F467281

General Info

Members Datasets Scaffolds Average Seq Length
593 259 1186 207

Family's Representative Sequence

Representative Sequence 3300053146|Ga0500588_0097763|Ga0500588_0097763_262_969
Length 235
Sequence MPRPAACEKVFPAITVEGSTIATENMNHHFITVEGNIGAGKTTLAHLLARHYNARLILEAFADNPFLPKFYENPQQFAFPLELFFMAERYKQLKELVHTKDLFQSLTISDYLFTKCLLFAKVNLPEEEFHLYQRLFEIIHQQLVQPDILIYLHAPVSKLQANIKKRNRSYEQHIPDEYLFNIQQTYTHYIKQHNIKTLFIDASNADFLGNEKHLKVITDALEKDLSDGQHYFTLP

Samples

Sample ID Description Type Environment
1 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
173 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
174 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
234 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 2738541278 Niastella sp. CF465 Isolate Unclassified
258 2818991444 Filimonas endophytica 3197 Isolate Unclassified
259 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 1.18
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 22.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500588_0097763 3300053146 Bacteria 1007
2 rootH1_10040138 3300003316 Bacteria 3484
3 rootH2_10011709 3300003320 Bacteria 6738
4 rootH2_10215871 3300003320 Bacteria 4787
5 rootH2_10250303 3300003320 Unclassified 1003
6 rootL2_10184856 3300003322 Bacteria 5341
7 rootL2_10307192 3300003322 Bacteria 2975
8 rootH1_10022476 3300003323 Bacteria 4396
9 Ga0065712_10093279 3300005290 Bacteria 2299
10 Ga0065707_10246388 3300005295 Bacteria 1139
11 Ga0070658_10103063 3300005327 Bacteria 2360
12 Ga0070676_10000263 3300005328 Bacteria 22940
13 Ga0070676_10017885 3300005328 Bacteria 3925
14 Ga0070683_100003859 3300005329 Bacteria 12252
15 Ga0070683_100004278 3300005329 Bacteria 11723
16 Ga0070683_100087498 3300005329 Unclassified 2922
17 Ga0070683_100216667 3300005329 Bacteria 1819
18 Ga0070670_100052282 3300005331 Unclassified 3508
19 Ga0070670_100116528 3300005331 Bacteria 2303
20 Ga0068869_100007877 3300005334 Bacteria 6837
21 Ga0068869_100017657 3300005334 Bacteria 4841
22 Ga0068869_100120963 3300005334 Unclassified 2002
23 Ga0068869_100489860 3300005334 Bacteria 1025
24 Ga0070666_10001269 3300005335 Bacteria 15275
25 Ga0070666_10004806 3300005335 Bacteria 8262
26 Ga0070680_100000693 3300005336 Bacteria 23394
27 Ga0070682_100001134 3300005337 Bacteria 15189
28 Ga0068868_100001950 3300005338 Bacteria 14152
29 Ga0068868_100003187 3300005338 Bacteria 11411
30 Ga0068868_100043145 3300005338 Unclassified 3523
31 Ga0068868_100162186 3300005338 Unclassified 1847
32 Ga0070660_100077797 3300005339 Unclassified 2600
33 Ga0070691_10002457 3300005341 Bacteria 8227
34 Ga0070691_10003801 3300005341 Bacteria 6818
35 Ga0070668_100000106 3300005347 Bacteria 51244
36 Ga0070669_100279078 3300005353 Bacteria 1338
37 Ga0070669_100466308 3300005353 Bacteria 1043
38 Ga0070675_100209802 3300005354 Bacteria 1693
39 Ga0070675_100680802 3300005354 Unclassified 936
40 Ga0070671_100013240 3300005355 Bacteria 6646
41 Ga0070671_100077412 3300005355 Bacteria 2779
42 Ga0070671_100257606 3300005355 Bacteria 1482
43 Ga0070671_100276292 3300005355 Bacteria 1428
44 Ga0070674_100059587 3300005356 Bacteria 2658
45 Ga0070674_100122503 3300005356 Bacteria 1927
46 Ga0070674_100422023 3300005356 Bacteria 1094
47 Ga0070673_100000229 3300005364 Bacteria 28088
48 Ga0070673_100017775 3300005364 Bacteria 5066
49 Ga0070673_100035166 3300005364 Unclassified 3796
50 Ga0070673_100038535 3300005364 Bacteria 3651
51 Ga0070673_100106332 3300005364 Unclassified 2320
52 Ga0070673_100493711 3300005364 Bacteria 1106
53 Ga0070688_100005254 3300005365 Bacteria 6806
54 Ga0070659_100032620 3300005366 Bacteria 4041
55 Ga0070667_100000931 3300005367 Bacteria 27021
56 Ga0070667_100001521 3300005367 Bacteria 20766
57 Ga0070667_100143861 3300005367 Unclassified 2090
58 Ga0070700_100491204 3300005441 Bacteria 942
59 Ga0070663_100104642 3300005455 Unclassified 2117
60 Ga0070662_100009238 3300005457 Bacteria 6440
61 Ga0070681_10008908 3300005458 Bacteria 9864
62 Ga0068867_100009241 3300005459 Bacteria 6956
63 Ga0068867_100035369 3300005459 Bacteria 3623
64 Ga0068867_100811839 3300005459 Bacteria 835
65 Ga0070685_10105477 3300005466 Unclassified 1727
66 Ga0070698_100174488 3300005471 Bacteria 2090
67 Ga0070698_100207989 3300005471 Bacteria 1892
68 Ga0070679_100025591 3300005530 Bacteria 5793
69 Ga0070684_100001995 3300005535 Bacteria 15009
70 Ga0070684_100010684 3300005535 Bacteria 7282
71 Ga0070684_100027031 3300005535 Bacteria 4838
72 Ga0068853_100005763 3300005539 Bacteria 9753
73 Ga0068853_100010845 3300005539 Bacteria 7382
74 Ga0068853_100127625 3300005539 Bacteria 2274
75 Ga0068853_100180102 3300005539 Unclassified 1916
76 Ga0068853_100240249 3300005539 Bacteria 1660
77 Ga0068853_100654044 3300005539 Bacteria 1000
78 Ga0068853_101173106 3300005539 Bacteria 741
79 Ga0070672_100000325 3300005543 Bacteria 27226
80 Ga0070672_100054719 3300005543 Bacteria 3125
81 Ga0070672_100799322 3300005543 Unclassified 830
82 Ga0070686_100151912 3300005544 Bacteria 1623
83 Ga0070695_100282936 3300005545 Bacteria 1219
84 Ga0070693_100023255 3300005547 Bacteria 3310
85 Ga0070665_100000570 3300005548 Bacteria 51526
86 Ga0068855_100017655 3300005563 Bacteria 8580
87 Ga0068855_100057754 3300005563 Bacteria 4548
88 Ga0068855_100070410 3300005563 Bacteria 4069
89 Ga0068855_100077031 3300005563 Bacteria 3869
90 Ga0068855_100321563 3300005563 Bacteria 1710
91 Ga0068855_100432613 3300005563 Unclassified 1438
92 Ga0068855_100673530 3300005563 Bacteria 1109
93 Ga0068855_100777377 3300005563 Bacteria 1019
94 Ga0070664_100002506 3300005564 Bacteria 14800
95 Ga0070664_100023310 3300005564 Bacteria 5111
96 Ga0070664_100121278 3300005564 Bacteria 2289
97 Ga0070664_100266265 3300005564 Bacteria 1543
98 Ga0070664_100343503 3300005564 Bacteria 1356
99 Ga0068857_100023691 3300005577 Bacteria 5404
100 Ga0068857_100039837 3300005577 Bacteria 4164
101 Ga0068857_100045150 3300005577 Bacteria 3908
102 Ga0068857_100516567 3300005577 Bacteria 1122
103 Ga0068857_101317288 3300005577 Bacteria 701
104 Ga0068854_100022248 3300005578 Bacteria 4315
105 Ga0068854_100118958 3300005578 Bacteria 2003
106 Ga0068854_101179282 3300005578 Bacteria 685
107 Ga0068856_100015173 3300005614 Bacteria 7442
108 Ga0068856_100179527 3300005614 Bacteria 2130
109 Ga0068856_100194848 3300005614 Bacteria 2040
110 Ga0068856_100197494 3300005614 Unclassified 2026
111 Ga0068852_100002840 3300005616 Bacteria 12011
112 Ga0068852_100051922 3300005616 Bacteria 3522
113 Ga0068852_100070235 3300005616 Unclassified 3072
114 Ga0068852_100167519 3300005616 Bacteria 2057
115 Ga0068852_100326214 3300005616 Unclassified 1492
116 Ga0068852_100706251 3300005616 Bacteria 1019
117 Ga0068859_100000106 3300005617 Bacteria 78128
118 Ga0068859_100258764 3300005617 Bacteria 1831
119 Ga0068864_100001209 3300005618 Bacteria 21452
120 Ga0068864_100009738 3300005618 Bacteria 7925
121 Ga0068864_100052879 3300005618 Unclassified 3501
122 Ga0068864_100159975 3300005618 Bacteria 2046
123 Ga0068861_100105564 3300005719 Bacteria 2249
124 Ga0068861_100120195 3300005719 Unclassified 2118
125 Ga0068861_101267419 3300005719 Bacteria 715
126 Ga0068851_10020273 3300005834 Unclassified 3217
127 Ga0068851_10114644 3300005834 Unclassified 1442
128 Ga0068863_100000567 3300005841 Bacteria 37587
129 Ga0068863_100003303 3300005841 Bacteria 15923
130 Ga0068863_100036503 3300005841 Unclassified 4682
131 Ga0068863_100139222 3300005841 Bacteria 2319
132 Ga0068863_100143875 3300005841 Bacteria 2280
133 Ga0068858_100001322 3300005842 Bacteria 25607
134 Ga0068858_100080098 3300005842 Bacteria 3034
135 Ga0068858_100285677 3300005842 Unclassified 1571
136 Ga0068860_100000078 3300005843 Bacteria 171062
137 Ga0068860_100005302 3300005843 Bacteria 13092
138 Ga0068860_100014141 3300005843 Bacteria 7828
139 Ga0068860_100073895 3300005843 Bacteria 3241
140 Ga0068860_100084825 3300005843 Bacteria 3013
141 Ga0068860_100617311 3300005843 Bacteria 1091
142 Ga0068860_100671103 3300005843 Bacteria 1045
143 Ga0068862_100074774 3300005844 Bacteria 2929
144 Ga0081540_1003562 3300005983 Bacteria 12251
145 Ga0075366_10060669 3300006195 Bacteria 2247
146 Ga0097621_100015299 3300006237 Bacteria 5770
147 Ga0097621_100088978 3300006237 Unclassified 2581
148 Ga0097621_100296479 3300006237 Bacteria 1427
149 Ga0097621_100331370 3300006237 Bacteria 1350
150 Ga0068871_100002881 3300006358 Bacteria 11796
151 Ga0068871_100019773 3300006358 Bacteria 5146
152 Ga0068871_100143635 3300006358 Bacteria 2031
153 Ga0075428_100193784 3300006844 Unclassified 2198
154 Ga0075431_100020645 3300006847 Bacteria 6731
155 Ga0068865_100000299 3300006881 Bacteria 27298
156 Ga0097620_100000106 3300006931 Bacteria 78128
157 Ga0097620_100258755 3300006931 Bacteria 1831
158 Ga0105240_10000023 3300009093 Bacteria 385028
159 Ga0105240_10000281 3300009093 Bacteria 100881
160 Ga0105240_10002290 3300009093 Bacteria 31019
161 Ga0105240_10009884 3300009093 Bacteria 13461
162 Ga0105240_10014873 3300009093 Bacteria 10605
163 Ga0105240_10024146 3300009093 Bacteria 8023
164 Ga0105240_10029485 3300009093 Bacteria 7148
165 Ga0105240_10061859 3300009093 Bacteria 4663
166 Ga0105240_10137465 3300009093 Bacteria 2925
167 Ga0105240_10210681 3300009093 Bacteria 2271
168 Ga0105240_10375389 3300009093 Unclassified 1607
169 Ga0105240_10509767 3300009093 Unclassified 1337
170 Ga0105240_10616852 3300009093 Bacteria 1192
171 Ga0111539_10087426 3300009094 Bacteria 3662
172 Ga0105245_10144272 3300009098 Bacteria 2245
173 Ga0105245_10366720 3300009098 Unclassified 1431
174 Ga0105247_10121257 3300009101 Unclassified 1694
175 Ga0105247_10172210 3300009101 Bacteria 1440
176 Ga0105247_10379798 3300009101 Unclassified 1001
177 Ga0114129_10011005 3300009147 Bacteria 12889
178 Ga0114129_10084409 3300009147 Bacteria 4410
179 Ga0105241_10008817 3300009174 Bacteria 7411
180 Ga0105241_10040164 3300009174 Bacteria 3532
181 Ga0105241_10048098 3300009174 Bacteria 3244
182 Ga0105241_10311933 3300009174 Bacteria 1353
183 Ga0105241_10350772 3300009174 Bacteria 1281
184 Ga0105241_10559358 3300009174 Unclassified 1028
185 Ga0105241_10885722 3300009174 Unclassified 828
186 Ga0105242_10022831 3300009176 Bacteria 4926
187 Ga0105242_10860851 3300009176 Bacteria 903
188 Ga0105242_11114501 3300009176 Bacteria 804
189 Ga0105248_10005891 3300009177 Bacteria 13473
190 Ga0105237_10000261 3300009545 Bacteria 74745
191 Ga0105237_10001123 3300009545 Bacteria 35881
192 Ga0105237_10003683 3300009545 Bacteria 18058
193 Ga0105237_10015708 3300009545 Bacteria 7871
194 Ga0105237_10062344 3300009545 Bacteria 3728
195 Ga0105237_10073006 3300009545 Bacteria 3424
196 Ga0105237_10126341 3300009545 Bacteria 2551
197 Ga0105237_10415234 3300009545 Bacteria 1351
198 Ga0105238_10025613 3300009551 Bacteria 6013
199 Ga0105238_10050805 3300009551 Unclassified 4173
200 Ga0105238_10177648 3300009551 Unclassified 2106
201 Ga0105238_10219439 3300009551 Unclassified 1877
202 Ga0105238_10256400 3300009551 Unclassified 1728
203 Ga0105238_10301311 3300009551 Bacteria 1586
204 Ga0105249_10002874 3300009553 Bacteria 14864
205 Ga0105249_10004490 3300009553 Bacteria 12063
206 Ga0105249_10628398 3300009553 Unclassified 1130
207 Ga0105239_10000345 3300010375 Bacteria 67861
208 Ga0105239_10002155 3300010375 Bacteria 25331
209 Ga0105239_10015165 3300010375 Bacteria 8540
210 Ga0105239_10019999 3300010375 Bacteria 7388
211 Ga0105239_10022156 3300010375 Bacteria 7002
212 Ga0105239_10138170 3300010375 Unclassified 2714
213 Ga0105246_10096265 3300011119 Unclassified 2145
214 Ga0105246_10168894 3300011119 Bacteria 1673
215 Ga0157373_10000489 3300013100 Bacteria 31312
216 Ga0157373_10100299 3300013100 Bacteria 2038
217 Ga0157373_10567530 3300013100 Unclassified 824
218 Ga0157371_10024966 3300013102 Bacteria 4362
219 Ga0157371_10030010 3300013102 Bacteria 3924
220 Ga0157371_10033027 3300013102 Unclassified 3720
221 Ga0157370_10001887 3300013104 Bacteria 25802
222 Ga0157370_10013074 3300013104 Bacteria 8568
223 Ga0157370_10046983 3300013104 Bacteria 4139
224 Ga0157370_10188546 3300013104 Bacteria 1914
225 Ga0157370_10554644 3300013104 Unclassified 1053
226 Ga0157369_10004105 3300013105 Bacteria 17247
227 Ga0157369_10035765 3300013105 Bacteria 5445
228 Ga0157369_10280244 3300013105 Unclassified 1736
229 Ga0157369_10383465 3300013105 Bacteria 1459
230 Ga0157374_10000002 3300013296 Bacteria 1054226
231 Ga0157374_10000089 3300013296 Bacteria 89250
232 Ga0157374_10018673 3300013296 Bacteria 6125
233 Ga0157378_10005286 3300013297 Bacteria 11339
234 Ga0157378_10013042 3300013297 Bacteria 7269
235 Ga0157378_10055412 3300013297 Bacteria 3532
236 Ga0157378_10163789 3300013297 Bacteria 2081
237 Ga0157378_10224091 3300013297 Bacteria 1788
238 Ga0157378_10287443 3300013297 Bacteria 1587
239 Ga0163162_10000084 3300013306 Bacteria 86252
240 Ga0163162_10000624 3300013306 Bacteria 32874
241 Ga0163162_10000972 3300013306 Bacteria 26646
242 Ga0163162_10013609 3300013306 Bacteria 7948
243 Ga0163162_10241613 3300013306 Unclassified 1937
244 Ga0157372_10001814 3300013307 Bacteria 23160
245 Ga0157372_10062059 3300013307 Unclassified 4186
246 Ga0157372_10063614 3300013307 Unclassified 4138
247 Ga0157372_10065892 3300013307 Bacteria 4069
248 Ga0157372_10073967 3300013307 Unclassified 3841
249 Ga0157372_10092527 3300013307 Bacteria 3440
250 Ga0157372_10209595 3300013307 Bacteria 2258
251 Ga0157372_10279351 3300013307 Bacteria 1941
252 Ga0157372_10671706 3300013307 Bacteria 1206
253 Ga0157375_10000057 3300013308 Bacteria 122654
254 Ga0157375_10015071 3300013308 Bacteria 6913
255 Ga0157375_10029151 3300013308 Bacteria 5186
256 Ga0157375_10038254 3300013308 Bacteria 4606
257 Ga0157375_10168438 3300013308 Unclassified 2337
258 Ga0163163_10000804 3300014325 Bacteria 26629
259 Ga0163163_10014347 3300014325 Bacteria 7283
260 Ga0163163_10178860 3300014325 Bacteria 2168
261 Ga0163163_10191920 3300014325 Unclassified 2091
262 Ga0163163_11281841 3300014325 Bacteria 795
263 Ga0157380_10006684 3300014326 Bacteria 8142
264 Ga0157380_10139444 3300014326 Bacteria 2081
265 Ga0157380_10272033 3300014326 Unclassified 1545
266 Ga0157380_11169535 3300014326 Unclassified 811
267 Ga0157377_10087715 3300014745 Bacteria 1831
268 Ga0157379_10000032 3300014968 Bacteria 83845
269 Ga0157379_10098322 3300014968 Bacteria 2627
270 Ga0157379_10112568 3300014968 Unclassified 2446
271 Ga0157379_10157515 3300014968 Unclassified 2049
272 Ga0157379_10213885 3300014968 Unclassified 1746
273 Ga0157379_10269379 3300014968 Unclassified 1548
274 Ga0157376_10000318 3300014969 Bacteria 32314
275 Ga0157376_10031895 3300014969 Bacteria 4225
276 Ga0157376_10041388 3300014969 Bacteria 3771
277 Ga0157376_10052117 3300014969 Bacteria 3401
278 Ga0157376_10473199 3300014969 Bacteria 1226
279 Ga0157376_10473342 3300014969 Bacteria 1226
280 Ga0157376_10813269 3300014969 Bacteria 948
281 Ga0182005_1030952 3300015265 Bacteria 1458
282 Ga0163161_10030785 3300017792 Unclassified 3822
283 Ga0163161_10092713 3300017792 Bacteria 2237
284 Ga0213876_10002070 3300021384 Bacteria 11887
285 Ga0213876_10033800 3300021384 Bacteria 2696
286 Ga0209646_1003036 3300025246 Bacteria 3446
287 Ga0207697_10069725 3300025315 Bacteria 1472
288 Ga0207697_10106373 3300025315 Bacteria 1199
289 Ga0207656_10026563 3300025321 Unclassified 2362
290 Ga0207682_10030531 3300025893 Bacteria 2159
291 Ga0207710_10110945 3300025900 Unclassified 1302
292 Ga0207680_10000125 3300025903 Bacteria 35925
293 Ga0207647_10014949 3300025904 Bacteria 5334
294 Ga0207647_10021474 3300025904 Unclassified 4309
295 Ga0207647_10094092 3300025904 Unclassified 1785
296 Ga0207645_10000638 3300025907 Bacteria 29117
297 Ga0207643_10094115 3300025908 Bacteria 1750
298 Ga0207705_10002058 3300025909 Bacteria 15638
299 Ga0207654_10045309 3300025911 Bacteria 2502
300 Ga0207654_10172768 3300025911 Bacteria 1404
301 Ga0207654_10400034 3300025911 Unclassified 955
302 Ga0207707_10001194 3300025912 Bacteria 24438
303 Ga0207707_10058317 3300025912 Bacteria 3360
304 Ga0207695_10000016 3300025913 Bacteria 771991
305 Ga0207695_10000128 3300025913 Bacteria 226098
306 Ga0207695_10000296 3300025913 Bacteria 123322
307 Ga0207695_10022769 3300025913 Bacteria 7099
308 Ga0207695_10063191 3300025913 Bacteria 3818
309 Ga0207695_10125536 3300025913 Bacteria 2529
310 Ga0207695_10237715 3300025913 Bacteria 1724
311 Ga0207695_10299981 3300025913 Unclassified 1498
312 Ga0207671_10001029 3300025914 Bacteria 33967
313 Ga0207671_10009779 3300025914 Bacteria 7980
314 Ga0207671_10126635 3300025914 Bacteria 1957
315 Ga0207671_10209717 3300025914 Bacteria 1523
316 Ga0207660_10023829 3300025917 Unclassified 4137
317 Ga0207657_10109630 3300025919 Unclassified 2281
318 Ga0207649_10446468 3300025920 Unclassified 975
319 Ga0207649_10593743 3300025920 Unclassified 851
320 Ga0207652_10002054 3300025921 Bacteria 17328
321 Ga0207681_10843348 3300025923 Bacteria 766
322 Ga0207694_10165333 3300025924 Bacteria 1789
323 Ga0207694_10220280 3300025924 Unclassified 1548
324 Ga0207694_10982428 3300025924 Unclassified 714
325 Ga0207650_10021737 3300025925 Bacteria 4536
326 Ga0207650_10024854 3300025925 Unclassified 4264
327 Ga0207650_10236709 3300025925 Bacteria 1474
328 Ga0207650_10606368 3300025925 Bacteria 921
329 Ga0207659_10033521 3300025926 Bacteria 3535
330 Ga0207659_10650160 3300025926 Unclassified 901
331 Ga0207687_10248283 3300025927 Unclassified 1413
332 Ga0207644_10058900 3300025931 Unclassified 2777
333 Ga0207644_10110786 3300025931 Bacteria 2075
334 Ga0207644_10205744 3300025931 Bacteria 1554
335 Ga0207690_10025692 3300025932 Bacteria 3702
336 Ga0207690_10057660 3300025932 Bacteria 2624
337 Ga0207706_10007388 3300025933 Bacteria 10158
338 Ga0207706_10039794 3300025933 Unclassified 4168
339 Ga0207706_10117833 3300025933 Bacteria 2335
340 Ga0207706_10315637 3300025933 Bacteria 1360
341 Ga0207686_10078238 3300025934 Unclassified 2150
342 Ga0207670_10287078 3300025936 Unclassified 1284
343 Ga0207669_10060010 3300025937 Bacteria 2329
344 Ga0207669_10186785 3300025937 Bacteria 1491
345 Ga0207704_10547495 3300025938 Bacteria 940
346 Ga0207704_10677686 3300025938 Bacteria 852
347 Ga0207691_10000014 3300025940 Bacteria 142542
348 Ga0207691_10010650 3300025940 Bacteria 8824
349 Ga0207691_10068604 3300025940 Bacteria 3203
350 Ga0207691_10764289 3300025940 Bacteria 813
351 Ga0207711_10990229 3300025941 Unclassified 780
352 Ga0207689_10000853 3300025942 Bacteria 29374
353 Ga0207689_10002211 3300025942 Bacteria 18237
354 Ga0207689_10004402 3300025942 Bacteria 12804
355 Ga0207689_10140956 3300025942 Unclassified 1986
356 Ga0207661_10012502 3300025944 Bacteria 6169
357 Ga0207661_10553957 3300025944 Unclassified 1053
358 Ga0207679_10001197 3300025945 Bacteria 16487
359 Ga0207679_10060263 3300025945 Unclassified 2819
360 Ga0207679_10153517 3300025945 Bacteria 1877
361 Ga0207679_10288993 3300025945 Bacteria 1409
362 Ga0207667_10000143 3300025949 Bacteria 108717
363 Ga0207667_10002746 3300025949 Bacteria 21763
364 Ga0207667_10015337 3300025949 Bacteria 8711
365 Ga0207667_10056411 3300025949 Bacteria 4127
366 Ga0207667_10291910 3300025949 Bacteria 1666
367 Ga0207667_10369207 3300025949 Bacteria 1462
368 Ga0207667_10427435 3300025949 Unclassified 1347
369 Ga0207667_10637976 3300025949 Bacteria 1072
370 Ga0207651_10000826 3300025960 Bacteria 13415
371 Ga0207651_10042111 3300025960 Bacteria 3037
372 Ga0207651_10146854 3300025960 Unclassified 1830
373 Ga0207651_10169089 3300025960 Bacteria 1722
374 Ga0207712_10002069 3300025961 Bacteria 13179
375 Ga0207712_10012835 3300025961 Bacteria 5358
376 Ga0207712_10457286 3300025961 Unclassified 1084
377 Ga0207668_10000124 3300025972 Bacteria 54437
378 Ga0207668_10183958 3300025972 Unclassified 1651
379 Ga0207668_10291744 3300025972 Bacteria 1342
380 Ga0207640_10485806 3300025981 Bacteria 1025
381 Ga0207658_10000242 3300025986 Bacteria 57191
382 Ga0207658_10010441 3300025986 Bacteria 6307
383 Ga0207658_10847830 3300025986 Unclassified 831
384 Ga0207677_10003043 3300026023 Bacteria 8867
385 Ga0207677_10005391 3300026023 Bacteria 6938
386 Ga0207677_10030799 3300026023 Unclassified 3430
387 Ga0207703_10000735 3300026035 Bacteria 32229
388 Ga0207703_10003904 3300026035 Bacteria 12380
389 Ga0207703_10180578 3300026035 Unclassified 1862
390 Ga0207639_10008018 3300026041 Bacteria 7216
391 Ga0207639_10037426 3300026041 Bacteria 3603
392 Ga0207639_10140366 3300026041 Unclassified 2012
393 Ga0207639_10176785 3300026041 Unclassified 1812
394 Ga0207678_10017896 3300026067 Bacteria 6225
395 Ga0207678_10123011 3300026067 Unclassified 2214
396 Ga0207678_10180545 3300026067 Bacteria 1802
397 Ga0207702_10067599 3300026078 Bacteria 3068
398 Ga0207702_10163484 3300026078 Unclassified 2034
399 Ga0207641_10000082 3300026088 Bacteria 138385
400 Ga0207641_10013162 3300026088 Bacteria 6782
401 Ga0207641_10015499 3300026088 Bacteria 6246
402 Ga0207641_10123075 3300026088 Bacteria 2318
403 Ga0207641_10483665 3300026088 Bacteria 1200
404 Ga0207648_10028788 3300026089 Unclassified 4924
405 Ga0207648_10046144 3300026089 Bacteria 3820
406 Ga0207648_10124845 3300026089 Bacteria 2264
407 Ga0207648_10319854 3300026089 Unclassified 1394
408 Ga0207676_10005134 3300026095 Bacteria 9267
409 Ga0207676_10010368 3300026095 Bacteria 6635
410 Ga0207676_10123859 3300026095 Bacteria 2185
411 Ga0207676_10371361 3300026095 Bacteria 1329
412 Ga0207674_10002304 3300026116 Bacteria 24174
413 Ga0207674_10013597 3300026116 Bacteria 9017
414 Ga0207674_10048747 3300026116 Unclassified 4334
415 Ga0207674_10053181 3300026116 Bacteria 4128
416 Ga0207674_10067721 3300026116 Bacteria 3593
417 Ga0207675_100070459 3300026118 Unclassified 3268
418 Ga0207683_10058659 3300026121 Bacteria 3380
419 Ga0207683_10075606 3300026121 Bacteria 2981
420 Ga0207683_10117290 3300026121 Bacteria 2387
421 Ga0207683_10436421 3300026121 Bacteria 1207
422 Ga0207698_10003520 3300026142 Bacteria 9440
423 Ga0207698_10037010 3300026142 Unclassified 3589
424 Ga0207698_10069847 3300026142 Bacteria 2780
425 Ga0207698_10359933 3300026142 Unclassified 1377
426 Ga0207698_10373039 3300026142 Bacteria 1355
427 Ga0207698_10617294 3300026142 Bacteria 1071
428 Ga0207428_10173053 3300027907 Bacteria 1634
429 Ga0268266_10005443 3300028379 Bacteria 11868
430 Ga0268265_10126345 3300028380 Bacteria 2117
431 Ga0268264_10000105 3300028381 Bacteria 212531
432 Ga0268264_10003731 3300028381 Bacteria 13086
433 Ga0268264_10003887 3300028381 Bacteria 12806
434 Ga0268264_10012385 3300028381 Bacteria 7020
435 Ga0268264_10254766 3300028381 Bacteria 1632
436 Ga0268264_11277044 3300028381 Unclassified 744
437 Ga0307515_10000190 3300028794 Bacteria 150300
438 Ga0265327_10012523 3300031251 Bacteria 5713
439 Ga0307513_10046944 3300031456 Bacteria 4703
440 Ga0307513_10264577 3300031456 Bacteria 1507
441 Ga0307513_10415718 3300031456 Bacteria 1076
442 Ga0307513_10506009 3300031456 Bacteria 925
443 Ga0307513_10532264 3300031456 Bacteria 889
444 Ga0307408_101161455 3300031548 Unclassified 719
445 Ga0307508_10011571 3300031616 Bacteria 8061
446 Ga0307516_10001379 3300031730 Bacteria 33641
447 Ga0307507_10168630 3300033179 Bacteria 1597
448 Ga0307510_10003610 3300033180 Bacteria 18060
449 Ga0373955_0152035 3300035172 Bacteria 1363
450 Ga0373935_0268381 3300035692 Bacteria 1199
451 Ga0373927_0160003 3300035695 Bacteria 1475
452 Ga0373947_0610666 3300035725 Bacteria 743
453 Ga0373937_0050719 3300036401 Bacteria 3802
454 Ga0373937_0099570 3300036401 Bacteria 2696
455 Ga0373937_0143636 3300036401 Bacteria 2233
456 Ga0373937_0244773 3300036401 Bacteria 1690
457 Ga0373925_0220750 3300037068 Unclassified 1513
458 Ga0395899_0045814 3300037312 Bacteria 3258
459 Ga0395900_0020435 3300037418 Bacteria 6759
460 Ga0395905_0176292 3300037471 Unclassified 2007
461 Ga0436365_1052711 3300039437 Bacteria 25242
462 Ga0436365_1077961 3300039437 Bacteria 3203
463 Ga0439436_0019396 3300041404 Bacteria 2031
464 Ga0439436_0043707 3300041404 Bacteria 1278
465 Ga0451802_1346588 3300041460 Bacteria 678
466 Ga0451833_0591057 3300041491 Unclassified 872
467 Ga0451845_0686587 3300041501 Bacteria 800
468 Ga0439442_007902 3300042002 Unclassified 2147
469 Ga0439449_0014897 3300042007 Bacteria 2923
470 Ga0439457_047020 3300042014 Bacteria 966
471 Ga0439462_0091908 3300042015 Bacteria 833
472 Ga0450922_006358 3300042124 Bacteria 1100
473 Ga0450923_107344 3300042125 Bacteria 649
474 Ga0439446_0109164 3300042156 Bacteria 881
475 Ga0439434_0107341 3300042435 Bacteria 902
476 Ga0439434_0109255 3300042435 Bacteria 895
477 Ga0451577_0061124 3300042876 Bacteria 3359
478 Ga0451577_0251788 3300042876 Unclassified 1599
479 Ga0451577_0449942 3300042876 Bacteria 1169
480 Ga0451577_0835648 3300042876 Bacteria 831
481 Ga0466969_0000244 3300044656 Bacteria 29819
482 Ga0466972_0000011 3300044658 Bacteria 249697
483 Ga0466972_0003024 3300044658 Bacteria 8339
484 Ga0466966_0017726 3300044684 Bacteria 4701
485 Ga0466961_0016976 3300044693 Bacteria 4675
486 Ga0466964_0028126 3300044706 Unclassified 2213
487 Ga0466964_0076007 3300044706 Bacteria 1431
488 Ga0453684_0006196 3300044712 Bacteria 22943
489 Ga0453684_0295857 3300044712 Unclassified 1841
490 Ga0453684_0947206 3300044712 Bacteria 919
491 Ga0466971_0016800 3300044719 Unclassified 3233
492 Ga0466971_0053354 3300044719 Bacteria 1822
493 Ga0466970_0090108 3300044765 Unclassified 1664
494 Ga0466970_0229291 3300044765 Bacteria 1038
495 Ga0466970_0334776 3300044765 Unclassified 857
496 Ga0466957_0000218 3300044842 Bacteria 27018
497 Ga0466957_0020990 3300044842 Bacteria 3844
498 Ga0466960_0171154 3300044901 Bacteria 1172
499 Ga0466959_0000039 3300045049 Bacteria 101186
500 Ga0466959_0004171 3300045049 Bacteria 9628
501 Ga0466958_0119347 3300045836 Unclassified 1650
502 Ga0495592_0200274 3300046454 Bacteria 1348
503 Ga0495629_0549349 3300046459 Bacteria 775
504 Ga0495580_0334582 3300046472 Unclassified 1028
505 Ga0495606_0129160 3300046507 Unclassified 1504
506 Ga0495608_0429829 3300046511 Bacteria 805
507 Ga0495630_0069116 3300046517 Bacteria 2657
508 Ga0495652_0067790 3300046529 Unclassified 2991
509 Ga0495586_0290687 3300046535 Bacteria 936
510 Ga0495667_0386575 3300046559 Bacteria 882
511 Ga0495634_0103090 3300046642 Bacteria 1842
512 Ga0495611_0000983 3300046648 Bacteria 15159
513 Ga0495657_0239976 3300046675 Bacteria 1094
514 Ga0495657_0353296 3300046675 Unclassified 870
515 Ga0495646_0082683 3300046680 Bacteria 1868
516 Ga0495647_0274515 3300046681 Bacteria 755
517 Ga0495674_0285910 3300047319 Bacteria 1350
518 Ga0495675_0218665 3300047444 Bacteria 1154
519 Ga0495675_0384218 3300047444 Bacteria 821
520 Ga0495686_0000016 3300047472 Bacteria 443701
521 Ga0496104_0458513 3300048907 Unclassified 1186
522 Ga0496105_0082646 3300048908 Unclassified 2653
523 Ga0496108_0765268 3300048911 Unclassified 835
524 Ga0496109_0079110 3300048912 Bacteria 3028
525 Ga0496110_0583305 3300048913 Unclassified 1015
526 Ga0496115_0807860 3300048918 Bacteria 729
527 Ga0501032_0011621 3300049569 Bacteria 6314
528 Ga0501033_0010981 3300049570 Bacteria 6940
529 Ga0501034_0019547 3300049571 Bacteria 6926
530 Ga0501034_0061244 3300049571 Bacteria 3779
531 Ga0501034_0109211 3300049571 Bacteria 2757
532 Ga0501034_0315740 3300049571 Bacteria 1496
533 Ga0501036_0015703 3300049572 Bacteria 6324
534 Ga0501036_0786596 3300049572 Bacteria 784
535 Ga0501037_0011454 3300049573 Bacteria 6528
536 Ga0501037_0226749 3300049573 Bacteria 1313
537 Ga0501037_0272104 3300049573 Bacteria 1182
538 Ga0501038_0031846 3300049574 Bacteria 4658
539 Ga0501038_0515662 3300049574 Bacteria 913
540 Ga0501043_0067826 3300049579 Unclassified 2801
541 Ga0501043_0084398 3300049579 Bacteria 2496
542 Ga0501046_0060700 3300049580 Unclassified 2958
543 Ga0501047_0008167 3300049581 Bacteria 9886
544 Ga0501047_0032597 3300049581 Bacteria 5030
545 Ga0501047_0164028 3300049581 Bacteria 2093
546 Ga0501047_0379798 3300049581 Bacteria 1247
547 Ga0501067_0283732 3300049583 Unclassified 922
548 Ga0501068_0344340 3300049584 Bacteria 957
549 Ga0501069_0011943 3300049585 Unclassified 4608
550 Ga0501073_0009700 3300049589 Bacteria 7094
551 Ga0501073_0516548 3300049589 Bacteria 826
552 Ga0501219_000085 3300049703 Bacteria 15993
553 Ga0501079_0057323 3300049741 Unclassified 3006
554 Ga0501265_026840 3300049762 Bacteria 809
555 Ga0501280_014976 3300049776 Bacteria 1108
556 Ga0501035_0052143 3300049822 Bacteria 3661
557 Ga0501035_0904840 3300049822 Unclassified 699
558 Ga0501044_0011702 3300049823 Bacteria 9505
559 Ga0501044_0019524 3300049823 Bacteria 7248
560 Ga0501044_0031489 3300049823 Bacteria 5583
561 Ga0501044_0074228 3300049823 Unclassified 3456
562 Ga0501044_0218722 3300049823 Unclassified 1856
563 Ga0501044_0254480 3300049823 Bacteria 1696
564 Ga0501044_0453525 3300049823 Bacteria 1189
565 Ga0501284_00074 3300050005 Bacteria 28202
566 nmdc:mga0k408_156910_c1 3300050493 Bacteria 1355
567 nmdc:mga07m45_239325_c1 3300050496 Unclassified 1056
568 nmdc:mga05p37_143831_c1 3300050507 Unclassified 2921
569 nmdc:mga05p37_970_c1 3300050507 Bacteria 16850
570 nmdc:mga09592_5087_c1 3300050508 Bacteria 6421
571 nmdc:mga06r32_7936_c1 3300050510 Bacteria 9541
572 nmdc:mga08y16_1571933_c1 3300050511 Bacteria 616
573 nmdc:mga08y16_346884_c1 3300050511 Bacteria 1526
574 Ga0495619_0093557 3300053085 Bacteria 2038
575 Ga0500578_0000027 3300053086 Bacteria 144362
576 Ga0500578_0337170 3300053086 Unclassified 885
577 Ga0500583_0000004 3300053092 Bacteria 174723
578 Ga0500583_0004553 3300053092 Bacteria 4538
579 Ga0500651_0108465 3300053093 Bacteria 1696
580 Ga0500562_000007 3300053108 Bacteria 241755
581 Ga0500568_0000374 3300053139 Bacteria 34278
582 Ga0500568_0042545 3300053139 Bacteria 1820
583 Ga0500573_0224858 3300053140 Bacteria 982
584 Ga0500604_0012960 3300053151 Bacteria 2257
585 Ga0500616_0036711 3300053153 Bacteria 2658
586 Ga0500622_0002683 3300053156 Bacteria 12605
587 Ga0500622_0047466 3300053156 Bacteria 2218
588 Ga0501084_0055796 3300054114 Unclassified 3305
589 Ga0501082_0175300 3300060353 Bacteria 1864
590 Ga0466962_0003550 3300061719 Bacteria 7429
591 2738727589 2738541278 Bacteria 9755573
592 2819591002 2818991444 Bacteria 6968812
593 2929156266 2929154850 Bacteria 6753285
594 Ga0500588_0097763
595 rootH1_10040138
596 rootH2_10011709
597 rootH2_10215871
598 rootH2_10250303
599 rootL2_10184856
600 rootL2_10307192
601 rootH1_10022476
602 Ga0065712_10093279
603 Ga0065707_10246388
604 Ga0070658_10103063
605 Ga0070676_10000263
606 Ga0070676_10017885
607 Ga0070683_100003859
608 Ga0070683_100004278
609 Ga0070683_100087498
610 Ga0070683_100216667
611 Ga0070670_100052282
612 Ga0070670_100116528
613 Ga0068869_100007877
614 Ga0068869_100017657
615 Ga0068869_100120963
616 Ga0068869_100489860
617 Ga0070666_10001269
618 Ga0070666_10004806
619 Ga0070680_100000693
620 Ga0070682_100001134
621 Ga0068868_100001950
622 Ga0068868_100003187
623 Ga0068868_100043145
624 Ga0068868_100162186
625 Ga0070660_100077797
626 Ga0070691_10002457
627 Ga0070691_10003801
628 Ga0070668_100000106
629 Ga0070669_100279078
630 Ga0070669_100466308
631 Ga0070675_100209802
632 Ga0070675_100680802
633 Ga0070671_100013240
634 Ga0070671_100077412
635 Ga0070671_100257606
636 Ga0070671_100276292
637 Ga0070674_100059587
638 Ga0070674_100122503
639 Ga0070674_100422023
640 Ga0070673_100000229
641 Ga0070673_100017775
642 Ga0070673_100035166
643 Ga0070673_100038535
644 Ga0070673_100106332
645 Ga0070673_100493711
646 Ga0070688_100005254
647 Ga0070659_100032620
648 Ga0070667_100000931
649 Ga0070667_100001521
650 Ga0070667_100143861
651 Ga0070700_100491204
652 Ga0070663_100104642
653 Ga0070662_100009238
654 Ga0070681_10008908
655 Ga0068867_100009241
656 Ga0068867_100035369
657 Ga0068867_100811839
658 Ga0070685_10105477
659 Ga0070698_100174488
660 Ga0070698_100207989
661 Ga0070679_100025591
662 Ga0070684_100001995
663 Ga0070684_100010684
664 Ga0070684_100027031
665 Ga0068853_100005763
666 Ga0068853_100010845
667 Ga0068853_100127625
668 Ga0068853_100180102
669 Ga0068853_100240249
670 Ga0068853_100654044
671 Ga0068853_101173106
672 Ga0070672_100000325
673 Ga0070672_100054719
674 Ga0070672_100799322
675 Ga0070686_100151912
676 Ga0070695_100282936
677 Ga0070693_100023255
678 Ga0070665_100000570
679 Ga0068855_100017655
680 Ga0068855_100057754
681 Ga0068855_100070410
682 Ga0068855_100077031
683 Ga0068855_100321563
684 Ga0068855_100432613
685 Ga0068855_100673530
686 Ga0068855_100777377
687 Ga0070664_100002506
688 Ga0070664_100023310
689 Ga0070664_100121278
690 Ga0070664_100266265
691 Ga0070664_100343503
692 Ga0068857_100023691
693 Ga0068857_100039837
694 Ga0068857_100045150
695 Ga0068857_100516567
696 Ga0068857_101317288
697 Ga0068854_100022248
698 Ga0068854_100118958
699 Ga0068854_101179282
700 Ga0068856_100015173
701 Ga0068856_100179527
702 Ga0068856_100194848
703 Ga0068856_100197494
704 Ga0068852_100002840
705 Ga0068852_100051922
706 Ga0068852_100070235
707 Ga0068852_100167519
708 Ga0068852_100326214
709 Ga0068852_100706251
710 Ga0068859_100000106
711 Ga0068859_100258764
712 Ga0068864_100001209
713 Ga0068864_100009738
714 Ga0068864_100052879
715 Ga0068864_100159975
716 Ga0068861_100105564
717 Ga0068861_100120195
718 Ga0068861_101267419
719 Ga0068851_10020273
720 Ga0068851_10114644
721 Ga0068863_100000567
722 Ga0068863_100003303
723 Ga0068863_100036503
724 Ga0068863_100139222
725 Ga0068863_100143875
726 Ga0068858_100001322
727 Ga0068858_100080098
728 Ga0068858_100285677
729 Ga0068860_100000078
730 Ga0068860_100005302
731 Ga0068860_100014141
732 Ga0068860_100073895
733 Ga0068860_100084825
734 Ga0068860_100617311
735 Ga0068860_100671103
736 Ga0068862_100074774
737 Ga0081540_1003562
738 Ga0075366_10060669
739 Ga0097621_100015299
740 Ga0097621_100088978
741 Ga0097621_100296479
742 Ga0097621_100331370
743 Ga0068871_100002881
744 Ga0068871_100019773
745 Ga0068871_100143635
746 Ga0075428_100193784
747 Ga0075431_100020645
748 Ga0068865_100000299
749 Ga0097620_100000106
750 Ga0097620_100258755
751 Ga0105240_10000023
752 Ga0105240_10000281
753 Ga0105240_10002290
754 Ga0105240_10009884
755 Ga0105240_10014873
756 Ga0105240_10024146
757 Ga0105240_10029485
758 Ga0105240_10061859
759 Ga0105240_10137465
760 Ga0105240_10210681
761 Ga0105240_10375389
762 Ga0105240_10509767
763 Ga0105240_10616852
764 Ga0111539_10087426
765 Ga0105245_10144272
766 Ga0105245_10366720
767 Ga0105247_10121257
768 Ga0105247_10172210
769 Ga0105247_10379798
770 Ga0114129_10011005
771 Ga0114129_10084409
772 Ga0105241_10008817
773 Ga0105241_10040164
774 Ga0105241_10048098
775 Ga0105241_10311933
776 Ga0105241_10350772
777 Ga0105241_10559358
778 Ga0105241_10885722
779 Ga0105242_10022831
780 Ga0105242_10860851
781 Ga0105242_11114501
782 Ga0105248_10005891
783 Ga0105237_10000261
784 Ga0105237_10001123
785 Ga0105237_10003683
786 Ga0105237_10015708
787 Ga0105237_10062344
788 Ga0105237_10073006
789 Ga0105237_10126341
790 Ga0105237_10415234
791 Ga0105238_10025613
792 Ga0105238_10050805
793 Ga0105238_10177648
794 Ga0105238_10219439
795 Ga0105238_10256400
796 Ga0105238_10301311
797 Ga0105249_10002874
798 Ga0105249_10004490
799 Ga0105249_10628398
800 Ga0105239_10000345
801 Ga0105239_10002155
802 Ga0105239_10015165
803 Ga0105239_10019999
804 Ga0105239_10022156
805 Ga0105239_10138170
806 Ga0105246_10096265
807 Ga0105246_10168894
808 Ga0157373_10000489
809 Ga0157373_10100299
810 Ga0157373_10567530
811 Ga0157371_10024966
812 Ga0157371_10030010
813 Ga0157371_10033027
814 Ga0157370_10001887
815 Ga0157370_10013074
816 Ga0157370_10046983
817 Ga0157370_10188546
818 Ga0157370_10554644
819 Ga0157369_10004105
820 Ga0157369_10035765
821 Ga0157369_10280244
822 Ga0157369_10383465
823 Ga0157374_10000002
824 Ga0157374_10000089
825 Ga0157374_10018673
826 Ga0157378_10005286
827 Ga0157378_10013042
828 Ga0157378_10055412
829 Ga0157378_10163789
830 Ga0157378_10224091
831 Ga0157378_10287443
832 Ga0163162_10000084
833 Ga0163162_10000624
834 Ga0163162_10000972
835 Ga0163162_10013609
836 Ga0163162_10241613
837 Ga0157372_10001814
838 Ga0157372_10062059
839 Ga0157372_10063614
840 Ga0157372_10065892
841 Ga0157372_10073967
842 Ga0157372_10092527
843 Ga0157372_10209595
844 Ga0157372_10279351
845 Ga0157372_10671706
846 Ga0157375_10000057
847 Ga0157375_10015071
848 Ga0157375_10029151
849 Ga0157375_10038254
850 Ga0157375_10168438
851 Ga0163163_10000804
852 Ga0163163_10014347
853 Ga0163163_10178860
854 Ga0163163_10191920
855 Ga0163163_11281841
856 Ga0157380_10006684
857 Ga0157380_10139444
858 Ga0157380_10272033
859 Ga0157380_11169535
860 Ga0157377_10087715
861 Ga0157379_10000032
862 Ga0157379_10098322
863 Ga0157379_10112568
864 Ga0157379_10157515
865 Ga0157379_10213885
866 Ga0157379_10269379
867 Ga0157376_10000318
868 Ga0157376_10031895
869 Ga0157376_10041388
870 Ga0157376_10052117
871 Ga0157376_10473199
872 Ga0157376_10473342
873 Ga0157376_10813269
874 Ga0182005_1030952
875 Ga0163161_10030785
876 Ga0163161_10092713
877 Ga0213876_10002070
878 Ga0213876_10033800
879 Ga0209646_1003036
880 Ga0207697_10069725
881 Ga0207697_10106373
882 Ga0207656_10026563
883 Ga0207682_10030531
884 Ga0207710_10110945
885 Ga0207680_10000125
886 Ga0207647_10014949
887 Ga0207647_10021474
888 Ga0207647_10094092
889 Ga0207645_10000638
890 Ga0207643_10094115
891 Ga0207705_10002058
892 Ga0207654_10045309
893 Ga0207654_10172768
894 Ga0207654_10400034
895 Ga0207707_10001194
896 Ga0207707_10058317
897 Ga0207695_10000016
898 Ga0207695_10000128
899 Ga0207695_10000296
900 Ga0207695_10022769
901 Ga0207695_10063191
902 Ga0207695_10125536
903 Ga0207695_10237715
904 Ga0207695_10299981
905 Ga0207671_10001029
906 Ga0207671_10009779
907 Ga0207671_10126635
908 Ga0207671_10209717
909 Ga0207660_10023829
910 Ga0207657_10109630
911 Ga0207649_10446468
912 Ga0207649_10593743
913 Ga0207652_10002054
914 Ga0207681_10843348
915 Ga0207694_10165333
916 Ga0207694_10220280
917 Ga0207694_10982428
918 Ga0207650_10021737
919 Ga0207650_10024854
920 Ga0207650_10236709
921 Ga0207650_10606368
922 Ga0207659_10033521
923 Ga0207659_10650160
924 Ga0207687_10248283
925 Ga0207644_10058900
926 Ga0207644_10110786
927 Ga0207644_10205744
928 Ga0207690_10025692
929 Ga0207690_10057660
930 Ga0207706_10007388
931 Ga0207706_10039794
932 Ga0207706_10117833
933 Ga0207706_10315637
934 Ga0207686_10078238
935 Ga0207670_10287078
936 Ga0207669_10060010
937 Ga0207669_10186785
938 Ga0207704_10547495
939 Ga0207704_10677686
940 Ga0207691_10000014
941 Ga0207691_10010650
942 Ga0207691_10068604
943 Ga0207691_10764289
944 Ga0207711_10990229
945 Ga0207689_10000853
946 Ga0207689_10002211
947 Ga0207689_10004402
948 Ga0207689_10140956
949 Ga0207661_10012502
950 Ga0207661_10553957
951 Ga0207679_10001197
952 Ga0207679_10060263
953 Ga0207679_10153517
954 Ga0207679_10288993
955 Ga0207667_10000143
956 Ga0207667_10002746
957 Ga0207667_10015337
958 Ga0207667_10056411
959 Ga0207667_10291910
960 Ga0207667_10369207
961 Ga0207667_10427435
962 Ga0207667_10637976
963 Ga0207651_10000826
964 Ga0207651_10042111
965 Ga0207651_10146854
966 Ga0207651_10169089
967 Ga0207712_10002069
968 Ga0207712_10012835
969 Ga0207712_10457286
970 Ga0207668_10000124
971 Ga0207668_10183958
972 Ga0207668_10291744
973 Ga0207640_10485806
974 Ga0207658_10000242
975 Ga0207658_10010441
976 Ga0207658_10847830
977 Ga0207677_10003043
978 Ga0207677_10005391
979 Ga0207677_10030799
980 Ga0207703_10000735
981 Ga0207703_10003904
982 Ga0207703_10180578
983 Ga0207639_10008018
984 Ga0207639_10037426
985 Ga0207639_10140366
986 Ga0207639_10176785
987 Ga0207678_10017896
988 Ga0207678_10123011
989 Ga0207678_10180545
990 Ga0207702_10067599
991 Ga0207702_10163484
992 Ga0207641_10000082
993 Ga0207641_10013162
994 Ga0207641_10015499
995 Ga0207641_10123075
996 Ga0207641_10483665
997 Ga0207648_10028788
998 Ga0207648_10046144
999 Ga0207648_10124845
1000 Ga0207648_10319854
1001 Ga0207676_10005134
1002 Ga0207676_10010368
1003 Ga0207676_10123859
1004 Ga0207676_10371361
1005 Ga0207674_10002304
1006 Ga0207674_10013597
1007 Ga0207674_10048747
1008 Ga0207674_10053181
1009 Ga0207674_10067721
1010 Ga0207675_100070459
1011 Ga0207683_10058659
1012 Ga0207683_10075606
1013 Ga0207683_10117290
1014 Ga0207683_10436421
1015 Ga0207698_10003520
1016 Ga0207698_10037010
1017 Ga0207698_10069847
1018 Ga0207698_10359933
1019 Ga0207698_10373039
1020 Ga0207698_10617294
1021 Ga0207428_10173053
1022 Ga0268266_10005443
1023 Ga0268265_10126345
1024 Ga0268264_10000105
1025 Ga0268264_10003731
1026 Ga0268264_10003887
1027 Ga0268264_10012385
1028 Ga0268264_10254766
1029 Ga0268264_11277044
1030 Ga0307515_10000190
1031 Ga0265327_10012523
1032 Ga0307513_10046944
1033 Ga0307513_10264577
1034 Ga0307513_10415718
1035 Ga0307513_10506009
1036 Ga0307513_10532264
1037 Ga0307408_101161455
1038 Ga0307508_10011571
1039 Ga0307516_10001379
1040 Ga0307507_10168630
1041 Ga0307510_10003610
1042 Ga0373955_0152035
1043 Ga0373935_0268381
1044 Ga0373927_0160003
1045 Ga0373947_0610666
1046 Ga0373937_0050719
1047 Ga0373937_0099570
1048 Ga0373937_0143636
1049 Ga0373937_0244773
1050 Ga0373925_0220750
1051 Ga0395899_0045814
1052 Ga0395900_0020435
1053 Ga0395905_0176292
1054 Ga0436365_1052711
1055 Ga0436365_1077961
1056 Ga0439436_0019396
1057 Ga0439436_0043707
1058 Ga0451802_1346588
1059 Ga0451833_0591057
1060 Ga0451845_0686587
1061 Ga0439442_007902
1062 Ga0439449_0014897
1063 Ga0439457_047020
1064 Ga0439462_0091908
1065 Ga0450922_006358
1066 Ga0450923_107344
1067 Ga0439446_0109164
1068 Ga0439434_0107341
1069 Ga0439434_0109255
1070 Ga0451577_0061124
1071 Ga0451577_0251788
1072 Ga0451577_0449942
1073 Ga0451577_0835648
1074 Ga0466969_0000244
1075 Ga0466972_0000011
1076 Ga0466972_0003024
1077 Ga0466966_0017726
1078 Ga0466961_0016976
1079 Ga0466964_0028126
1080 Ga0466964_0076007
1081 Ga0453684_0006196
1082 Ga0453684_0295857
1083 Ga0453684_0947206
1084 Ga0466971_0016800
1085 Ga0466971_0053354
1086 Ga0466970_0090108
1087 Ga0466970_0229291
1088 Ga0466970_0334776
1089 Ga0466957_0000218
1090 Ga0466957_0020990
1091 Ga0466960_0171154
1092 Ga0466959_0000039
1093 Ga0466959_0004171
1094 Ga0466958_0119347
1095 Ga0495592_0200274
1096 Ga0495629_0549349
1097 Ga0495580_0334582
1098 Ga0495606_0129160
1099 Ga0495608_0429829
1100 Ga0495630_0069116
1101 Ga0495652_0067790
1102 Ga0495586_0290687
1103 Ga0495667_0386575
1104 Ga0495634_0103090
1105 Ga0495611_0000983
1106 Ga0495657_0239976
1107 Ga0495657_0353296
1108 Ga0495646_0082683
1109 Ga0495647_0274515
1110 Ga0495674_0285910
1111 Ga0495675_0218665
1112 Ga0495675_0384218
1113 Ga0495686_0000016
1114 Ga0496104_0458513
1115 Ga0496105_0082646
1116 Ga0496108_0765268
1117 Ga0496109_0079110
1118 Ga0496110_0583305
1119 Ga0496115_0807860
1120 Ga0501032_0011621
1121 Ga0501033_0010981
1122 Ga0501034_0019547
1123 Ga0501034_0061244
1124 Ga0501034_0109211
1125 Ga0501034_0315740
1126 Ga0501036_0015703
1127 Ga0501036_0786596
1128 Ga0501037_0011454
1129 Ga0501037_0226749
1130 Ga0501037_0272104
1131 Ga0501038_0031846
1132 Ga0501038_0515662
1133 Ga0501043_0067826
1134 Ga0501043_0084398
1135 Ga0501046_0060700
1136 Ga0501047_0008167
1137 Ga0501047_0032597
1138 Ga0501047_0164028
1139 Ga0501047_0379798
1140 Ga0501067_0283732
1141 Ga0501068_0344340
1142 Ga0501069_0011943
1143 Ga0501073_0009700
1144 Ga0501073_0516548
1145 Ga0501219_000085
1146 Ga0501079_0057323
1147 Ga0501265_026840
1148 Ga0501280_014976
1149 Ga0501035_0052143
1150 Ga0501035_0904840
1151 Ga0501044_0011702
1152 Ga0501044_0019524
1153 Ga0501044_0031489
1154 Ga0501044_0074228
1155 Ga0501044_0218722
1156 Ga0501044_0254480
1157 Ga0501044_0453525
1158 Ga0501284_00074
1159 nmdc:mga0k408_156910_c1
1160 nmdc:mga07m45_239325_c1
1161 nmdc:mga05p37_143831_c1
1162 nmdc:mga05p37_970_c1
1163 nmdc:mga09592_5087_c1
1164 nmdc:mga06r32_7936_c1
1165 nmdc:mga08y16_1571933_c1
1166 nmdc:mga08y16_346884_c1
1167 Ga0495619_0093557
1168 Ga0500578_0000027
1169 Ga0500578_0337170
1170 Ga0500583_0000004
1171 Ga0500583_0004553
1172 Ga0500651_0108465
1173 Ga0500562_000007
1174 Ga0500568_0000374
1175 Ga0500568_0042545
1176 Ga0500573_0224858
1177 Ga0500604_0012960
1178 Ga0500616_0036711
1179 Ga0500622_0002683
1180 Ga0500622_0047466
1181 Ga0501084_0055796
1182 Ga0501082_0175300
1183 Ga0466962_0003550
1184 2738727589
1185 2819591002
1186 2929156266

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01712

dNK

Deoxynucleoside kinase

31

226

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zi3-assembly1.cif.gz_B c4s-e247a dck variant of dck in complex with d-da+adp 0.8744 4 196
4q1c-assembly1.cif.gz_A human dck c4s-s74e mutant in complex with udp and the inhibitor 8 {2,2'-[{4-[(2r)-4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-2,3-dihydro-1,3-thiazol-2-yl]benzene-1,2-diyl}bis(oxy)]diethanol} 0.8716 4 200
1p60-assembly1.cif.gz_B structure of human dck complexed with 2'-deoxycytidine and adp, space group c 2 2 21 0.8696 2 196
5mqt-assembly1.cif.gz_B crystal structure of dck mutant c3s in complex with imatinib and udp 0.8668 2 200
2no9-assembly1.cif.gz_B the structure of deoxycytidine kinase complexed with troxacitabine and adp. 0.8667 2 196
ID Description Score Start End Superfamily
af_Q2G0M0_4_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9153 5 196 3.40.50.300
af_Q54UT2_32_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.894 4 199 3.40.50.300
af_Q2G0M1_9_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8901 4 196 3.40.50.300
af_Q54YL2_23_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8851 6 198 3.40.50.300
af_Q2G0M0_4_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8845 5 196 3.40.50.300
ID Description Score Start End GO Terms
AF-G8TFB5-F1-model_v4 Deoxynucleoside kinase 0.9645 1 210 GO:0005524
GO:0005737
GO:0019136
AF-A0A661YPS8-F1-model_v4 deleted 0.9641 2 172
AF-A0A7X9KP01-F1-model_v4 Deoxynucleoside kinase 0.9629 1 176 GO:0005524
GO:0005737
GO:0019136
AF-A0A4U3L3J7-F1-model_v4 Deoxynucleoside kinase 0.9624 1 210 GO:0005524
GO:0005737
GO:0019136
AF-A0A2E3VP59-F1-model_v4 deleted 0.962 2 197

Map