F467282

General Info

Members Datasets Scaffolds Average Seq Length
593 419 1186 169

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0002418|Ga0500636_0002418_3181_3801
Length 206
Sequence LPKRKTGTRFFAQCSGLIRSAALSATGIVACPKKVETMDVTALRALQAPLKDQYRETPDAAVITLKARGELDDQHIACKVETGRAIALAGLHPATGGSGAELCSGDMLLEALVACAGVTLKAVATALEIELKKGTVRAEGDLDFRGTLGVAKDAPVGFKAIRLSFDVETDAPQEKLDTLLKLTERYCVVFQTLNVKPQLSAELRQA

Samples

Sample ID Description Type Environment
1 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
72 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
85 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
86 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
87 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
138 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
165 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
171 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
266 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
267 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
279 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
295 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
296 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
297 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
298 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
301 2508501050 Microvirga lupini Lut6 Isolate Nodule
302 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
303 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
304 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
305 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
306 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
307 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
308 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
309 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
310 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
311 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
312 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
313 2643221733 Bosea sp. Root381 Isolate Unclassified
314 2643221734 Bosea sp. Root670 Isolate Unclassified
315 2643221736 Bosea sp. Root483D1 Isolate Unclassified
316 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
317 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
318 2773857925 Microvirga vignae BR3299 Isolate Unclassified
319 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
320 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
321 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
322 2818991467 Bosea vestrisii 3192 Isolate Unclassified
323 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
324 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
325 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
326 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
327 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
328 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
329 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
330 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
331 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
332 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
333 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
334 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
335 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
336 2841760612 Bosea sp. Tri-49 Isolate Nodule
337 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
338 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
339 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
340 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
341 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
342 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
343 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
344 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
345 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
346 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
347 2844104063 Bosea sp. Tri-39 Isolate Nodule
348 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
349 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
350 2851182111 Bosea sp. Tri-44 Isolate Nodule
351 2851246043 Bosea sp. Tri-54 Isolate Nodule
352 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
353 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
354 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
355 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
356 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
357 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
358 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
359 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
360 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
361 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
362 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
363 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
364 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
365 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
366 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
367 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
368 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
369 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
370 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
371 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
372 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
373 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
374 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
375 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
376 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
377 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
378 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
379 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
380 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
381 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
382 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
383 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
384 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
385 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
386 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
387 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
388 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
389 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
390 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
391 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
392 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
393 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
394 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
395 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
396 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
397 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
398 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
399 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
400 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
401 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
402 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
403 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
404 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
405 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
406 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
407 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
408 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
409 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
410 641522639 Methylobacterium sp. 4-46 Isolate Nodule
411 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
412 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
413 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
414 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
415 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
416 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
417 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
418 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
419 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.43
Metatranscriptomes 0.34
Isolates 20.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.55
Nodule 15.01
Rhizoplane 7.93
Rhizosphere 45.36
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500636_0002418 3300053177 Bacteria 10334
2 JGI25159J45721_1021976 3300002987 Bacteria 1190
3 JGI25151J46595_10000021 3300003187 Bacteria 227826
4 JGI25153J46596_10000133 3300003215 Bacteria 79398
5 JGI25153J46596_10001375 3300003215 Bacteria 14553
6 JGI25153J46596_10015196 3300003215 Bacteria 3152
7 JGI25160J50197_1001189 3300003354 Bacteria 13266
8 Ga0055526_1001254 3300003771 Bacteria 18211
9 Ga0055526_1001771 3300003771 Bacteria 14997
10 Ga0055524_1000011 3300003775 Bacteria 261442
11 Ga0065165_1000150 3300005262 Bacteria 121992
12 Ga0065165_1053766 3300005262 Bacteria 1132
13 Ga0070658_10811070 3300005327 Bacteria 813
14 Ga0070670_100075398 3300005331 Bacteria 2898
15 Ga0068868_100003650 3300005338 Bacteria 10741
16 Ga0070660_100492174 3300005339 Bacteria 1020
17 Ga0070689_100000018 3300005340 Bacteria 153256
18 Ga0070668_100464360 3300005347 Bacteria 1091
19 Ga0070668_100516691 3300005347 Bacteria 1036
20 Ga0070675_100083801 3300005354 Bacteria 2662
21 Ga0070675_100128215 3300005354 Bacteria 2160
22 Ga0070675_100298987 3300005354 Bacteria 1418
23 Ga0070675_100299578 3300005354 Bacteria 1416
24 Ga0070671_100015653 3300005355 Bacteria 6129
25 Ga0070671_100141019 3300005355 Unclassified 2034
26 Ga0070673_100090930 3300005364 Bacteria 2494
27 Ga0070688_100122177 3300005365 Bacteria 1746
28 Ga0070659_100994064 3300005366 Bacteria 736
29 Ga0070709_10018422 3300005434 Bacteria 4021
30 Ga0070714_100017599 3300005435 Bacteria 5792
31 Ga0070713_100018232 3300005436 Bacteria 5333
32 Ga0070713_100251505 3300005436 Bacteria 1612
33 Ga0070710_10083796 3300005437 Unclassified 1867
34 Ga0070705_100417546 3300005440 Bacteria 998
35 Ga0070700_100812870 3300005441 Bacteria 754
36 Ga0070694_100728250 3300005444 Bacteria 808
37 Ga0070663_100096378 3300005455 Bacteria 2200
38 Ga0070663_100234570 3300005455 Bacteria 1446
39 Ga0070678_100745913 3300005456 Bacteria 885
40 Ga0070678_101010449 3300005456 Bacteria 765
41 Ga0068867_100044224 3300005459 Bacteria 3262
42 Ga0068867_101540674 3300005459 Bacteria 620
43 Ga0070685_10013703 3300005466 Bacteria 4283
44 Ga0070684_100273139 3300005535 Bacteria 1548
45 Ga0070684_100424240 3300005535 Bacteria 1228
46 Ga0070672_100216621 3300005543 Bacteria 1605
47 Ga0070672_100416870 3300005543 Bacteria 1153
48 Ga0070686_100030101 3300005544 Bacteria 3308
49 Ga0070696_100008909 3300005546 Bacteria 6717
50 Ga0070693_100624624 3300005547 Bacteria 781
51 Ga0070665_100027310 3300005548 Bacteria 5749
52 Ga0070704_100024848 3300005549 Bacteria 3936
53 Ga0068856_100227664 3300005614 Bacteria 1880
54 Ga0068856_100294832 3300005614 Unclassified 1639
55 Ga0070702_100141784 3300005615 Bacteria 1531
56 Ga0068852_100076609 3300005616 Bacteria 2953
57 Ga0068859_100362045 3300005617 Bacteria 1545
58 Ga0068864_101191853 3300005618 Bacteria 760
59 Ga0068866_10209299 3300005718 Bacteria 1170
60 Ga0068863_100407461 3300005841 Bacteria 1331
61 Ga0068863_101461066 3300005841 Bacteria 692
62 Ga0068858_101139955 3300005842 Bacteria 766
63 Ga0068860_100400687 3300005843 Bacteria 1357
64 Ga0068860_100926396 3300005843 Bacteria 888
65 Ga0068862_100004007 3300005844 Bacteria 12490
66 Ga0068862_100365703 3300005844 Bacteria 1341
67 Ga0081455_10043443 3300005937 Bacteria 3930
68 Ga0081455_10124402 3300005937 Bacteria 2026
69 Ga0081540_1081219 3300005983 Bacteria 1459
70 Ga0070717_10005153 3300006028 Bacteria 9528
71 Ga0075365_10017968 3300006038 Bacteria 4339
72 Ga0075365_10027319 3300006038 Bacteria 3630
73 Ga0075365_10164656 3300006038 Bacteria 1546
74 Ga0075365_10405718 3300006038 Bacteria 962
75 Ga0075365_11004602 3300006038 Bacteria 588
76 Ga0075368_10318850 3300006042 Bacteria 673
77 Ga0075364_10133114 3300006051 Bacteria 1669
78 Ga0075364_10490732 3300006051 Bacteria 840
79 Ga0070716_100121943 3300006173 Unclassified 1633
80 Ga0070716_100231711 3300006173 Bacteria 1247
81 Ga0075362_10257900 3300006177 Bacteria 858
82 Ga0075369_10061400 3300006186 Bacteria 1640
83 Ga0075369_10077135 3300006186 Bacteria 1474
84 Ga0075366_10054826 3300006195 Bacteria 2367
85 Ga0075366_10091254 3300006195 Bacteria 1825
86 Ga0097621_100085078 3300006237 Bacteria 2637
87 Ga0097621_100335347 3300006237 Bacteria 1342
88 Ga0075370_10052635 3300006353 Bacteria 2310
89 Ga0075370_10247437 3300006353 Bacteria 1056
90 Ga0068871_100021632 3300006358 Bacteria 4947
91 Ga0075434_100011878 3300006871 Bacteria 8233
92 Ga0075434_100339422 3300006871 Bacteria 1523
93 Ga0097620_100362038 3300006931 Bacteria 1545
94 Ga0099823_1013263 3300006944 Bacteria 8300
95 Ga0105240_10009401 3300009093 Bacteria 13842
96 Ga0105240_10076360 3300009093 Bacteria 4130
97 Ga0105240_10077368 3300009093 Bacteria 4098
98 Ga0105240_10430678 3300009093 Bacteria 1480
99 Ga0105240_10670205 3300009093 Bacteria 1135
100 Ga0105247_10160516 3300009101 Bacteria 1488
101 Ga0105247_10786876 3300009101 Bacteria 724
102 Ga0105241_10131101 3300009174 Bacteria 2030
103 Ga0105241_10187922 3300009174 Bacteria 1718
104 Ga0105248_10806788 3300009177 Bacteria 1059
105 Ga0105237_10133511 3300009545 Bacteria 2477
106 Ga0105249_10014538 3300009553 Bacteria 6958
107 Ga0105249_10914868 3300009553 Bacteria 944
108 Ga0105239_10079271 3300010375 Bacteria 3614
109 Ga0105239_10367297 3300010375 Bacteria 1626
110 Ga0157314_1014240 3300012500 Bacteria 738
111 Ga0171462_1015 3300013250 Bacteria 169578
112 Ga0157374_10203265 3300013296 Bacteria 1940
113 Ga0157374_10848455 3300013296 Bacteria 930
114 Ga0157378_10274569 3300013297 Bacteria 1622
115 Ga0163162_10927960 3300013306 Bacteria 982
116 Ga0157372_11862187 3300013307 Bacteria 692
117 Ga0157375_12225208 3300013308 Bacteria 653
118 Ga0163163_10004923 3300014325 Bacteria 11488
119 Ga0163163_10047869 3300014325 Bacteria 4203
120 Ga0163163_10308330 3300014325 Bacteria 1635
121 Ga0163163_10733616 3300014325 Bacteria 1051
122 Ga0157380_10019928 3300014326 Bacteria 5005
123 Ga0182008_10534830 3300014497 Bacteria 649
124 Ga0157379_10170305 3300014968 Bacteria 1966
125 Ga0157379_10252918 3300014968 Bacteria 1600
126 Ga0163161_10552857 3300017792 Bacteria 944
127 Ga0163161_11383257 3300017792 Bacteria 614
128 Ga0206354_10108602 3300020081 Bacteria 1158
129 Ga0206354_10359821 3300020081 Bacteria 631
130 Ga0214544_1000003 3300021320 Bacteria 643752
131 Ga0214542_1000003 3300021321 Bacteria 435700
132 Ga0214545_1000004 3300021324 Bacteria 453352
133 Ga0214543_1000007 3300021327 Bacteria 414744
134 Ga0213874_10002498 3300021377 Bacteria 3969
135 Ga0213876_10007769 3300021384 Bacteria 5821
136 Ga0213876_10009062 3300021384 Bacteria 5359
137 Ga0213876_10029125 3300021384 Bacteria 2911
138 Ga0213875_10021992 3300021388 Bacteria 3052
139 Ga0213875_10076933 3300021388 Bacteria 1557
140 Ga0213875_10377973 3300021388 Bacteria 674
141 Ga0209233_1021879 3300025261 Bacteria 1646
142 Ga0209673_1049107 3300025273 Bacteria 1130
143 Ga0209130_1000187 3300025284 Bacteria 87082
144 Ga0209675_1005741 3300025291 Bacteria 5121
145 Ga0209025_1000010 3300025294 Bacteria 986612
146 Ga0209025_1003913 3300025294 Bacteria 13420
147 Ga0209025_1062867 3300025294 Bacteria 1374
148 Ga0209025_1070283 3300025294 Bacteria 1247
149 Ga0209564_1000019 3300025295 Bacteria 573686
150 Ga0209564_1000369 3300025295 Bacteria 83878
151 Ga0209758_1000005 3300025297 Bacteria 1368918
152 Ga0209758_1002632 3300025297 Bacteria 17829
153 Ga0209758_1016086 3300025297 Bacteria 3822
154 Ga0209758_1039208 3300025297 Bacteria 1804
155 Ga0209758_1078121 3300025297 Bacteria 1012
156 Ga0209050_1019524 3300025298 Bacteria 2569
157 Ga0209050_1064198 3300025298 Bacteria 852
158 Ga0209256_1000317 3300025299 Bacteria 83179
159 Ga0209256_1050348 3300025299 Bacteria 1010
160 Ga0207426_1000201 3300025302 Bacteria 143975
161 Ga0207426_1011144 3300025302 Bacteria 3444
162 Ga0207426_1018295 3300025302 Bacteria 2472
163 Ga0209257_1000391 3300025304 Bacteria 87258
164 Ga0209257_1065298 3300025304 Bacteria 976
165 Ga0207692_10081313 3300025898 Unclassified 1733
166 Ga0207692_10628966 3300025898 Bacteria 692
167 Ga0207680_10198228 3300025903 Bacteria 1367
168 Ga0207699_10115358 3300025906 Unclassified 1728
169 Ga0207654_10044547 3300025911 Bacteria 2521
170 Ga0207695_10000065 3300025913 Bacteria 336949
171 Ga0207695_10055253 3300025913 Bacteria 4139
172 Ga0207695_10414864 3300025913 Bacteria 1231
173 Ga0207671_10017405 3300025914 Bacteria 5543
174 Ga0207662_10112981 3300025918 Bacteria 1695
175 Ga0207657_10185324 3300025919 Bacteria 1681
176 Ga0207652_10104076 3300025921 Bacteria 2510
177 Ga0207650_10095627 3300025925 Bacteria 2277
178 Ga0207650_10836010 3300025925 Bacteria 781
179 Ga0207659_10159977 3300025926 Bacteria 1767
180 Ga0207659_10263559 3300025926 Bacteria 1403
181 Ga0207700_10040741 3300025928 Bacteria 3392
182 Ga0207664_10028898 3300025929 Bacteria 4218
183 Ga0207644_10052406 3300025931 Bacteria 2932
184 Ga0207644_10538122 3300025931 Unclassified 966
185 Ga0207644_10656374 3300025931 Bacteria 873
186 Ga0207706_10237822 3300025933 Bacteria 1592
187 Ga0207670_10000001 3300025936 Bacteria 949312
188 Ga0207670_10026049 3300025936 Bacteria 3681
189 Ga0207665_10136391 3300025939 Unclassified 1746
190 Ga0207665_10405791 3300025939 Bacteria 1038
191 Ga0207691_10005607 3300025940 Bacteria 12133
192 Ga0207691_10129493 3300025940 Bacteria 2230
193 Ga0207679_11454512 3300025945 Bacteria 629
194 Ga0207667_10753042 3300025949 Bacteria 973
195 Ga0207651_10000751 3300025960 Bacteria 13926
196 Ga0207651_10121773 3300025960 Bacteria 1980
197 Ga0207651_10212262 3300025960 Bacteria 1559
198 Ga0207712_10007361 3300025961 Bacteria 6949
199 Ga0207712_11364006 3300025961 Bacteria 634
200 Ga0207668_10411807 3300025972 Bacteria 1145
201 Ga0207668_11362324 3300025972 Bacteria 639
202 Ga0207640_10813913 3300025981 Bacteria 810
203 Ga0207658_10039079 3300025986 Bacteria 3423
204 Ga0207677_10004986 3300026023 Bacteria 7167
205 Ga0207678_10744374 3300026067 Bacteria 864
206 Ga0207708_10244255 3300026075 Bacteria 1445
207 Ga0207708_10409273 3300026075 Bacteria 1123
208 Ga0207708_11100282 3300026075 Bacteria 693
209 Ga0207702_10250907 3300026078 Bacteria 1662
210 Ga0207702_10490535 3300026078 Bacteria 1197
211 Ga0207641_11541881 3300026088 Bacteria 666
212 Ga0207648_10031123 3300026089 Bacteria 4719
213 Ga0207648_10316570 3300026089 Bacteria 1402
214 Ga0207648_11460127 3300026089 Bacteria 643
215 Ga0207676_10167880 3300026095 Bacteria 1909
216 Ga0207683_10054965 3300026121 Bacteria 3491
217 Ga0207683_10246280 3300026121 Bacteria 1631
218 Ga0207698_10104979 3300026142 Bacteria 2353
219 Ga0209389_1010635 3300027296 Bacteria 8306
220 Ga0209489_112010 3300027361 Bacteria 8306
221 Ga0209700_110939 3300027363 Bacteria 8919
222 Ga0207428_10035875 3300027907 Bacteria 4050
223 Ga0268266_10006781 3300028379 Bacteria 10439
224 Ga0268265_11749033 3300028380 Bacteria 628
225 Ga0265318_10067478 3300028577 Bacteria 1328
226 Ga0307515_10178960 3300028794 Bacteria 2079
227 Ga0265320_10269587 3300031240 Bacteria 754
228 Ga0307513_10036871 3300031456 Bacteria 5447
229 Ga0307513_10129247 3300031456 Bacteria 2475
230 Ga0307408_100052585 3300031548 Bacteria 2938
231 Ga0307408_100225750 3300031548 Bacteria 1531
232 Ga0307508_10082799 3300031616 Bacteria 2791
233 Ga0307406_10141603 3300031901 Bacteria 1703
234 Ga0307406_10324944 3300031901 Bacteria 1192
235 Ga0307412_10212845 3300031911 Bacteria 1476
236 Ga0307409_101744072 3300031995 Bacteria 651
237 Ga0307416_100878294 3300032002 Bacteria 996
238 Ga0307416_102132942 3300032002 Bacteria 662
239 Ga0307415_100643481 3300032126 Bacteria 949
240 Ga0307415_101320184 3300032126 Bacteria 684
241 Ga0307510_10016772 3300033180 Bacteria 8640
242 Ga0307510_10070055 3300033180 Bacteria 3506
243 Ga0373957_0079320 3300035120 Bacteria 1294
244 Ga0373946_0030522 3300035171 Bacteria 2152
245 Ga0373955_0110620 3300035172 Bacteria 1588
246 Ga0373931_0472589 3300035691 Bacteria 805
247 Ga0373933_0120135 3300035724 Bacteria 1645
248 Ga0373933_0526077 3300035724 Bacteria 775
249 Ga0373937_0197415 3300036401 Bacteria 1891
250 Ga0373925_0268148 3300037068 Bacteria 1373
251 Ga0373925_0898809 3300037068 Bacteria 730
252 Ga0395898_1118688 3300037466 Bacteria 720
253 Ga0395905_0081569 3300037471 Bacteria 3031
254 Ga0436364_0197909 3300037853 Bacteria 872
255 Ga0436364_0497276 3300037853 Bacteria 1333
256 Ga0436364_0532601 3300037853 Bacteria 664
257 Ga0436364_1099918 3300037853 Bacteria 3218
258 Ga0237819_26476 3300038705 Bacteria 540
259 Ga0237816_00722 3300039145 Bacteria 2784
260 Ga0436365_0088001 3300039437 Bacteria 1551
261 Ga0436365_0277390 3300039437 Bacteria 3720
262 Ga0436365_0678611 3300039437 Bacteria 2527
263 Ga0436365_1886658 3300039437 Bacteria 26869
264 Ga0436360_0652803 3300039438 Bacteria 5557
265 Ga0436361_0425765 3300039447 Bacteria 1311
266 Ga0436361_0500698 3300039447 Bacteria 1074
267 Ga0436361_1079383 3300039447 Bacteria 2820
268 Ga0436363_0699892 3300039450 Bacteria 10776
269 Ga0436363_0700629 3300039450 Bacteria 1028
270 Ga0436363_1011916 3300039450 Bacteria 2000
271 Ga0451843_1323642 3300041509 Bacteria 1277
272 Ga0450900_028879 3300042136 Bacteria 800
273 Ga0466972_0072916 3300044658 Bacteria 1637
274 Ga0466968_0053024 3300044735 Bacteria 1736
275 Ga0466968_0066967 3300044735 Bacteria 1556
276 Ga0466960_0200173 3300044901 Bacteria 1091
277 Ga0466960_0391389 3300044901 Bacteria 799
278 Ga0466960_0465994 3300044901 Bacteria 736
279 Ga0466967_0282371 3300045976 Bacteria 1593
280 Ga0495592_0538314 3300046454 Bacteria 720
281 Ga0495603_0123288 3300046455 Bacteria 1510
282 Ga0495638_0001760 3300046460 Bacteria 18968
283 Ga0495638_0361783 3300046460 Bacteria 763
284 Ga0495651_0001917 3300046462 Bacteria 16106
285 Ga0495605_0148332 3300046474 Bacteria 1048
286 Ga0495639_0048418 3300046475 Bacteria 1927
287 Ga0495664_0011217 3300046477 Bacteria 5047
288 Ga0495594_0228874 3300046499 Bacteria 1060
289 Ga0495583_0230360 3300046506 Bacteria 747
290 Ga0495606_0375969 3300046507 Bacteria 746
291 Ga0495620_0138662 3300046515 Bacteria 952
292 Ga0495628_0103487 3300046516 Bacteria 2195
293 Ga0495643_0050420 3300046522 Bacteria 2242
294 Ga0495652_0025465 3300046529 Bacteria 5233
295 Ga0495652_0514286 3300046529 Bacteria 828
296 Ga0495640_0011710 3300046533 Bacteria 6735
297 Ga0495640_0376595 3300046533 Bacteria 874
298 Ga0495587_0009486 3300046536 Bacteria 6236
299 Ga0495598_0314227 3300046537 Bacteria 595
300 Ga0495609_0058978 3300046538 Bacteria 1697
301 Ga0495645_0037519 3300046543 Bacteria 3533
302 Ga0495622_0079208 3300046557 Bacteria 1512
303 Ga0495667_0009591 3300046559 Bacteria 6564
304 Ga0495634_0042998 3300046642 Bacteria 3063
305 Ga0495634_0065794 3300046642 Bacteria 2401
306 Ga0495625_0071460 3300046660 Bacteria 2435
307 Ga0495635_0001881 3300046663 Bacteria 14234
308 Ga0495635_0099874 3300046663 Bacteria 1983
309 Ga0495661_0168011 3300046665 Bacteria 1172
310 Ga0495661_0419745 3300046665 Bacteria 648
311 Ga0495588_0075640 3300046674 Bacteria 1754
312 Ga0495588_0082234 3300046674 Bacteria 1682
313 Ga0495657_0004727 3300046675 Bacteria 10849
314 Ga0495599_0011007 3300046678 Bacteria 5551
315 Ga0495623_0022868 3300046679 Bacteria 4036
316 Ga0495613_0027850 3300046689 Bacteria 4206
317 Ga0495624_0022395 3300046690 Bacteria 4176
318 Ga0495600_0004439 3300046809 Bacteria 8392
319 Ga0495600_0007347 3300046809 Bacteria 6734
320 Ga0495581_0063802 3300047315 Bacteria 2128
321 Ga0495581_0174984 3300047315 Bacteria 1255
322 Ga0495604_0002141 3300047317 Bacteria 15889
323 Ga0495604_0026793 3300047317 Bacteria 4587
324 Ga0495674_0018376 3300047319 Bacteria 6508
325 Ga0495676_0049909 3300047321 Bacteria 3360
326 Ga0495680_0019780 3300047322 Bacteria 5678
327 Ga0495683_0244379 3300047323 Bacteria 790
328 Ga0495675_0027393 3300047444 Bacteria 3630
329 Ga0495686_0020180 3300047472 Bacteria 4446
330 Ga0495686_0634721 3300047472 Bacteria 550
331 Ga0495602_0074836 3300048088 Bacteria 2876
332 Ga0496100_0134242 3300048903 Bacteria 1747
333 Ga0496100_0152731 3300048903 Bacteria 1649
334 Ga0496100_0494916 3300048903 Bacteria 941
335 Ga0496101_0131222 3300048904 Bacteria 1903
336 Ga0496101_0272801 3300048904 Bacteria 1321
337 Ga0496101_0428910 3300048904 Bacteria 1042
338 Ga0496101_0667172 3300048904 Bacteria 821
339 Ga0496102_0070802 3300048905 Bacteria 3202
340 Ga0496104_0006361 3300048907 Bacteria 10389
341 Ga0496104_0021759 3300048907 Bacteria 5889
342 Ga0496104_0022524 3300048907 Bacteria 5787
343 Ga0496104_0251380 3300048907 Bacteria 1680
344 Ga0496104_0361991 3300048907 Unclassified 1363
345 Ga0496104_0398200 3300048907 Bacteria 1289
346 Ga0496104_0632394 3300048907 Bacteria 979
347 Ga0496105_0005021 3300048908 Bacteria 10018
348 Ga0496105_0147028 3300048908 Bacteria 1938
349 Ga0496105_0191474 3300048908 Unclassified 1672
350 Ga0496106_0059587 3300048909 Bacteria 2892
351 Ga0496106_0230376 3300048909 Bacteria 1479
352 Ga0496106_0549762 3300048909 Bacteria 926
353 Ga0496107_0173502 3300048910 Bacteria 1600
354 Ga0496107_0354899 3300048910 Unclassified 1091
355 Ga0496108_0010916 3300048911 Bacteria 7375
356 Ga0496108_0071778 3300048911 Bacteria 2922
357 Ga0496108_0573538 3300048911 Bacteria 984
358 Ga0496108_0588931 3300048911 Bacteria 969
359 Ga0496108_0780298 3300048911 Bacteria 825
360 Ga0496109_0001443 3300048912 Bacteria 19754
361 Ga0496110_0024131 3300048913 Bacteria 5180
362 Ga0496110_0228404 3300048913 Bacteria 1692
363 Ga0496110_0419356 3300048913 Bacteria 1220
364 Ga0496110_1133173 3300048913 Bacteria 691
365 Ga0496111_0436011 3300048914 Bacteria 967
366 Ga0496112_0001558 3300048915 Bacteria 17713
367 Ga0496112_1010461 3300048915 Bacteria 751
368 Ga0496113_0001483 3300048916 Bacteria 13114
369 Ga0496113_0010571 3300048916 Bacteria 6107
370 Ga0496113_0280507 3300048916 Bacteria 1332
371 Ga0496114_0000290 3300048917 Bacteria 36753
372 Ga0496114_0440600 3300048917 Bacteria 1154
373 Ga0496114_0949437 3300048917 Bacteria 742
374 Ga0496114_1298827 3300048917 Bacteria 614
375 Ga0496115_0003155 3300048918 Bacteria 11852
376 Ga0496115_0019865 3300048918 Bacteria 5176
377 Ga0496115_0057623 3300048918 Bacteria 3125
378 Ga0496115_0639186 3300048918 Bacteria 842
379 Ga0496116_0273267 3300048919 Bacteria 824
380 Ga0496117_0235143 3300048920 Bacteria 1010
381 Ga0496118_0175217 3300048921 Bacteria 1304
382 Ga0496119_0022738 3300048922 Bacteria 4476
383 Ga0496120_0036896 3300048923 Bacteria 2904
384 Ga0496121_0051244 3300048924 Bacteria 3478
385 Ga0496122_0007615 3300048925 Bacteria 11968
386 Ga0496122_0100923 3300048925 Bacteria 1929
387 Ga0496122_0278299 3300048925 Bacteria 916
388 Ga0496123_0055689 3300048926 Bacteria 2591
389 Ga0496124_0082577 3300048927 Bacteria 2637
390 Ga0496124_0087867 3300048927 Bacteria 2542
391 Ga0496125_0082641 3300048928 Bacteria 2447
392 Ga0496125_0105615 3300048928 Bacteria 2058
393 Ga0496126_0031654 3300048929 Bacteria 4992
394 Ga0496126_0111250 3300048929 Bacteria 2385
395 Ga0496126_0302353 3300048929 Bacteria 1319
396 Ga0496126_0853138 3300048929 Bacteria 694
397 Ga0501031_0198575 3300049568 Bacteria 1309
398 Ga0501037_0022439 3300049573 Bacteria 4669
399 Ga0501038_0553451 3300049574 Bacteria 874
400 Ga0501039_0119308 3300049575 Bacteria 2066
401 Ga0501040_0140528 3300049576 Bacteria 1701
402 Ga0501042_0069013 3300049578 Bacteria 2528
403 Ga0501046_0024593 3300049580 Bacteria 4939
404 Ga0501048_0247788 3300049582 Bacteria 1264
405 Ga0501070_0803033 3300049586 Bacteria 739
406 Ga0501075_0226169 3300049591 Bacteria 1427
407 Ga0501076_0154250 3300049592 Bacteria 1869
408 Ga0501044_0642380 3300049823 Bacteria 951
409 Ga0501045_0040032 3300049824 Bacteria 3410
410 nmdc:mga03n38_249516_c1 3300050490 Bacteria 937
411 nmdc:mga00v17_27926_c1 3300050491 Bacteria 3299
412 nmdc:mga00v17_349596_c1 3300050491 Bacteria 961
413 nmdc:mga0yw44_147163_c1 3300050492 Bacteria 1534
414 nmdc:mga0yw44_26350_c1 3300050492 Bacteria 3320
415 nmdc:mga0yw44_44148_c1 3300050492 Bacteria 2665
416 nmdc:mga07m45_53861_c1 3300050496 Bacteria 2274
417 nmdc:mga07m45_78980_c1 3300050496 Bacteria 1878
418 nmdc:mga0qj67_1105113_c1 3300050509 Bacteria 619
419 nmdc:mga08y16_66783_c1 3300050511 Bacteria 3754
420 nmdc:mga0n895_18008_c1 3300050512 Bacteria 6528
421 nmdc:mga08x19_95333_c1 3300050514 Bacteria 1968
422 nmdc:mga0sz30_102683_c1 3300050516 Bacteria 1250
423 nmdc:mga0sz30_135110_c1 3300050516 Bacteria 1088
424 nmdc:mga0sz30_44043_c1 3300050516 Bacteria 1879
425 nmdc:mga0sz30_86805_c1 3300050516 Bacteria 1358
426 Ga0500610_0142079 3300053079 Bacteria 1211
427 Ga0500578_0087490 3300053086 Bacteria 1979
428 Ga0500643_000163 3300053087 Bacteria 66676
429 Ga0500644_0225983 3300053088 Bacteria 782
430 Ga0500646_0026278 3300053090 Bacteria 1577
431 Ga0500651_0413484 3300053093 Bacteria 756
432 Ga0500566_0000224 3300053094 Bacteria 30350
433 Ga0500566_0096883 3300053094 Bacteria 1623
434 Ga0500641_0002734 3300053096 Bacteria 6227
435 Ga0500641_0016388 3300053096 Bacteria 2760
436 Ga0500650_0045589 3300053098 Bacteria 2031
437 Ga0500650_0112302 3300053098 Bacteria 1272
438 Ga0500650_0118657 3300053098 Bacteria 1234
439 Ga0500554_053541 3300053102 Bacteria 1277
440 Ga0500555_001084 3300053103 Bacteria 9093
441 Ga0500556_0027049 3300053104 Bacteria 1911
442 Ga0500562_110308 3300053108 Bacteria 750
443 Ga0500569_164298 3300053109 Bacteria 752
444 Ga0500572_042735 3300053111 Bacteria 1322
445 Ga0500594_0036703 3300053118 Bacteria 1320
446 Ga0500595_005537 3300053119 Bacteria 5504
447 Ga0500595_040507 3300053119 Bacteria 1502
448 Ga0500608_046197 3300053122 Bacteria 2092
449 Ga0500642_0007538 3300053130 Bacteria 3665
450 Ga0500642_0008075 3300053130 Bacteria 3578
451 Ga0500559_0063420 3300053136 Bacteria 1651
452 Ga0500564_034892 3300053138 Bacteria 2322
453 Ga0500568_0053420 3300053139 Bacteria 1583
454 Ga0500577_0206153 3300053142 Bacteria 849
455 Ga0500588_0001796 3300053146 Bacteria 4178
456 Ga0500588_0008929 3300053146 Bacteria 2362
457 Ga0500588_0021991 3300053146 Bacteria 1730
458 Ga0500590_107781 3300053148 Bacteria 1327
459 Ga0500604_0003195 3300053151 Bacteria 4404
460 Ga0500604_0045994 3300053151 Bacteria 1333
461 Ga0500616_0000705 3300053153 Bacteria 38798
462 Ga0500616_0060070 3300053153 Bacteria 1972
463 Ga0500619_056515 3300053154 Bacteria 1282
464 Ga0500622_0022826 3300053156 Bacteria 3313
465 Ga0500624_074124 3300053157 Bacteria 670
466 Ga0500633_0062579 3300053160 Bacteria 1312
467 Ga0500636_0000330 3300053177 Bacteria 26259
468 Ga0500609_000476 3300053731 Bacteria 5969
469 Ga0500609_001275 3300053731 Bacteria 3727
470 Ga0500609_011550 3300053731 Bacteria 1193
471 Ga0500599_012579 3300053736 Bacteria 1138
472 Ga0500601_001460 3300053737 Bacteria 2595
473 Ga0501084_0073475 3300054114 Bacteria 2864
474 2507504937 2507262055 Bacteria 8048963
475 2508727602 2508501050 Bacteria 9633614
476 2509077487 2508501114 Bacteria 7082538
477 2511401386 2511231028 Bacteria 8046582
478 2513623374 2513237092 Bacteria 8341956
479 2513873818 2513237139 Bacteria 8737671
480 2514015340 2513237161 Bacteria 8871253
481 2517102292 2517093001 Bacteria 9002274
482 2528851958 2528768022 Bacteria 10457665
483 2545678069 2545555834 Bacteria 8130841
484 2596373538 2595698237 Bacteria 6712432
485 2617351799 2617270735 Bacteria 9163226
486 2617374026 2617270741 Bacteria 8201522
487 2644730869 2643221733 Bacteria 5690728
488 2644736032 2643221734 Bacteria 5365412
489 2644742586 2643221736 Bacteria 6608466
490 2738745530 2738541281 Bacteria 5112672
491 2739354760 2738543032 Bacteria 5115625
492 2774868728 2773857925 Bacteria 6472445
493 2776258335 2775506901 Bacteria 9631051
494 2793063020 2791355196 Bacteria 7323613
495 2805915901 2802429603 Bacteria 8777136
496 2819722087 2818991467 Bacteria 5893227
497 2824670084 2824661429 Bacteria 9877870
498 2824679108 2824671348 Bacteria 8369588
499 2824695718 2824687955 Bacteria 8360029
500 2824701633 2824696289 Bacteria 8335049
501 2824713651 2824704595 Bacteria 9667483
502 2824739262 2824732956 Bacteria 7810675
503 2824748925 2824746037 Bacteria 7911610
504 2824760561 2824753945 Bacteria 9787441
505 2824771025 2824763712 Bacteria 9792355
506 2824774844 2824773399 Bacteria 8360218
507 2829750703 2829745981 Bacteria 5406054
508 2835318528 2835312727 Bacteria 7413381
509 2838124215 2838122688 Bacteria 8803140
510 2841763991 2841760612 Bacteria 6454112
511 2841915525 2841911363 Bacteria 6173697
512 2841920727 2841917233 Bacteria 6173500
513 2841944561 2841941048 Bacteria 8688029
514 2841951699 2841949485 Bacteria 8680857
515 2841964840 2841957949 Bacteria 8652217
516 2841969339 2841966195 Bacteria 8673214
517 2841980264 2841974524 Bacteria 8931498
518 2841985514 2841983080 Bacteria 8395090
519 2842043786 2842038055 Bacteria 8002051
520 2842052224 2842045827 Bacteria 8006841
521 2844108554 2844104063 Bacteria 6440972
522 2844321915 2844315083 Bacteria 8138177
523 2847941852 2847939898 Bacteria 8606328
524 2851185234 2851182111 Bacteria 6047226
525 2851250426 2851246043 Bacteria 6439203
526 2861695916 2861691609 Bacteria 5628931
527 2874618479 2874612657 Bacteria 8252029
528 2874624508 2874620515 Bacteria 8290088
529 2874629128 2874628541 Bacteria 8630250
530 2879107321 2879099564 Bacteria 10442239
531 2882457563 2882456835 Bacteria 6863978
532 2884301344 2884298095 Bacteria 3823049
533 2889311485 2889306138 Bacteria 6358934
534 2894235974 2894232714 Bacteria 8834183
535 2902411663 2902405164 Bacteria 6784948
536 2903727537 2903727486 Bacteria 8281579
537 2904672153 2904666416 Bacteria 8226587
538 2904718166 2904711408 Bacteria 9771557
539 2906602973 2906602504 Bacteria 8295279
540 2908776503 2908775508 Bacteria 8092255
541 2917701902 2917699015 Bacteria 7043791
542 2928128570 2928125067 Bacteria 5937560
543 2929623800 2929615660 Bacteria 9193770
544 2929629031 2929624759 Bacteria 9339455
545 2932786443 2932784394 Bacteria 9704911
546 2932812483 2932809354 Bacteria 9135765
547 2932822845 2932818245 Bacteria 9955613
548 2932829680 2932828146 Bacteria 9745859
549 2933585679 2933577622 Bacteria 9116884
550 2935618200 2935616580 Bacteria 9032984
551 2935641404 2935638405 Bacteria 10015038
552 2935652897 2935648319 Bacteria 8801166
553 2935661480 2935656913 Bacteria 8965014
554 2935669538 2935665750 Bacteria 9571747
555 2935677864 2935675223 Bacteria 9928132
556 2935689687 2935684952 Bacteria 9590419
557 2935698225 2935694250 Bacteria 9291695
558 2935707363 2935703347 Bacteria 10242284
559 2935717207 2935713505 Bacteria 9608509
560 2935724124 2935722832 Bacteria 9608746
561 2935738622 2935732158 Bacteria 9706831
562 2935749130 2935741537 Bacteria 9707219
563 2935757041 2935750917 Bacteria 9590372
564 2935764348 2935760218 Bacteria 9817913
565 2935804258 2935801545 Bacteria 9301974
566 2935831135 2935827899 Bacteria 10038562
567 2935841744 2935837841 Bacteria 9454360
568 2935856301 2935855204 Bacteria 9035059
569 2935866367 2935864058 Bacteria 9784707
570 2935874674 2935873716 Bacteria 9632195
571 2935962368 2935959822 Bacteria 7869783
572 2935984878 2935984226 Bacteria 8302647
573 2935994132 2935992306 Bacteria 9802711
574 2936004857 2936002035 Bacteria 9362176
575 2936015791 2936011229 Bacteria 8801034
576 2936024425 2936019824 Bacteria 8804134
577 2936031688 2936028420 Bacteria 8965941
578 2936051510 2936046547 Bacteria 8903709
579 2936056049 2936055302 Bacteria 8785755
580 2940562955 2940556831 Bacteria 9590747
581 2941543817 2941538514 Bacteria 9402094
582 3003666943 3003665799 Bacteria 7279786
583 3005725037 3005718088 Bacteria 8283608
584 641642416 641522639 Bacteria 7737025
585 643598895 643348564 Bacteria 8839022
586 8006932777 8006926726 Bacteria 6749210
587 8016635985 8016630954 Bacteria 9217207
588 8017058142 8017057580 Bacteria 10023680
589 8019595680 8019586578 Bacteria 10212056
590 8019612450 8019608314 Bacteria 10042931
591 8019652782 8019648815 Bacteria 10014479
592 8055751101 8055742211 Bacteria 9226248
593 8057534084 8057529695 Bacteria 6306553
594 Ga0500636_0002418
595 JGI25159J45721_1021976
596 JGI25151J46595_10000021
597 JGI25153J46596_10000133
598 JGI25153J46596_10001375
599 JGI25153J46596_10015196
600 JGI25160J50197_1001189
601 Ga0055526_1001254
602 Ga0055526_1001771
603 Ga0055524_1000011
604 Ga0065165_1000150
605 Ga0065165_1053766
606 Ga0070658_10811070
607 Ga0070670_100075398
608 Ga0068868_100003650
609 Ga0070660_100492174
610 Ga0070689_100000018
611 Ga0070668_100464360
612 Ga0070668_100516691
613 Ga0070675_100083801
614 Ga0070675_100128215
615 Ga0070675_100298987
616 Ga0070675_100299578
617 Ga0070671_100015653
618 Ga0070671_100141019
619 Ga0070673_100090930
620 Ga0070688_100122177
621 Ga0070659_100994064
622 Ga0070709_10018422
623 Ga0070714_100017599
624 Ga0070713_100018232
625 Ga0070713_100251505
626 Ga0070710_10083796
627 Ga0070705_100417546
628 Ga0070700_100812870
629 Ga0070694_100728250
630 Ga0070663_100096378
631 Ga0070663_100234570
632 Ga0070678_100745913
633 Ga0070678_101010449
634 Ga0068867_100044224
635 Ga0068867_101540674
636 Ga0070685_10013703
637 Ga0070684_100273139
638 Ga0070684_100424240
639 Ga0070672_100216621
640 Ga0070672_100416870
641 Ga0070686_100030101
642 Ga0070696_100008909
643 Ga0070693_100624624
644 Ga0070665_100027310
645 Ga0070704_100024848
646 Ga0068856_100227664
647 Ga0068856_100294832
648 Ga0070702_100141784
649 Ga0068852_100076609
650 Ga0068859_100362045
651 Ga0068864_101191853
652 Ga0068866_10209299
653 Ga0068863_100407461
654 Ga0068863_101461066
655 Ga0068858_101139955
656 Ga0068860_100400687
657 Ga0068860_100926396
658 Ga0068862_100004007
659 Ga0068862_100365703
660 Ga0081455_10043443
661 Ga0081455_10124402
662 Ga0081540_1081219
663 Ga0070717_10005153
664 Ga0075365_10017968
665 Ga0075365_10027319
666 Ga0075365_10164656
667 Ga0075365_10405718
668 Ga0075365_11004602
669 Ga0075368_10318850
670 Ga0075364_10133114
671 Ga0075364_10490732
672 Ga0070716_100121943
673 Ga0070716_100231711
674 Ga0075362_10257900
675 Ga0075369_10061400
676 Ga0075369_10077135
677 Ga0075366_10054826
678 Ga0075366_10091254
679 Ga0097621_100085078
680 Ga0097621_100335347
681 Ga0075370_10052635
682 Ga0075370_10247437
683 Ga0068871_100021632
684 Ga0075434_100011878
685 Ga0075434_100339422
686 Ga0097620_100362038
687 Ga0099823_1013263
688 Ga0105240_10009401
689 Ga0105240_10076360
690 Ga0105240_10077368
691 Ga0105240_10430678
692 Ga0105240_10670205
693 Ga0105247_10160516
694 Ga0105247_10786876
695 Ga0105241_10131101
696 Ga0105241_10187922
697 Ga0105248_10806788
698 Ga0105237_10133511
699 Ga0105249_10014538
700 Ga0105249_10914868
701 Ga0105239_10079271
702 Ga0105239_10367297
703 Ga0157314_1014240
704 Ga0171462_1015
705 Ga0157374_10203265
706 Ga0157374_10848455
707 Ga0157378_10274569
708 Ga0163162_10927960
709 Ga0157372_11862187
710 Ga0157375_12225208
711 Ga0163163_10004923
712 Ga0163163_10047869
713 Ga0163163_10308330
714 Ga0163163_10733616
715 Ga0157380_10019928
716 Ga0182008_10534830
717 Ga0157379_10170305
718 Ga0157379_10252918
719 Ga0163161_10552857
720 Ga0163161_11383257
721 Ga0206354_10108602
722 Ga0206354_10359821
723 Ga0214544_1000003
724 Ga0214542_1000003
725 Ga0214545_1000004
726 Ga0214543_1000007
727 Ga0213874_10002498
728 Ga0213876_10007769
729 Ga0213876_10009062
730 Ga0213876_10029125
731 Ga0213875_10021992
732 Ga0213875_10076933
733 Ga0213875_10377973
734 Ga0209233_1021879
735 Ga0209673_1049107
736 Ga0209130_1000187
737 Ga0209675_1005741
738 Ga0209025_1000010
739 Ga0209025_1003913
740 Ga0209025_1062867
741 Ga0209025_1070283
742 Ga0209564_1000019
743 Ga0209564_1000369
744 Ga0209758_1000005
745 Ga0209758_1002632
746 Ga0209758_1016086
747 Ga0209758_1039208
748 Ga0209758_1078121
749 Ga0209050_1019524
750 Ga0209050_1064198
751 Ga0209256_1000317
752 Ga0209256_1050348
753 Ga0207426_1000201
754 Ga0207426_1011144
755 Ga0207426_1018295
756 Ga0209257_1000391
757 Ga0209257_1065298
758 Ga0207692_10081313
759 Ga0207692_10628966
760 Ga0207680_10198228
761 Ga0207699_10115358
762 Ga0207654_10044547
763 Ga0207695_10000065
764 Ga0207695_10055253
765 Ga0207695_10414864
766 Ga0207671_10017405
767 Ga0207662_10112981
768 Ga0207657_10185324
769 Ga0207652_10104076
770 Ga0207650_10095627
771 Ga0207650_10836010
772 Ga0207659_10159977
773 Ga0207659_10263559
774 Ga0207700_10040741
775 Ga0207664_10028898
776 Ga0207644_10052406
777 Ga0207644_10538122
778 Ga0207644_10656374
779 Ga0207706_10237822
780 Ga0207670_10000001
781 Ga0207670_10026049
782 Ga0207665_10136391
783 Ga0207665_10405791
784 Ga0207691_10005607
785 Ga0207691_10129493
786 Ga0207679_11454512
787 Ga0207667_10753042
788 Ga0207651_10000751
789 Ga0207651_10121773
790 Ga0207651_10212262
791 Ga0207712_10007361
792 Ga0207712_11364006
793 Ga0207668_10411807
794 Ga0207668_11362324
795 Ga0207640_10813913
796 Ga0207658_10039079
797 Ga0207677_10004986
798 Ga0207678_10744374
799 Ga0207708_10244255
800 Ga0207708_10409273
801 Ga0207708_11100282
802 Ga0207702_10250907
803 Ga0207702_10490535
804 Ga0207641_11541881
805 Ga0207648_10031123
806 Ga0207648_10316570
807 Ga0207648_11460127
808 Ga0207676_10167880
809 Ga0207683_10054965
810 Ga0207683_10246280
811 Ga0207698_10104979
812 Ga0209389_1010635
813 Ga0209489_112010
814 Ga0209700_110939
815 Ga0207428_10035875
816 Ga0268266_10006781
817 Ga0268265_11749033
818 Ga0265318_10067478
819 Ga0307515_10178960
820 Ga0265320_10269587
821 Ga0307513_10036871
822 Ga0307513_10129247
823 Ga0307408_100052585
824 Ga0307408_100225750
825 Ga0307508_10082799
826 Ga0307406_10141603
827 Ga0307406_10324944
828 Ga0307412_10212845
829 Ga0307409_101744072
830 Ga0307416_100878294
831 Ga0307416_102132942
832 Ga0307415_100643481
833 Ga0307415_101320184
834 Ga0307510_10016772
835 Ga0307510_10070055
836 Ga0373957_0079320
837 Ga0373946_0030522
838 Ga0373955_0110620
839 Ga0373931_0472589
840 Ga0373933_0120135
841 Ga0373933_0526077
842 Ga0373937_0197415
843 Ga0373925_0268148
844 Ga0373925_0898809
845 Ga0395898_1118688
846 Ga0395905_0081569
847 Ga0436364_0197909
848 Ga0436364_0497276
849 Ga0436364_0532601
850 Ga0436364_1099918
851 Ga0237819_26476
852 Ga0237816_00722
853 Ga0436365_0088001
854 Ga0436365_0277390
855 Ga0436365_0678611
856 Ga0436365_1886658
857 Ga0436360_0652803
858 Ga0436361_0425765
859 Ga0436361_0500698
860 Ga0436361_1079383
861 Ga0436363_0699892
862 Ga0436363_0700629
863 Ga0436363_1011916
864 Ga0451843_1323642
865 Ga0450900_028879
866 Ga0466972_0072916
867 Ga0466968_0053024
868 Ga0466968_0066967
869 Ga0466960_0200173
870 Ga0466960_0391389
871 Ga0466960_0465994
872 Ga0466967_0282371
873 Ga0495592_0538314
874 Ga0495603_0123288
875 Ga0495638_0001760
876 Ga0495638_0361783
877 Ga0495651_0001917
878 Ga0495605_0148332
879 Ga0495639_0048418
880 Ga0495664_0011217
881 Ga0495594_0228874
882 Ga0495583_0230360
883 Ga0495606_0375969
884 Ga0495620_0138662
885 Ga0495628_0103487
886 Ga0495643_0050420
887 Ga0495652_0025465
888 Ga0495652_0514286
889 Ga0495640_0011710
890 Ga0495640_0376595
891 Ga0495587_0009486
892 Ga0495598_0314227
893 Ga0495609_0058978
894 Ga0495645_0037519
895 Ga0495622_0079208
896 Ga0495667_0009591
897 Ga0495634_0042998
898 Ga0495634_0065794
899 Ga0495625_0071460
900 Ga0495635_0001881
901 Ga0495635_0099874
902 Ga0495661_0168011
903 Ga0495661_0419745
904 Ga0495588_0075640
905 Ga0495588_0082234
906 Ga0495657_0004727
907 Ga0495599_0011007
908 Ga0495623_0022868
909 Ga0495613_0027850
910 Ga0495624_0022395
911 Ga0495600_0004439
912 Ga0495600_0007347
913 Ga0495581_0063802
914 Ga0495581_0174984
915 Ga0495604_0002141
916 Ga0495604_0026793
917 Ga0495674_0018376
918 Ga0495676_0049909
919 Ga0495680_0019780
920 Ga0495683_0244379
921 Ga0495675_0027393
922 Ga0495686_0020180
923 Ga0495686_0634721
924 Ga0495602_0074836
925 Ga0496100_0134242
926 Ga0496100_0152731
927 Ga0496100_0494916
928 Ga0496101_0131222
929 Ga0496101_0272801
930 Ga0496101_0428910
931 Ga0496101_0667172
932 Ga0496102_0070802
933 Ga0496104_0006361
934 Ga0496104_0021759
935 Ga0496104_0022524
936 Ga0496104_0251380
937 Ga0496104_0361991
938 Ga0496104_0398200
939 Ga0496104_0632394
940 Ga0496105_0005021
941 Ga0496105_0147028
942 Ga0496105_0191474
943 Ga0496106_0059587
944 Ga0496106_0230376
945 Ga0496106_0549762
946 Ga0496107_0173502
947 Ga0496107_0354899
948 Ga0496108_0010916
949 Ga0496108_0071778
950 Ga0496108_0573538
951 Ga0496108_0588931
952 Ga0496108_0780298
953 Ga0496109_0001443
954 Ga0496110_0024131
955 Ga0496110_0228404
956 Ga0496110_0419356
957 Ga0496110_1133173
958 Ga0496111_0436011
959 Ga0496112_0001558
960 Ga0496112_1010461
961 Ga0496113_0001483
962 Ga0496113_0010571
963 Ga0496113_0280507
964 Ga0496114_0000290
965 Ga0496114_0440600
966 Ga0496114_0949437
967 Ga0496114_1298827
968 Ga0496115_0003155
969 Ga0496115_0019865
970 Ga0496115_0057623
971 Ga0496115_0639186
972 Ga0496116_0273267
973 Ga0496117_0235143
974 Ga0496118_0175217
975 Ga0496119_0022738
976 Ga0496120_0036896
977 Ga0496121_0051244
978 Ga0496122_0007615
979 Ga0496122_0100923
980 Ga0496122_0278299
981 Ga0496123_0055689
982 Ga0496124_0082577
983 Ga0496124_0087867
984 Ga0496125_0082641
985 Ga0496125_0105615
986 Ga0496126_0031654
987 Ga0496126_0111250
988 Ga0496126_0302353
989 Ga0496126_0853138
990 Ga0501031_0198575
991 Ga0501037_0022439
992 Ga0501038_0553451
993 Ga0501039_0119308
994 Ga0501040_0140528
995 Ga0501042_0069013
996 Ga0501046_0024593
997 Ga0501048_0247788
998 Ga0501070_0803033
999 Ga0501075_0226169
1000 Ga0501076_0154250
1001 Ga0501044_0642380
1002 Ga0501045_0040032
1003 nmdc:mga03n38_249516_c1
1004 nmdc:mga00v17_27926_c1
1005 nmdc:mga00v17_349596_c1
1006 nmdc:mga0yw44_147163_c1
1007 nmdc:mga0yw44_26350_c1
1008 nmdc:mga0yw44_44148_c1
1009 nmdc:mga07m45_53861_c1
1010 nmdc:mga07m45_78980_c1
1011 nmdc:mga0qj67_1105113_c1
1012 nmdc:mga08y16_66783_c1
1013 nmdc:mga0n895_18008_c1
1014 nmdc:mga08x19_95333_c1
1015 nmdc:mga0sz30_102683_c1
1016 nmdc:mga0sz30_135110_c1
1017 nmdc:mga0sz30_44043_c1
1018 nmdc:mga0sz30_86805_c1
1019 Ga0500610_0142079
1020 Ga0500578_0087490
1021 Ga0500643_000163
1022 Ga0500644_0225983
1023 Ga0500646_0026278
1024 Ga0500651_0413484
1025 Ga0500566_0000224
1026 Ga0500566_0096883
1027 Ga0500641_0002734
1028 Ga0500641_0016388
1029 Ga0500650_0045589
1030 Ga0500650_0112302
1031 Ga0500650_0118657
1032 Ga0500554_053541
1033 Ga0500555_001084
1034 Ga0500556_0027049
1035 Ga0500562_110308
1036 Ga0500569_164298
1037 Ga0500572_042735
1038 Ga0500594_0036703
1039 Ga0500595_005537
1040 Ga0500595_040507
1041 Ga0500608_046197
1042 Ga0500642_0007538
1043 Ga0500642_0008075
1044 Ga0500559_0063420
1045 Ga0500564_034892
1046 Ga0500568_0053420
1047 Ga0500577_0206153
1048 Ga0500588_0001796
1049 Ga0500588_0008929
1050 Ga0500588_0021991
1051 Ga0500590_107781
1052 Ga0500604_0003195
1053 Ga0500604_0045994
1054 Ga0500616_0000705
1055 Ga0500616_0060070
1056 Ga0500619_056515
1057 Ga0500622_0022826
1058 Ga0500624_074124
1059 Ga0500633_0062579
1060 Ga0500636_0000330
1061 Ga0500609_000476
1062 Ga0500609_001275
1063 Ga0500609_011550
1064 Ga0500599_012579
1065 Ga0500601_001460
1066 Ga0501084_0073475
1067 2507504937
1068 2508727602
1069 2509077487
1070 2511401386
1071 2513623374
1072 2513873818
1073 2514015340
1074 2517102292
1075 2528851958
1076 2545678069
1077 2596373538
1078 2617351799
1079 2617374026
1080 2644730869
1081 2644736032
1082 2644742586
1083 2738745530
1084 2739354760
1085 2774868728
1086 2776258335
1087 2793063020
1088 2805915901
1089 2819722087
1090 2824670084
1091 2824679108
1092 2824695718
1093 2824701633
1094 2824713651
1095 2824739262
1096 2824748925
1097 2824760561
1098 2824771025
1099 2824774844
1100 2829750703
1101 2835318528
1102 2838124215
1103 2841763991
1104 2841915525
1105 2841920727
1106 2841944561
1107 2841951699
1108 2841964840
1109 2841969339
1110 2841980264
1111 2841985514
1112 2842043786
1113 2842052224
1114 2844108554
1115 2844321915
1116 2847941852
1117 2851185234
1118 2851250426
1119 2861695916
1120 2874618479
1121 2874624508
1122 2874629128
1123 2879107321
1124 2882457563
1125 2884301344
1126 2889311485
1127 2894235974
1128 2902411663
1129 2903727537
1130 2904672153
1131 2904718166
1132 2906602973
1133 2908776503
1134 2917701902
1135 2928128570
1136 2929623800
1137 2929629031
1138 2932786443
1139 2932812483
1140 2932822845
1141 2932829680
1142 2933585679
1143 2935618200
1144 2935641404
1145 2935652897
1146 2935661480
1147 2935669538
1148 2935677864
1149 2935689687
1150 2935698225
1151 2935707363
1152 2935717207
1153 2935724124
1154 2935738622
1155 2935749130
1156 2935757041
1157 2935764348
1158 2935804258
1159 2935831135
1160 2935841744
1161 2935856301
1162 2935866367
1163 2935874674
1164 2935962368
1165 2935984878
1166 2935994132
1167 2936004857
1168 2936015791
1169 2936024425
1170 2936031688
1171 2936051510
1172 2936056049
1173 2940562955
1174 2941543817
1175 3003666943
1176 3005725037
1177 641642416
1178 643598895
1179 8006932777
1180 8016635985
1181 8017058142
1182 8019595680
1183 8019612450
1184 8019652782
1185 8055751101
1186 8057534084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

97

202

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8668 62 157
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.8655 64 155
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.7887 63 161
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.7649 25 157
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.7593 61 160
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9352 69 157 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8665 69 157 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8153 68 159 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8115 61 155 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.797 45 155 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V6HIQ5-F1-model_v4 Peroxiredoxin 0.9926 1 169
AF-A0A4P5WPR6-F1-model_v4 Peroxiredoxin 0.9888 65 168
AF-A0A440JM30-F1-model_v4 deleted 0.9883 50 168
AF-A0A4Q0QJ12-F1-model_v4 OsmC family peroxiredoxin 0.9876 1 169
AF-A0A395KC67-F1-model_v4 deleted 0.987 1 168

Map