109_0873911
1072 Ga0496114_0041357
1073 Ga0496114_0187462
1074 Ga0501032_0116247
1075 Ga0501036_0185774
1076 Ga0501038_0153273
1077 Ga0501039_0015829
1078 Ga0501039_0090042
1079 Ga0501039_0172389
1080 Ga0501040_0064480
1081 Ga0501040_0064579
1082 Ga0501041_0127046
1083 Ga0501042_0002376
1084 Ga0501042_0011703
1085 Ga0501046_0016929
1086 Ga0501046_0365340
1087 Ga0501046_0493260
1088 Ga0501048_0014072
1089 Ga0501048_0177608
1090 Ga0501068_0119420
1091 Ga0501070_0508685
1092 Ga0501072_0006039
1093 Ga0501072_0069616
1094 Ga0501072_0340237
1095 Ga0501075_0014812
1096 Ga0501075_0074054
1097 Ga0501075_0172560
1098 Ga0501076_0042575
1099 Ga0501077_0163752
1100 Ga0501077_0234519
1101 Ga0501079_0032104
1102 Ga0501079_0280326
1103 Ga0501080_0439348
1104 Ga0501081_0047448
1105 Ga0501081_0411234
1106 Ga0501035_0380131
1107 Ga0501045_0023711
1108 nmdc:mga00v17_41393_c1
1109 nmdc:mga0k408_10084_c1
1110 nmdc:mga04h51_14746_c1
1111 nmdc:mga04h51_8245_c1
1112 nmdc:mga04h51_8660_c1
1113 nmdc:mga07m45_50616_c1
1114 nmdc:mga07m45_95335_c1
1115 nmdc:mga05p37_1185083_c1
1116 nmdc:mga05p37_221265_c1
1117 nmdc:mga05p37_28799_c1
1118 nmdc:mga05p37_35576_c2
1119 nmdc:mga05p37_41077_c1
1120 nmdc:mga05p37_494104_c1
1121 nmdc:mga05p37_543215_c1
1122 nmdc:mga05p37_637800_c1
1123 nmdc:mga05p37_73718_c1
1124 nmdc:mga05p37_744442_c1
1125 nmdc:mga05p37_86226_c2
1126 nmdc:mga09592_100232_c1
1127 nmdc:mga09592_128189_c1
1128 nmdc:mga09592_18887_c1
1129 nmdc:mga09592_21646_c1
1130 nmdc:mga09592_29197_c1
1131 nmdc:mga09592_343167_c1
1132 nmdc:mga09592_88971_c1
1133 nmdc:mga0qj67_14582_c1
1134 nmdc:mga0qj67_350903_c1
1135 nmdc:mga0qj67_36224_c1
1136 nmdc:mga0qj67_41368_c1
1137 nmdc:mga0qj67_4306_c2
1138 nmdc:mga06r32_13671_c1
1139 nmdc:mga06r32_181496_c1
1140 nmdc:mga06r32_44898_c1
1141 nmdc:mga06r32_481770_c1
1142 nmdc:mga06r32_62556_c1
1143 nmdc:mga06r32_88622_c1
1144 nmdc:mga08y16_164190_c1
1145 nmdc:mga08y16_32226_c1
1146 nmdc:mga08y16_34435_c1
1147 nmdc:mga08y16_34682_c1
1148 nmdc:mga08y16_530076_c1
1149 nmdc:mga08y16_5828_c1
1150 nmdc:mga08y16_6728_c1
1151 nmdc:mga08y16_829056_c1
1152 nmdc:mga0n895_158346_c1
1153 nmdc:mga0n895_237975_c1
1154 nmdc:mga0n895_4485_c1
1155 nmdc:mga0n895_6752_c1
1156 nmdc:mga0rr50_204135_c1
1157 nmdc:mga0rr50_371511_c1
1158 nmdc:mga0a205_134492_c1
1159 nmdc:mga0a205_197113_c1
1160 nmdc:mga0a205_42998_c1
1161 nmdc:mga0a205_44250_c1
1162 nmdc:mga0a205_6501_c1
1163 nmdc:mga0a205_73291_c1
1164 nmdc:mga0a205_808_c1
1165 Ga0495601_0027654
1166 Ga0495601_0046729
1167 Ga0495612_0128878
1168 Ga0495619_0033144
1169 Ga0495619_0176958
1170 Ga0495619_0331042
1171 Ga0501084_0022462
1172 Ga0501084_0067796
1173 Ga0590071_000198
1174 Ga0590071_000207
1175 Ga0590071_001255
1176 Ga0590074_000161
1177 Ga0590074_000467
1178 Ga0590074_014175
1179 Ga0590075_000997
1180 Ga0590075_004629
1181 Ga0590075_012701
1182 Ga0590077_000049
1183 Ga0590077_000317
1184 Ga0590077_002943
1185 Ga0590077_010917
1186 Ga0501082_0006994
1187 Ga0530510_0004934
1188 Ga0530510_0131795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

78

261

0.97

PF01479

S4

S4 domain

22

69

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9766 4 45
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9765 4 45
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9727 56 240
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9652 61 240
7p7q-assembly1.cif.gz_e e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume 0.9588 4 52
ID Description Score Start End Superfamily
af_P02355_88_184_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9763 4 45 3.10.290.10
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9747 66 240 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9665 56 240 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9652 61 240 3.40.50.150
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.942 3 52 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A3E0KKI0-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9858 61 240 GO:0008168
GO:0032259
AF-A0A0H2UQB2-F1-model_v4 Putative hemolysin A 0.9853 72 240 GO:0008168
GO:0032259
AF-A0A7C1B1B0-F1-model_v4 TlyA family RNA methyltransferase 0.9838 66 241 GO:0008168
GO:0032259
AF-A0A0W8G7W9-F1-model_v4 Rna binding methyltransferase ftsj like 0.9819 70 241 GO:0008168
GO:0032259
AF-A0A7Z9ZZR2-F1-model_v4 TlyA family RNA methyltransferase 0.9816 70 240 GO:0008168
GO:0032259

Map