F467281
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 259 | 1186 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300053146|Ga0500588_0097763|Ga0500588_0097763_262_969 |
| Length | 235 |
| Sequence | MPRPAACEKVFPAITVEGSTIATENMNHHFITVEGNIGAGKTTLAHLLARHYNARLILEAFADNPFLPKFYENPQQFAFPLELFFMAERYKQLKELVHTKDLFQSLTISDYLFTKCLLFAKVNLPEEEFHLYQRLFEIIHQQLVQPDILIYLHAPVSKLQANIKKRNRSYEQHIPDEYLFNIQQTYTHYIKQHNIKTLFIDASNADFLGNEKHLKVITDALEKDLSDGQHYFTLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 171 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 173 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 174 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 177 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 178 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 179 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 180 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 234 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 246 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 247 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 248 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 251 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 252 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 253 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 257 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 258 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 259 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0 |
| Isolates | 0.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.87 |
| Nodule | 0 |
| Rhizoplane | 1.18 |
| Rhizosphere | 91.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500588_0097763 | 3300053146 | Bacteria | 1007 |
| 2 | rootH1_10040138 | 3300003316 | Bacteria | 3484 |
| 3 | rootH2_10011709 | 3300003320 | Bacteria | 6738 |
| 4 | rootH2_10215871 | 3300003320 | Bacteria | 4787 |
| 5 | rootH2_10250303 | 3300003320 | Unclassified | 1003 |
| 6 | rootL2_10184856 | 3300003322 | Bacteria | 5341 |
| 7 | rootL2_10307192 | 3300003322 | Bacteria | 2975 |
| 8 | rootH1_10022476 | 3300003323 | Bacteria | 4396 |
| 9 | Ga0065712_10093279 | 3300005290 | Bacteria | 2299 |
| 10 | Ga0065707_10246388 | 3300005295 | Bacteria | 1139 |
| 11 | Ga0070658_10103063 | 3300005327 | Bacteria | 2360 |
| 12 | Ga0070676_10000263 | 3300005328 | Bacteria | 22940 |
| 13 | Ga0070676_10017885 | 3300005328 | Bacteria | 3925 |
| 14 | Ga0070683_100003859 | 3300005329 | Bacteria | 12252 |
| 15 | Ga0070683_100004278 | 3300005329 | Bacteria | 11723 |
| 16 | Ga0070683_100087498 | 3300005329 | Unclassified | 2922 |
| 17 | Ga0070683_100216667 | 3300005329 | Bacteria | 1819 |
| 18 | Ga0070670_100052282 | 3300005331 | Unclassified | 3508 |
| 19 | Ga0070670_100116528 | 3300005331 | Bacteria | 2303 |
| 20 | Ga0068869_100007877 | 3300005334 | Bacteria | 6837 |
| 21 | Ga0068869_100017657 | 3300005334 | Bacteria | 4841 |
| 22 | Ga0068869_100120963 | 3300005334 | Unclassified | 2002 |
| 23 | Ga0068869_100489860 | 3300005334 | Bacteria | 1025 |
| 24 | Ga0070666_10001269 | 3300005335 | Bacteria | 15275 |
| 25 | Ga0070666_10004806 | 3300005335 | Bacteria | 8262 |
| 26 | Ga0070680_100000693 | 3300005336 | Bacteria | 23394 |
| 27 | Ga0070682_100001134 | 3300005337 | Bacteria | 15189 |
| 28 | Ga0068868_100001950 | 3300005338 | Bacteria | 14152 |
| 29 | Ga0068868_100003187 | 3300005338 | Bacteria | 11411 |
| 30 | Ga0068868_100043145 | 3300005338 | Unclassified | 3523 |
| 31 | Ga0068868_100162186 | 3300005338 | Unclassified | 1847 |
| 32 | Ga0070660_100077797 | 3300005339 | Unclassified | 2600 |
| 33 | Ga0070691_10002457 | 3300005341 | Bacteria | 8227 |
| 34 | Ga0070691_10003801 | 3300005341 | Bacteria | 6818 |
| 35 | Ga0070668_100000106 | 3300005347 | Bacteria | 51244 |
| 36 | Ga0070669_100279078 | 3300005353 | Bacteria | 1338 |
| 37 | Ga0070669_100466308 | 3300005353 | Bacteria | 1043 |
| 38 | Ga0070675_100209802 | 3300005354 | Bacteria | 1693 |
| 39 | Ga0070675_100680802 | 3300005354 | Unclassified | 936 |
| 40 | Ga0070671_100013240 | 3300005355 | Bacteria | 6646 |
| 41 | Ga0070671_100077412 | 3300005355 | Bacteria | 2779 |
| 42 | Ga0070671_100257606 | 3300005355 | Bacteria | 1482 |
| 43 | Ga0070671_100276292 | 3300005355 | Bacteria | 1428 |
| 44 | Ga0070674_100059587 | 3300005356 | Bacteria | 2658 |
| 45 | Ga0070674_100122503 | 3300005356 | Bacteria | 1927 |
| 46 | Ga0070674_100422023 | 3300005356 | Bacteria | 1094 |
| 47 | Ga0070673_100000229 | 3300005364 | Bacteria | 28088 |
| 48 | Ga0070673_100017775 | 3300005364 | Bacteria | 5066 |
| 49 | Ga0070673_100035166 | 3300005364 | Unclassified | 3796 |
| 50 | Ga0070673_100038535 | 3300005364 | Bacteria | 3651 |
| 51 | Ga0070673_100106332 | 3300005364 | Unclassified | 2320 |
| 52 | Ga0070673_100493711 | 3300005364 | Bacteria | 1106 |
| 53 | Ga0070688_100005254 | 3300005365 | Bacteria | 6806 |
| 54 | Ga0070659_100032620 | 3300005366 | Bacteria | 4041 |
| 55 | Ga0070667_100000931 | 3300005367 | Bacteria | 27021 |
| 56 | Ga0070667_100001521 | 3300005367 | Bacteria | 20766 |
| 57 | Ga0070667_100143861 | 3300005367 | Unclassified | 2090 |
| 58 | Ga0070700_100491204 | 3300005441 | Bacteria | 942 |
| 59 | Ga0070663_100104642 | 3300005455 | Unclassified | 2117 |
| 60 | Ga0070662_100009238 | 3300005457 | Bacteria | 6440 |
| 61 | Ga0070681_10008908 | 3300005458 | Bacteria | 9864 |
| 62 | Ga0068867_100009241 | 3300005459 | Bacteria | 6956 |
| 63 | Ga0068867_100035369 | 3300005459 | Bacteria | 3623 |
| 64 | Ga0068867_100811839 | 3300005459 | Bacteria | 835 |
| 65 | Ga0070685_10105477 | 3300005466 | Unclassified | 1727 |
| 66 | Ga0070698_100174488 | 3300005471 | Bacteria | 2090 |
| 67 | Ga0070698_100207989 | 3300005471 | Bacteria | 1892 |
| 68 | Ga0070679_100025591 | 3300005530 | Bacteria | 5793 |
| 69 | Ga0070684_100001995 | 3300005535 | Bacteria | 15009 |
| 70 | Ga0070684_100010684 | 3300005535 | Bacteria | 7282 |
| 71 | Ga0070684_100027031 | 3300005535 | Bacteria | 4838 |
| 72 | Ga0068853_100005763 | 3300005539 | Bacteria | 9753 |
| 73 | Ga0068853_100010845 | 3300005539 | Bacteria | 7382 |
| 74 | Ga0068853_100127625 | 3300005539 | Bacteria | 2274 |
| 75 | Ga0068853_100180102 | 3300005539 | Unclassified | 1916 |
| 76 | Ga0068853_100240249 | 3300005539 | Bacteria | 1660 |
| 77 | Ga0068853_100654044 | 3300005539 | Bacteria | 1000 |
| 78 | Ga0068853_101173106 | 3300005539 | Bacteria | 741 |
| 79 | Ga0070672_100000325 | 3300005543 | Bacteria | 27226 |
| 80 | Ga0070672_100054719 | 3300005543 | Bacteria | 3125 |
| 81 | Ga0070672_100799322 | 3300005543 | Unclassified | 830 |
| 82 | Ga0070686_100151912 | 3300005544 | Bacteria | 1623 |
| 83 | Ga0070695_100282936 | 3300005545 | Bacteria | 1219 |
| 84 | Ga0070693_100023255 | 3300005547 | Bacteria | 3310 |
| 85 | Ga0070665_100000570 | 3300005548 | Bacteria | 51526 |
| 86 | Ga0068855_100017655 | 3300005563 | Bacteria | 8580 |
| 87 | Ga0068855_100057754 | 3300005563 | Bacteria | 4548 |
| 88 | Ga0068855_100070410 | 3300005563 | Bacteria | 4069 |
| 89 | Ga0068855_100077031 | 3300005563 | Bacteria | 3869 |
| 90 | Ga0068855_100321563 | 3300005563 | Bacteria | 1710 |
| 91 | Ga0068855_100432613 | 3300005563 | Unclassified | 1438 |
| 92 | Ga0068855_100673530 | 3300005563 | Bacteria | 1109 |
| 93 | Ga0068855_100777377 | 3300005563 | Bacteria | 1019 |
| 94 | Ga0070664_100002506 | 3300005564 | Bacteria | 14800 |
| 95 | Ga0070664_100023310 | 3300005564 | Bacteria | 5111 |
| 96 | Ga0070664_100121278 | 3300005564 | Bacteria | 2289 |
| 97 | Ga0070664_100266265 | 3300005564 | Bacteria | 1543 |
| 98 | Ga0070664_100343503 | 3300005564 | Bacteria | 1356 |
| 99 | Ga0068857_100023691 | 3300005577 | Bacteria | 5404 |
| 100 | Ga0068857_100039837 | 3300005577 | Bacteria | 4164 |
| 101 | Ga0068857_100045150 | 3300005577 | Bacteria | 3908 |
| 102 | Ga0068857_100516567 | 3300005577 | Bacteria | 1122 |
| 103 | Ga0068857_101317288 | 3300005577 | Bacteria | 701 |
| 104 | Ga0068854_100022248 | 3300005578 | Bacteria | 4315 |
| 105 | Ga0068854_100118958 | 3300005578 | Bacteria | 2003 |
| 106 | Ga0068854_101179282 | 3300005578 | Bacteria | 685 |
| 107 | Ga0068856_100015173 | 3300005614 | Bacteria | 7442 |
| 108 | Ga0068856_100179527 | 3300005614 | Bacteria | 2130 |
| 109 | Ga0068856_100194848 | 3300005614 | Bacteria | 2040 |
| 110 | Ga0068856_100197494 | 3300005614 | Unclassified | 2026 |
| 111 | Ga0068852_100002840 | 3300005616 | Bacteria | 12011 |
| 112 | Ga0068852_100051922 | 3300005616 | Bacteria | 3522 |
| 113 | Ga0068852_100070235 | 3300005616 | Unclassified | 3072 |
| 114 | Ga0068852_100167519 | 3300005616 | Bacteria | 2057 |
| 115 | Ga0068852_100326214 | 3300005616 | Unclassified | 1492 |
| 116 | Ga0068852_100706251 | 3300005616 | Bacteria | 1019 |
| 117 | Ga0068859_100000106 | 3300005617 | Bacteria | 78128 |
| 118 | Ga0068859_100258764 | 3300005617 | Bacteria | 1831 |
| 119 | Ga0068864_100001209 | 3300005618 | Bacteria | 21452 |
| 120 | Ga0068864_100009738 | 3300005618 | Bacteria | 7925 |
| 121 | Ga0068864_100052879 | 3300005618 | Unclassified | 3501 |
| 122 | Ga0068864_100159975 | 3300005618 | Bacteria | 2046 |
| 123 | Ga0068861_100105564 | 3300005719 | Bacteria | 2249 |
| 124 | Ga0068861_100120195 | 3300005719 | Unclassified | 2118 |
| 125 | Ga0068861_101267419 | 3300005719 | Bacteria | 715 |
| 126 | Ga0068851_10020273 | 3300005834 | Unclassified | 3217 |
| 127 | Ga0068851_10114644 | 3300005834 | Unclassified | 1442 |
| 128 | Ga0068863_100000567 | 3300005841 | Bacteria | 37587 |
| 129 | Ga0068863_100003303 | 3300005841 | Bacteria | 15923 |
| 130 | Ga0068863_100036503 | 3300005841 | Unclassified | 4682 |
| 131 | Ga0068863_100139222 | 3300005841 | Bacteria | 2319 |
| 132 | Ga0068863_100143875 | 3300005841 | Bacteria | 2280 |
| 133 | Ga0068858_100001322 | 3300005842 | Bacteria | 25607 |
| 134 | Ga0068858_100080098 | 3300005842 | Bacteria | 3034 |
| 135 | Ga0068858_100285677 | 3300005842 | Unclassified | 1571 |
| 136 | Ga0068860_100000078 | 3300005843 | Bacteria | 171062 |
| 137 | Ga0068860_100005302 | 3300005843 | Bacteria | 13092 |
| 138 | Ga0068860_100014141 | 3300005843 | Bacteria | 7828 |
| 139 | Ga0068860_100073895 | 3300005843 | Bacteria | 3241 |
| 140 | Ga0068860_100084825 | 3300005843 | Bacteria | 3013 |
| 141 | Ga0068860_100617311 | 3300005843 | Bacteria | 1091 |
| 142 | Ga0068860_100671103 | 3300005843 | Bacteria | 1045 |
| 143 | Ga0068862_100074774 | 3300005844 | Bacteria | 2929 |
| 144 | Ga0081540_1003562 | 3300005983 | Bacteria | 12251 |
| 145 | Ga0075366_10060669 | 3300006195 | Bacteria | 2247 |
| 146 | Ga0097621_100015299 | 3300006237 | Bacteria | 5770 |
| 147 | Ga0097621_100088978 | 3300006237 | Unclassified | 2581 |
| 148 | Ga0097621_100296479 | 3300006237 | Bacteria | 1427 |
| 149 | Ga0097621_100331370 | 3300006237 | Bacteria | 1350 |
| 150 | Ga0068871_100002881 | 3300006358 | Bacteria | 11796 |
| 151 | Ga0068871_100019773 | 3300006358 | Bacteria | 5146 |
| 152 | Ga0068871_100143635 | 3300006358 | Bacteria | 2031 |
| 153 | Ga0075428_100193784 | 3300006844 | Unclassified | 2198 |
| 154 | Ga0075431_100020645 | 3300006847 | Bacteria | 6731 |
| 155 | Ga0068865_100000299 | 3300006881 | Bacteria | 27298 |
| 156 | Ga0097620_100000106 | 3300006931 | Bacteria | 78128 |
| 157 | Ga0097620_100258755 | 3300006931 | Bacteria | 1831 |
| 158 | Ga0105240_10000023 | 3300009093 | Bacteria | 385028 |
| 159 | Ga0105240_10000281 | 3300009093 | Bacteria | 100881 |
| 160 | Ga0105240_10002290 | 3300009093 | Bacteria | 31019 |
| 161 | Ga0105240_10009884 | 3300009093 | Bacteria | 13461 |
| 162 | Ga0105240_10014873 | 3300009093 | Bacteria | 10605 |
| 163 | Ga0105240_10024146 | 3300009093 | Bacteria | 8023 |
| 164 | Ga0105240_10029485 | 3300009093 | Bacteria | 7148 |
| 165 | Ga0105240_10061859 | 3300009093 | Bacteria | 4663 |
| 166 | Ga0105240_10137465 | 3300009093 | Bacteria | 2925 |
| 167 | Ga0105240_10210681 | 3300009093 | Bacteria | 2271 |
| 168 | Ga0105240_10375389 | 3300009093 | Unclassified | 1607 |
| 169 | Ga0105240_10509767 | 3300009093 | Unclassified | 1337 |
| 170 | Ga0105240_10616852 | 3300009093 | Bacteria | 1192 |
| 171 | Ga0111539_10087426 | 3300009094 | Bacteria | 3662 |
| 172 | Ga0105245_10144272 | 3300009098 | Bacteria | 2245 |
| 173 | Ga0105245_10366720 | 3300009098 | Unclassified | 1431 |
| 174 | Ga0105247_10121257 | 3300009101 | Unclassified | 1694 |
| 175 | Ga0105247_10172210 | 3300009101 | Bacteria | 1440 |
| 176 | Ga0105247_10379798 | 3300009101 | Unclassified | 1001 |
| 177 | Ga0114129_10011005 | 3300009147 | Bacteria | 12889 |
| 178 | Ga0114129_10084409 | 3300009147 | Bacteria | 4410 |
| 179 | Ga0105241_10008817 | 3300009174 | Bacteria | 7411 |
| 180 | Ga0105241_10040164 | 3300009174 | Bacteria | 3532 |
| 181 | Ga0105241_10048098 | 3300009174 | Bacteria | 3244 |
| 182 | Ga0105241_10311933 | 3300009174 | Bacteria | 1353 |
| 183 | Ga0105241_10350772 | 3300009174 | Bacteria | 1281 |
| 184 | Ga0105241_10559358 | 3300009174 | Unclassified | 1028 |
| 185 | Ga0105241_10885722 | 3300009174 | Unclassified | 828 |
| 186 | Ga0105242_10022831 | 3300009176 | Bacteria | 4926 |
| 187 | Ga0105242_10860851 | 3300009176 | Bacteria | 903 |
| 188 | Ga0105242_11114501 | 3300009176 | Bacteria | 804 |
| 189 | Ga0105248_10005891 | 3300009177 | Bacteria | 13473 |
| 190 | Ga0105237_10000261 | 3300009545 | Bacteria | 74745 |
| 191 | Ga0105237_10001123 | 3300009545 | Bacteria | 35881 |
| 192 | Ga0105237_10003683 | 3300009545 | Bacteria | 18058 |
| 193 | Ga0105237_10015708 | 3300009545 | Bacteria | 7871 |
| 194 | Ga0105237_10062344 | 3300009545 | Bacteria | 3728 |
| 195 | Ga0105237_10073006 | 3300009545 | Bacteria | 3424 |
| 196 | Ga0105237_10126341 | 3300009545 | Bacteria | 2551 |
| 197 | Ga0105237_10415234 | 3300009545 | Bacteria | 1351 |
| 198 | Ga0105238_10025613 | 3300009551 | Bacteria | 6013 |
| 199 | Ga0105238_10050805 | 3300009551 | Unclassified | 4173 |
| 200 | Ga0105238_10177648 | 3300009551 | Unclassified | 2106 |
| 201 | Ga0105238_10219439 | 3300009551 | Unclassified | 1877 |
| 202 | Ga0105238_10256400 | 3300009551 | Unclassified | 1728 |
| 203 | Ga0105238_10301311 | 3300009551 | Bacteria | 1586 |
| 204 | Ga0105249_10002874 | 3300009553 | Bacteria | 14864 |
| 205 | Ga0105249_10004490 | 3300009553 | Bacteria | 12063 |
| 206 | Ga0105249_10628398 | 3300009553 | Unclassified | 1130 |
| 207 | Ga0105239_10000345 | 3300010375 | Bacteria | 67861 |
| 208 | Ga0105239_10002155 | 3300010375 | Bacteria | 25331 |
| 209 | Ga0105239_10015165 | 3300010375 | Bacteria | 8540 |
| 210 | Ga0105239_10019999 | 3300010375 | Bacteria | 7388 |
| 211 | Ga0105239_10022156 | 3300010375 | Bacteria | 7002 |
| 212 | Ga0105239_10138170 | 3300010375 | Unclassified | 2714 |
| 213 | Ga0105246_10096265 | 3300011119 | Unclassified | 2145 |
| 214 | Ga0105246_10168894 | 3300011119 | Bacteria | 1673 |
| 215 | Ga0157373_10000489 | 3300013100 | Bacteria | 31312 |
| 216 | Ga0157373_10100299 | 3300013100 | Bacteria | 2038 |
| 217 | Ga0157373_10567530 | 3300013100 | Unclassified | 824 |
| 218 | Ga0157371_10024966 | 3300013102 | Bacteria | 4362 |
| 219 | Ga0157371_10030010 | 3300013102 | Bacteria | 3924 |
| 220 | Ga0157371_10033027 | 3300013102 | Unclassified | 3720 |
| 221 | Ga0157370_10001887 | 3300013104 | Bacteria | 25802 |
| 222 | Ga0157370_10013074 | 3300013104 | Bacteria | 8568 |
| 223 | Ga0157370_10046983 | 3300013104 | Bacteria | 4139 |
| 224 | Ga0157370_10188546 | 3300013104 | Bacteria | 1914 |
| 225 | Ga0157370_10554644 | 3300013104 | Unclassified | 1053 |
| 226 | Ga0157369_10004105 | 3300013105 | Bacteria | 17247 |
| 227 | Ga0157369_10035765 | 3300013105 | Bacteria | 5445 |
| 228 | Ga0157369_10280244 | 3300013105 | Unclassified | 1736 |
| 229 | Ga0157369_10383465 | 3300013105 | Bacteria | 1459 |
| 230 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 231 | Ga0157374_10000089 | 3300013296 | Bacteria | 89250 |
| 232 | Ga0157374_10018673 | 3300013296 | Bacteria | 6125 |
| 233 | Ga0157378_10005286 | 3300013297 | Bacteria | 11339 |
| 234 | Ga0157378_10013042 | 3300013297 | Bacteria | 7269 |
| 235 | Ga0157378_10055412 | 3300013297 | Bacteria | 3532 |
| 236 | Ga0157378_10163789 | 3300013297 | Bacteria | 2081 |
| 237 | Ga0157378_10224091 | 3300013297 | Bacteria | 1788 |
| 238 | Ga0157378_10287443 | 3300013297 | Bacteria | 1587 |
| 239 | Ga0163162_10000084 | 3300013306 | Bacteria | 86252 |
| 240 | Ga0163162_10000624 | 3300013306 | Bacteria | 32874 |
| 241 | Ga0163162_10000972 | 3300013306 | Bacteria | 26646 |
| 242 | Ga0163162_10013609 | 3300013306 | Bacteria | 7948 |
| 243 | Ga0163162_10241613 | 3300013306 | Unclassified | 1937 |
| 244 | Ga0157372_10001814 | 3300013307 | Bacteria | 23160 |
| 245 | Ga0157372_10062059 | 3300013307 | Unclassified | 4186 |
| 246 | Ga0157372_10063614 | 3300013307 | Unclassified | 4138 |
| 247 | Ga0157372_10065892 | 3300013307 | Bacteria | 4069 |
| 248 | Ga0157372_10073967 | 3300013307 | Unclassified | 3841 |
| 249 | Ga0157372_10092527 | 3300013307 | Bacteria | 3440 |
| 250 | Ga0157372_10209595 | 3300013307 | Bacteria | 2258 |
| 251 | Ga0157372_10279351 | 3300013307 | Bacteria | 1941 |
| 252 | Ga0157372_10671706 | 3300013307 | Bacteria | 1206 |
| 253 | Ga0157375_10000057 | 3300013308 | Bacteria | 122654 |
| 254 | Ga0157375_10015071 | 3300013308 | Bacteria | 6913 |
| 255 | Ga0157375_10029151 | 3300013308 | Bacteria | 5186 |
| 256 | Ga0157375_10038254 | 3300013308 | Bacteria | 4606 |
| 257 | Ga0157375_10168438 | 3300013308 | Unclassified | 2337 |
| 258 | Ga0163163_10000804 | 3300014325 | Bacteria | 26629 |
| 259 | Ga0163163_10014347 | 3300014325 | Bacteria | 7283 |
| 260 | Ga0163163_10178860 | 3300014325 | Bacteria | 2168 |
| 261 | Ga0163163_10191920 | 3300014325 | Unclassified | 2091 |
| 262 | Ga0163163_11281841 | 3300014325 | Bacteria | 795 |
| 263 | Ga0157380_10006684 | 3300014326 | Bacteria | 8142 |
| 264 | Ga0157380_10139444 | 3300014326 | Bacteria | 2081 |
| 265 | Ga0157380_10272033 | 3300014326 | Unclassified | 1545 |
| 266 | Ga0157380_11169535 | 3300014326 | Unclassified | 811 |
| 267 | Ga0157377_10087715 | 3300014745 | Bacteria | 1831 |
| 268 | Ga0157379_10000032 | 3300014968 | Bacteria | 83845 |
| 269 | Ga0157379_10098322 | 3300014968 | Bacteria | 2627 |
| 270 | Ga0157379_10112568 | 3300014968 | Unclassified | 2446 |
| 271 | Ga0157379_10157515 | 3300014968 | Unclassified | 2049 |
| 272 | Ga0157379_10213885 | 3300014968 | Unclassified | 1746 |
| 273 | Ga0157379_10269379 | 3300014968 | Unclassified | 1548 |
| 274 | Ga0157376_10000318 | 3300014969 | Bacteria | 32314 |
| 275 | Ga0157376_10031895 | 3300014969 | Bacteria | 4225 |
| 276 | Ga0157376_10041388 | 3300014969 | Bacteria | 3771 |
| 277 | Ga0157376_10052117 | 3300014969 | Bacteria | 3401 |
| 278 | Ga0157376_10473199 | 3300014969 | Bacteria | 1226 |
| 279 | Ga0157376_10473342 | 3300014969 | Bacteria | 1226 |
| 280 | Ga0157376_10813269 | 3300014969 | Bacteria | 948 |
| 281 | Ga0182005_1030952 | 3300015265 | Bacteria | 1458 |
| 282 | Ga0163161_10030785 | 3300017792 | Unclassified | 3822 |
| 283 | Ga0163161_10092713 | 3300017792 | Bacteria | 2237 |
| 284 | Ga0213876_10002070 | 3300021384 | Bacteria | 11887 |
| 285 | Ga0213876_10033800 | 3300021384 | Bacteria | 2696 |
| 286 | Ga0209646_1003036 | 3300025246 | Bacteria | 3446 |
| 287 | Ga0207697_10069725 | 3300025315 | Bacteria | 1472 |
| 288 | Ga0207697_10106373 | 3300025315 | Bacteria | 1199 |
| 289 | Ga0207656_10026563 | 3300025321 | Unclassified | 2362 |
| 290 | Ga0207682_10030531 | 3300025893 | Bacteria | 2159 |
| 291 | Ga0207710_10110945 | 3300025900 | Unclassified | 1302 |
| 292 | Ga0207680_10000125 | 3300025903 | Bacteria | 35925 |
| 293 | Ga0207647_10014949 | 3300025904 | Bacteria | 5334 |
| 294 | Ga0207647_10021474 | 3300025904 | Unclassified | 4309 |
| 295 | Ga0207647_10094092 | 3300025904 | Unclassified | 1785 |
| 296 | Ga0207645_10000638 | 3300025907 | Bacteria | 29117 |
| 297 | Ga0207643_10094115 | 3300025908 | Bacteria | 1750 |
| 298 | Ga0207705_10002058 | 3300025909 | Bacteria | 15638 |
| 299 | Ga0207654_10045309 | 3300025911 | Bacteria | 2502 |
| 300 | Ga0207654_10172768 | 3300025911 | Bacteria | 1404 |
| 301 | Ga0207654_10400034 | 3300025911 | Unclassified | 955 |
| 302 | Ga0207707_10001194 | 3300025912 | Bacteria | 24438 |
| 303 | Ga0207707_10058317 | 3300025912 | Bacteria | 3360 |
| 304 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 305 | Ga0207695_10000128 | 3300025913 | Bacteria | 226098 |
| 306 | Ga0207695_10000296 | 3300025913 | Bacteria | 123322 |
| 307 | Ga0207695_10022769 | 3300025913 | Bacteria | 7099 |
| 308 | Ga0207695_10063191 | 3300025913 | Bacteria | 3818 |
| 309 | Ga0207695_10125536 | 3300025913 | Bacteria | 2529 |
| 310 | Ga0207695_10237715 | 3300025913 | Bacteria | 1724 |
| 311 | Ga0207695_10299981 | 3300025913 | Unclassified | 1498 |
| 312 | Ga0207671_10001029 | 3300025914 | Bacteria | 33967 |
| 313 | Ga0207671_10009779 | 3300025914 | Bacteria | 7980 |
| 314 | Ga0207671_10126635 | 3300025914 | Bacteria | 1957 |
| 315 | Ga0207671_10209717 | 3300025914 | Bacteria | 1523 |
| 316 | Ga0207660_10023829 | 3300025917 | Unclassified | 4137 |
| 317 | Ga0207657_10109630 | 3300025919 | Unclassified | 2281 |
| 318 | Ga0207649_10446468 | 3300025920 | Unclassified | 975 |
| 319 | Ga0207649_10593743 | 3300025920 | Unclassified | 851 |
| 320 | Ga0207652_10002054 | 3300025921 | Bacteria | 17328 |
| 321 | Ga0207681_10843348 | 3300025923 | Bacteria | 766 |
| 322 | Ga0207694_10165333 | 3300025924 | Bacteria | 1789 |
| 323 | Ga0207694_10220280 | 3300025924 | Unclassified | 1548 |
| 324 | Ga0207694_10982428 | 3300025924 | Unclassified | 714 |
| 325 | Ga0207650_10021737 | 3300025925 | Bacteria | 4536 |
| 326 | Ga0207650_10024854 | 3300025925 | Unclassified | 4264 |
| 327 | Ga0207650_10236709 | 3300025925 | Bacteria | 1474 |
| 328 | Ga0207650_10606368 | 3300025925 | Bacteria | 921 |
| 329 | Ga0207659_10033521 | 3300025926 | Bacteria | 3535 |
| 330 | Ga0207659_10650160 | 3300025926 | Unclassified | 901 |
| 331 | Ga0207687_10248283 | 3300025927 | Unclassified | 1413 |
| 332 | Ga0207644_10058900 | 3300025931 | Unclassified | 2777 |
| 333 | Ga0207644_10110786 | 3300025931 | Bacteria | 2075 |
| 334 | Ga0207644_10205744 | 3300025931 | Bacteria | 1554 |
| 335 | Ga0207690_10025692 | 3300025932 | Bacteria | 3702 |
| 336 | Ga0207690_10057660 | 3300025932 | Bacteria | 2624 |
| 337 | Ga0207706_10007388 | 3300025933 | Bacteria | 10158 |
| 338 | Ga0207706_10039794 | 3300025933 | Unclassified | 4168 |
| 339 | Ga0207706_10117833 | 3300025933 | Bacteria | 2335 |
| 340 | Ga0207706_10315637 | 3300025933 | Bacteria | 1360 |
| 341 | Ga0207686_10078238 | 3300025934 | Unclassified | 2150 |
| 342 | Ga0207670_10287078 | 3300025936 | Unclassified | 1284 |
| 343 | Ga0207669_10060010 | 3300025937 | Bacteria | 2329 |
| 344 | Ga0207669_10186785 | 3300025937 | Bacteria | 1491 |
| 345 | Ga0207704_10547495 | 3300025938 | Bacteria | 940 |
| 346 | Ga0207704_10677686 | 3300025938 | Bacteria | 852 |
| 347 | Ga0207691_10000014 | 3300025940 | Bacteria | 142542 |
| 348 | Ga0207691_10010650 | 3300025940 | Bacteria | 8824 |
| 349 | Ga0207691_10068604 | 3300025940 | Bacteria | 3203 |
| 350 | Ga0207691_10764289 | 3300025940 | Bacteria | 813 |
| 351 | Ga0207711_10990229 | 3300025941 | Unclassified | 780 |
| 352 | Ga0207689_10000853 | 3300025942 | Bacteria | 29374 |
| 353 | Ga0207689_10002211 | 3300025942 | Bacteria | 18237 |
| 354 | Ga0207689_10004402 | 3300025942 | Bacteria | 12804 |
| 355 | Ga0207689_10140956 | 3300025942 | Unclassified | 1986 |
| 356 | Ga0207661_10012502 | 3300025944 | Bacteria | 6169 |
| 357 | Ga0207661_10553957 | 3300025944 | Unclassified | 1053 |
| 358 | Ga0207679_10001197 | 3300025945 | Bacteria | 16487 |
| 359 | Ga0207679_10060263 | 3300025945 | Unclassified | 2819 |
| 360 | Ga0207679_10153517 | 3300025945 | Bacteria | 1877 |
| 361 | Ga0207679_10288993 | 3300025945 | Bacteria | 1409 |
| 362 | Ga0207667_10000143 | 3300025949 | Bacteria | 108717 |
| 363 | Ga0207667_10002746 | 3300025949 | Bacteria | 21763 |
| 364 | Ga0207667_10015337 | 3300025949 | Bacteria | 8711 |
| 365 | Ga0207667_10056411 | 3300025949 | Bacteria | 4127 |
| 366 | Ga0207667_10291910 | 3300025949 | Bacteria | 1666 |
| 367 | Ga0207667_10369207 | 3300025949 | Bacteria | 1462 |
| 368 | Ga0207667_10427435 | 3300025949 | Unclassified | 1347 |
| 369 | Ga0207667_10637976 | 3300025949 | Bacteria | 1072 |
| 370 | Ga0207651_10000826 | 3300025960 | Bacteria | 13415 |
| 371 | Ga0207651_10042111 | 3300025960 | Bacteria | 3037 |
| 372 | Ga0207651_10146854 | 3300025960 | Unclassified | 1830 |
| 373 | Ga0207651_10169089 | 3300025960 | Bacteria | 1722 |
| 374 | Ga0207712_10002069 | 3300025961 | Bacteria | 13179 |
| 375 | Ga0207712_10012835 | 3300025961 | Bacteria | 5358 |
| 376 | Ga0207712_10457286 | 3300025961 | Unclassified | 1084 |
| 377 | Ga0207668_10000124 | 3300025972 | Bacteria | 54437 |
| 378 | Ga0207668_10183958 | 3300025972 | Unclassified | 1651 |
| 379 | Ga0207668_10291744 | 3300025972 | Bacteria | 1342 |
| 380 | Ga0207640_10485806 | 3300025981 | Bacteria | 1025 |
| 381 | Ga0207658_10000242 | 3300025986 | Bacteria | 57191 |
| 382 | Ga0207658_10010441 | 3300025986 | Bacteria | 6307 |
| 383 | Ga0207658_10847830 | 3300025986 | Unclassified | 831 |
| 384 | Ga0207677_10003043 | 3300026023 | Bacteria | 8867 |
| 385 | Ga0207677_10005391 | 3300026023 | Bacteria | 6938 |
| 386 | Ga0207677_10030799 | 3300026023 | Unclassified | 3430 |
| 387 | Ga0207703_10000735 | 3300026035 | Bacteria | 32229 |
| 388 | Ga0207703_10003904 | 3300026035 | Bacteria | 12380 |
| 389 | Ga0207703_10180578 | 3300026035 | Unclassified | 1862 |
| 390 | Ga0207639_10008018 | 3300026041 | Bacteria | 7216 |
| 391 | Ga0207639_10037426 | 3300026041 | Bacteria | 3603 |
| 392 | Ga0207639_10140366 | 3300026041 | Unclassified | 2012 |
| 393 | Ga0207639_10176785 | 3300026041 | Unclassified | 1812 |
| 394 | Ga0207678_10017896 | 3300026067 | Bacteria | 6225 |
| 395 | Ga0207678_10123011 | 3300026067 | Unclassified | 2214 |
| 396 | Ga0207678_10180545 | 3300026067 | Bacteria | 1802 |
| 397 | Ga0207702_10067599 | 3300026078 | Bacteria | 3068 |
| 398 | Ga0207702_10163484 | 3300026078 | Unclassified | 2034 |
| 399 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 400 | Ga0207641_10013162 | 3300026088 | Bacteria | 6782 |
| 401 | Ga0207641_10015499 | 3300026088 | Bacteria | 6246 |
| 402 | Ga0207641_10123075 | 3300026088 | Bacteria | 2318 |
| 403 | Ga0207641_10483665 | 3300026088 | Bacteria | 1200 |
| 404 | Ga0207648_10028788 | 3300026089 | Unclassified | 4924 |
| 405 | Ga0207648_10046144 | 3300026089 | Bacteria | 3820 |
| 406 | Ga0207648_10124845 | 3300026089 | Bacteria | 2264 |
| 407 | Ga0207648_10319854 | 3300026089 | Unclassified | 1394 |
| 408 | Ga0207676_10005134 | 3300026095 | Bacteria | 9267 |
| 409 | Ga0207676_10010368 | 3300026095 | Bacteria | 6635 |
| 410 | Ga0207676_10123859 | 3300026095 | Bacteria | 2185 |
| 411 | Ga0207676_10371361 | 3300026095 | Bacteria | 1329 |
| 412 | Ga0207674_10002304 | 3300026116 | Bacteria | 24174 |
| 413 | Ga0207674_10013597 | 3300026116 | Bacteria | 9017 |
| 414 | Ga0207674_10048747 | 3300026116 | Unclassified | 4334 |
| 415 | Ga0207674_10053181 | 3300026116 | Bacteria | 4128 |
| 416 | Ga0207674_10067721 | 3300026116 | Bacteria | 3593 |
| 417 | Ga0207675_100070459 | 3300026118 | Unclassified | 3268 |
| 418 | Ga0207683_10058659 | 3300026121 | Bacteria | 3380 |
| 419 | Ga0207683_10075606 | 3300026121 | Bacteria | 2981 |
| 420 | Ga0207683_10117290 | 3300026121 | Bacteria | 2387 |
| 421 | Ga0207683_10436421 | 3300026121 | Bacteria | 1207 |
| 422 | Ga0207698_10003520 | 3300026142 | Bacteria | 9440 |
| 423 | Ga0207698_10037010 | 3300026142 | Unclassified | 3589 |
| 424 | Ga0207698_10069847 | 3300026142 | Bacteria | 2780 |
| 425 | Ga0207698_10359933 | 3300026142 | Unclassified | 1377 |
| 426 | Ga0207698_10373039 | 3300026142 | Bacteria | 1355 |
| 427 | Ga0207698_10617294 | 3300026142 | Bacteria | 1071 |
| 428 | Ga0207428_10173053 | 3300027907 | Bacteria | 1634 |
| 429 | Ga0268266_10005443 | 3300028379 | Bacteria | 11868 |
| 430 | Ga0268265_10126345 | 3300028380 | Bacteria | 2117 |
| 431 | Ga0268264_10000105 | 3300028381 | Bacteria | 212531 |
| 432 | Ga0268264_10003731 | 3300028381 | Bacteria | 13086 |
| 433 | Ga0268264_10003887 | 3300028381 | Bacteria | 12806 |
| 434 | Ga0268264_10012385 | 3300028381 | Bacteria | 7020 |
| 435 | Ga0268264_10254766 | 3300028381 | Bacteria | 1632 |
| 436 | Ga0268264_11277044 | 3300028381 | Unclassified | 744 |
| 437 | Ga0307515_10000190 | 3300028794 | Bacteria | 150300 |
| 438 | Ga0265327_10012523 | 3300031251 | Bacteria | 5713 |
| 439 | Ga0307513_10046944 | 3300031456 | Bacteria | 4703 |
| 440 | Ga0307513_10264577 | 3300031456 | Bacteria | 1507 |
| 441 | Ga0307513_10415718 | 3300031456 | Bacteria | 1076 |
| 442 | Ga0307513_10506009 | 3300031456 | Bacteria | 925 |
| 443 | Ga0307513_10532264 | 3300031456 | Bacteria | 889 |
| 444 | Ga0307408_101161455 | 3300031548 | Unclassified | 719 |
| 445 | Ga0307508_10011571 | 3300031616 | Bacteria | 8061 |
| 446 | Ga0307516_10001379 | 3300031730 | Bacteria | 33641 |
| 447 | Ga0307507_10168630 | 3300033179 | Bacteria | 1597 |
| 448 | Ga0307510_10003610 | 3300033180 | Bacteria | 18060 |
| 449 | Ga0373955_0152035 | 3300035172 | Bacteria | 1363 |
| 450 | Ga0373935_0268381 | 3300035692 | Bacteria | 1199 |
| 451 | Ga0373927_0160003 | 3300035695 | Bacteria | 1475 |
| 452 | Ga0373947_0610666 | 3300035725 | Bacteria | 743 |
| 453 | Ga0373937_0050719 | 3300036401 | Bacteria | 3802 |
| 454 | Ga0373937_0099570 | 3300036401 | Bacteria | 2696 |
| 455 | Ga0373937_0143636 | 3300036401 | Bacteria | 2233 |
| 456 | Ga0373937_0244773 | 3300036401 | Bacteria | 1690 |
| 457 | Ga0373925_0220750 | 3300037068 | Unclassified | 1513 |
| 458 | Ga0395899_0045814 | 3300037312 | Bacteria | 3258 |
| 459 | Ga0395900_0020435 | 3300037418 | Bacteria | 6759 |
| 460 | Ga0395905_0176292 | 3300037471 | Unclassified | 2007 |
| 461 | Ga0436365_1052711 | 3300039437 | Bacteria | 25242 |
| 462 | Ga0436365_1077961 | 3300039437 | Bacteria | 3203 |
| 463 | Ga0439436_0019396 | 3300041404 | Bacteria | 2031 |
| 464 | Ga0439436_0043707 | 3300041404 | Bacteria | 1278 |
| 465 | Ga0451802_1346588 | 3300041460 | Bacteria | 678 |
| 466 | Ga0451833_0591057 | 3300041491 | Unclassified | 872 |
| 467 | Ga0451845_0686587 | 3300041501 | Bacteria | 800 |
| 468 | Ga0439442_007902 | 3300042002 | Unclassified | 2147 |
| 469 | Ga0439449_0014897 | 3300042007 | Bacteria | 2923 |
| 470 | Ga0439457_047020 | 3300042014 | Bacteria | 966 |
| 471 | Ga0439462_0091908 | 3300042015 | Bacteria | 833 |
| 472 | Ga0450922_006358 | 3300042124 | Bacteria | 1100 |
| 473 | Ga0450923_107344 | 3300042125 | Bacteria | 649 |
| 474 | Ga0439446_0109164 | 3300042156 | Bacteria | 881 |
| 475 | Ga0439434_0107341 | 3300042435 | Bacteria | 902 |
| 476 | Ga0439434_0109255 | 3300042435 | Bacteria | 895 |
| 477 | Ga0451577_0061124 | 3300042876 | Bacteria | 3359 |
| 478 | Ga0451577_0251788 | 3300042876 | Unclassified | 1599 |
| 479 | Ga0451577_0449942 | 3300042876 | Bacteria | 1169 |
| 480 | Ga0451577_0835648 | 3300042876 | Bacteria | 831 |
| 481 | Ga0466969_0000244 | 3300044656 | Bacteria | 29819 |
| 482 | Ga0466972_0000011 | 3300044658 | Bacteria | 249697 |
| 483 | Ga0466972_0003024 | 3300044658 | Bacteria | 8339 |
| 484 | Ga0466966_0017726 | 3300044684 | Bacteria | 4701 |
| 485 | Ga0466961_0016976 | 3300044693 | Bacteria | 4675 |
| 486 | Ga0466964_0028126 | 3300044706 | Unclassified | 2213 |
| 487 | Ga0466964_0076007 | 3300044706 | Bacteria | 1431 |
| 488 | Ga0453684_0006196 | 3300044712 | Bacteria | 22943 |
| 489 | Ga0453684_0295857 | 3300044712 | Unclassified | 1841 |
| 490 | Ga0453684_0947206 | 3300044712 | Bacteria | 919 |
| 491 | Ga0466971_0016800 | 3300044719 | Unclassified | 3233 |
| 492 | Ga0466971_0053354 | 3300044719 | Bacteria | 1822 |
| 493 | Ga0466970_0090108 | 3300044765 | Unclassified | 1664 |
| 494 | Ga0466970_0229291 | 3300044765 | Bacteria | 1038 |
| 495 | Ga0466970_0334776 | 3300044765 | Unclassified | 857 |
| 496 | Ga0466957_0000218 | 3300044842 | Bacteria | 27018 |
| 497 | Ga0466957_0020990 | 3300044842 | Bacteria | 3844 |
| 498 | Ga0466960_0171154 | 3300044901 | Bacteria | 1172 |
| 499 | Ga0466959_0000039 | 3300045049 | Bacteria | 101186 |
| 500 | Ga0466959_0004171 | 3300045049 | Bacteria | 9628 |
| 501 | Ga0466958_0119347 | 3300045836 | Unclassified | 1650 |
| 502 | Ga0495592_0200274 | 3300046454 | Bacteria | 1348 |
| 503 | Ga0495629_0549349 | 3300046459 | Bacteria | 775 |
| 504 | Ga0495580_0334582 | 3300046472 | Unclassified | 1028 |
| 505 | Ga0495606_0129160 | 3300046507 | Unclassified | 1504 |
| 506 | Ga0495608_0429829 | 3300046511 | Bacteria | 805 |
| 507 | Ga0495630_0069116 | 3300046517 | Bacteria | 2657 |
| 508 | Ga0495652_0067790 | 3300046529 | Unclassified | 2991 |
| 509 | Ga0495586_0290687 | 3300046535 | Bacteria | 936 |
| 510 | Ga0495667_0386575 | 3300046559 | Bacteria | 882 |
| 511 | Ga0495634_0103090 | 3300046642 | Bacteria | 1842 |
| 512 | Ga0495611_0000983 | 3300046648 | Bacteria | 15159 |
| 513 | Ga0495657_0239976 | 3300046675 | Bacteria | 1094 |
| 514 | Ga0495657_0353296 | 3300046675 | Unclassified | 870 |
| 515 | Ga0495646_0082683 | 3300046680 | Bacteria | 1868 |
| 516 | Ga0495647_0274515 | 3300046681 | Bacteria | 755 |
| 517 | Ga0495674_0285910 | 3300047319 | Bacteria | 1350 |
| 518 | Ga0495675_0218665 | 3300047444 | Bacteria | 1154 |
| 519 | Ga0495675_0384218 | 3300047444 | Bacteria | 821 |
| 520 | Ga0495686_0000016 | 3300047472 | Bacteria | 443701 |
| 521 | Ga0496104_0458513 | 3300048907 | Unclassified | 1186 |
| 522 | Ga0496105_0082646 | 3300048908 | Unclassified | 2653 |
| 523 | Ga0496108_0765268 | 3300048911 | Unclassified | 835 |
| 524 | Ga0496109_0079110 | 3300048912 | Bacteria | 3028 |
| 525 | Ga0496110_0583305 | 3300048913 | Unclassified | 1015 |
| 526 | Ga0496115_0807860 | 3300048918 | Bacteria | 729 |
| 527 | Ga0501032_0011621 | 3300049569 | Bacteria | 6314 |
| 528 | Ga0501033_0010981 | 3300049570 | Bacteria | 6940 |
| 529 | Ga0501034_0019547 | 3300049571 | Bacteria | 6926 |
| 530 | Ga0501034_0061244 | 3300049571 | Bacteria | 3779 |
| 531 | Ga0501034_0109211 | 3300049571 | Bacteria | 2757 |
| 532 | Ga0501034_0315740 | 3300049571 | Bacteria | 1496 |
| 533 | Ga0501036_0015703 | 3300049572 | Bacteria | 6324 |
| 534 | Ga0501036_0786596 | 3300049572 | Bacteria | 784 |
| 535 | Ga0501037_0011454 | 3300049573 | Bacteria | 6528 |
| 536 | Ga0501037_0226749 | 3300049573 | Bacteria | 1313 |
| 537 | Ga0501037_0272104 | 3300049573 | Bacteria | 1182 |
| 538 | Ga0501038_0031846 | 3300049574 | Bacteria | 4658 |
| 539 | Ga0501038_0515662 | 3300049574 | Bacteria | 913 |
| 540 | Ga0501043_0067826 | 3300049579 | Unclassified | 2801 |
| 541 | Ga0501043_0084398 | 3300049579 | Bacteria | 2496 |
| 542 | Ga0501046_0060700 | 3300049580 | Unclassified | 2958 |
| 543 | Ga0501047_0008167 | 3300049581 | Bacteria | 9886 |
| 544 | Ga0501047_0032597 | 3300049581 | Bacteria | 5030 |
| 545 | Ga0501047_0164028 | 3300049581 | Bacteria | 2093 |
| 546 | Ga0501047_0379798 | 3300049581 | Bacteria | 1247 |
| 547 | Ga0501067_0283732 | 3300049583 | Unclassified | 922 |
| 548 | Ga0501068_0344340 | 3300049584 | Bacteria | 957 |
| 549 | Ga0501069_0011943 | 3300049585 | Unclassified | 4608 |
| 550 | Ga0501073_0009700 | 3300049589 | Bacteria | 7094 |
| 551 | Ga0501073_0516548 | 3300049589 | Bacteria | 826 |
| 552 | Ga0501219_000085 | 3300049703 | Bacteria | 15993 |
| 553 | Ga0501079_0057323 | 3300049741 | Unclassified | 3006 |
| 554 | Ga0501265_026840 | 3300049762 | Bacteria | 809 |
| 555 | Ga0501280_014976 | 3300049776 | Bacteria | 1108 |
| 556 | Ga0501035_0052143 | 3300049822 | Bacteria | 3661 |
| 557 | Ga0501035_0904840 | 3300049822 | Unclassified | 699 |
| 558 | Ga0501044_0011702 | 3300049823 | Bacteria | 9505 |
| 559 | Ga0501044_0019524 | 3300049823 | Bacteria | 7248 |
| 560 | Ga0501044_0031489 | 3300049823 | Bacteria | 5583 |
| 561 | Ga0501044_0074228 | 3300049823 | Unclassified | 3456 |
| 562 | Ga0501044_0218722 | 3300049823 | Unclassified | 1856 |
| 563 | Ga0501044_0254480 | 3300049823 | Bacteria | 1696 |
| 564 | Ga0501044_0453525 | 3300049823 | Bacteria | 1189 |
| 565 | Ga0501284_00074 | 3300050005 | Bacteria | 28202 |
| 566 | nmdc:mga0k408_156910_c1 | 3300050493 | Bacteria | 1355 |
| 567 | nmdc:mga07m45_239325_c1 | 3300050496 | Unclassified | 1056 |
| 568 | nmdc:mga05p37_143831_c1 | 3300050507 | Unclassified | 2921 |
| 569 | nmdc:mga05p37_970_c1 | 3300050507 | Bacteria | 16850 |
| 570 | nmdc:mga09592_5087_c1 | 3300050508 | Bacteria | 6421 |
| 571 | nmdc:mga06r32_7936_c1 | 3300050510 | Bacteria | 9541 |
| 572 | nmdc:mga08y16_1571933_c1 | 3300050511 | Bacteria | 616 |
| 573 | nmdc:mga08y16_346884_c1 | 3300050511 | Bacteria | 1526 |
| 574 | Ga0495619_0093557 | 3300053085 | Bacteria | 2038 |
| 575 | Ga0500578_0000027 | 3300053086 | Bacteria | 144362 |
| 576 | Ga0500578_0337170 | 3300053086 | Unclassified | 885 |
| 577 | Ga0500583_0000004 | 3300053092 | Bacteria | 174723 |
| 578 | Ga0500583_0004553 | 3300053092 | Bacteria | 4538 |
| 579 | Ga0500651_0108465 | 3300053093 | Bacteria | 1696 |
| 580 | Ga0500562_000007 | 3300053108 | Bacteria | 241755 |
| 581 | Ga0500568_0000374 | 3300053139 | Bacteria | 34278 |
| 582 | Ga0500568_0042545 | 3300053139 | Bacteria | 1820 |
| 583 | Ga0500573_0224858 | 3300053140 | Bacteria | 982 |
| 584 | Ga0500604_0012960 | 3300053151 | Bacteria | 2257 |
| 585 | Ga0500616_0036711 | 3300053153 | Bacteria | 2658 |
| 586 | Ga0500622_0002683 | 3300053156 | Bacteria | 12605 |
| 587 | Ga0500622_0047466 | 3300053156 | Bacteria | 2218 |
| 588 | Ga0501084_0055796 | 3300054114 | Unclassified | 3305 |
| 589 | Ga0501082_0175300 | 3300060353 | Bacteria | 1864 |
| 590 | Ga0466962_0003550 | 3300061719 | Bacteria | 7429 |
| 591 | 2738727589 | 2738541278 | Bacteria | 9755573 |
| 592 | 2819591002 | 2818991444 | Bacteria | 6968812 |
| 593 | 2929156266 | 2929154850 | Bacteria | 6753285 |
| 594 | Ga0500588_0097763 | |||
| 595 | rootH1_10040138 | |||
| 596 | rootH2_10011709 | |||
| 597 | rootH2_10215871 | |||
| 598 | rootH2_10250303 | |||
| 599 | rootL2_10184856 | |||
| 600 | rootL2_10307192 | |||
| 601 | rootH1_10022476 | |||
| 602 | Ga0065712_10093279 | |||
| 603 | Ga0065707_10246388 | |||
| 604 | Ga0070658_10103063 | |||
| 605 | Ga0070676_10000263 | |||
| 606 | Ga0070676_10017885 | |||
| 607 | Ga0070683_100003859 | |||
| 608 | Ga0070683_100004278 | |||
| 609 | Ga0070683_100087498 | |||
| 610 | Ga0070683_100216667 | |||
| 611 | Ga0070670_100052282 | |||
| 612 | Ga0070670_100116528 | |||
| 613 | Ga0068869_100007877 | |||
| 614 | Ga0068869_100017657 | |||
| 615 | Ga0068869_100120963 | |||
| 616 | Ga0068869_100489860 | |||
| 617 | Ga0070666_10001269 | |||
| 618 | Ga0070666_10004806 | |||
| 619 | Ga0070680_100000693 | |||
| 620 | Ga0070682_100001134 | |||
| 621 | Ga0068868_100001950 | |||
| 622 | Ga0068868_100003187 | |||
| 623 | Ga0068868_100043145 | |||
| 624 | Ga0068868_100162186 | |||
| 625 | Ga0070660_100077797 | |||
| 626 | Ga0070691_10002457 | |||
| 627 | Ga0070691_10003801 | |||
| 628 | Ga0070668_100000106 | |||
| 629 | Ga0070669_100279078 | |||
| 630 | Ga0070669_100466308 | |||
| 631 | Ga0070675_100209802 | |||
| 632 | Ga0070675_100680802 | |||
| 633 | Ga0070671_100013240 | |||
| 634 | Ga0070671_100077412 | |||
| 635 | Ga0070671_100257606 | |||
| 636 | Ga0070671_100276292 | |||
| 637 | Ga0070674_100059587 | |||
| 638 | Ga0070674_100122503 | |||
| 639 | Ga0070674_100422023 | |||
| 640 | Ga0070673_100000229 | |||
| 641 | Ga0070673_100017775 | |||
| 642 | Ga0070673_100035166 | |||
| 643 | Ga0070673_100038535 | |||
| 644 | Ga0070673_100106332 | |||
| 645 | Ga0070673_100493711 | |||
| 646 | Ga0070688_100005254 | |||
| 647 | Ga0070659_100032620 | |||
| 648 | Ga0070667_100000931 | |||
| 649 | Ga0070667_100001521 | |||
| 650 | Ga0070667_100143861 | |||
| 651 | Ga0070700_100491204 | |||
| 652 | Ga0070663_100104642 | |||
| 653 | Ga0070662_100009238 | |||
| 654 | Ga0070681_10008908 | |||
| 655 | Ga0068867_100009241 | |||
| 656 | Ga0068867_100035369 | |||
| 657 | Ga0068867_100811839 | |||
| 658 | Ga0070685_10105477 | |||
| 659 | Ga0070698_100174488 | |||
| 660 | Ga0070698_100207989 | |||
| 661 | Ga0070679_100025591 | |||
| 662 | Ga0070684_100001995 | |||
| 663 | Ga0070684_100010684 | |||
| 664 | Ga0070684_100027031 | |||
| 665 | Ga0068853_100005763 | |||
| 666 | Ga0068853_100010845 | |||
| 667 | Ga0068853_100127625 | |||
| 668 | Ga0068853_100180102 | |||
| 669 | Ga0068853_100240249 | |||
| 670 | Ga0068853_100654044 | |||
| 671 | Ga0068853_101173106 | |||
| 672 | Ga0070672_100000325 | |||
| 673 | Ga0070672_100054719 | |||
| 674 | Ga0070672_100799322 | |||
| 675 | Ga0070686_100151912 | |||
| 676 | Ga0070695_100282936 | |||
| 677 | Ga0070693_100023255 | |||
| 678 | Ga0070665_100000570 | |||
| 679 | Ga0068855_100017655 | |||
| 680 | Ga0068855_100057754 | |||
| 681 | Ga0068855_100070410 | |||
| 682 | Ga0068855_100077031 | |||
| 683 | Ga0068855_100321563 | |||
| 684 | Ga0068855_100432613 | |||
| 685 | Ga0068855_100673530 | |||
| 686 | Ga0068855_100777377 | |||
| 687 | Ga0070664_100002506 | |||
| 688 | Ga0070664_100023310 | |||
| 689 | Ga0070664_100121278 | |||
| 690 | Ga0070664_100266265 | |||
| 691 | Ga0070664_100343503 | |||
| 692 | Ga0068857_100023691 | |||
| 693 | Ga0068857_100039837 | |||
| 694 | Ga0068857_100045150 | |||
| 695 | Ga0068857_100516567 | |||
| 696 | Ga0068857_101317288 | |||
| 697 | Ga0068854_100022248 | |||
| 698 | Ga0068854_100118958 | |||
| 699 | Ga0068854_101179282 | |||
| 700 | Ga0068856_100015173 | |||
| 701 | Ga0068856_100179527 | |||
| 702 | Ga0068856_100194848 | |||
| 703 | Ga0068856_100197494 | |||
| 704 | Ga0068852_100002840 | |||
| 705 | Ga0068852_100051922 | |||
| 706 | Ga0068852_100070235 | |||
| 707 | Ga0068852_100167519 | |||
| 708 | Ga0068852_100326214 | |||
| 709 | Ga0068852_100706251 | |||
| 710 | Ga0068859_100000106 | |||
| 711 | Ga0068859_100258764 | |||
| 712 | Ga0068864_100001209 | |||
| 713 | Ga0068864_100009738 | |||
| 714 | Ga0068864_100052879 | |||
| 715 | Ga0068864_100159975 | |||
| 716 | Ga0068861_100105564 | |||
| 717 | Ga0068861_100120195 | |||
| 718 | Ga0068861_101267419 | |||
| 719 | Ga0068851_10020273 | |||
| 720 | Ga0068851_10114644 | |||
| 721 | Ga0068863_100000567 | |||
| 722 | Ga0068863_100003303 | |||
| 723 | Ga0068863_100036503 | |||
| 724 | Ga0068863_100139222 | |||
| 725 | Ga0068863_100143875 | |||
| 726 | Ga0068858_100001322 | |||
| 727 | Ga0068858_100080098 | |||
| 728 | Ga0068858_100285677 | |||
| 729 | Ga0068860_100000078 | |||
| 730 | Ga0068860_100005302 | |||
| 731 | Ga0068860_100014141 | |||
| 732 | Ga0068860_100073895 | |||
| 733 | Ga0068860_100084825 | |||
| 734 | Ga0068860_100617311 | |||
| 735 | Ga0068860_100671103 | |||
| 736 | Ga0068862_100074774 | |||
| 737 | Ga0081540_1003562 | |||
| 738 | Ga0075366_10060669 | |||
| 739 | Ga0097621_100015299 | |||
| 740 | Ga0097621_100088978 | |||
| 741 | Ga0097621_100296479 | |||
| 742 | Ga0097621_100331370 | |||
| 743 | Ga0068871_100002881 | |||
| 744 | Ga0068871_100019773 | |||
| 745 | Ga0068871_100143635 | |||
| 746 | Ga0075428_100193784 | |||
| 747 | Ga0075431_100020645 | |||
| 748 | Ga0068865_100000299 | |||
| 749 | Ga0097620_100000106 | |||
| 750 | Ga0097620_100258755 | |||
| 751 | Ga0105240_10000023 | |||
| 752 | Ga0105240_10000281 | |||
| 753 | Ga0105240_10002290 | |||
| 754 | Ga0105240_10009884 | |||
| 755 | Ga0105240_10014873 | |||
| 756 | Ga0105240_10024146 | |||
| 757 | Ga0105240_10029485 | |||
| 758 | Ga0105240_10061859 | |||
| 759 | Ga0105240_10137465 | |||
| 760 | Ga0105240_10210681 | |||
| 761 | Ga0105240_10375389 | |||
| 762 | Ga0105240_10509767 | |||
| 763 | Ga0105240_10616852 | |||
| 764 | Ga0111539_10087426 | |||
| 765 | Ga0105245_10144272 | |||
| 766 | Ga0105245_10366720 | |||
| 767 | Ga0105247_10121257 | |||
| 768 | Ga0105247_10172210 | |||
| 769 | Ga0105247_10379798 | |||
| 770 | Ga0114129_10011005 | |||
| 771 | Ga0114129_10084409 | |||
| 772 | Ga0105241_10008817 | |||
| 773 | Ga0105241_10040164 | |||
| 774 | Ga0105241_10048098 | |||
| 775 | Ga0105241_10311933 | |||
| 776 | Ga0105241_10350772 | |||
| 777 | Ga0105241_10559358 | |||
| 778 | Ga0105241_10885722 | |||
| 779 | Ga0105242_10022831 | |||
| 780 | Ga0105242_10860851 | |||
| 781 | Ga0105242_11114501 | |||
| 782 | Ga0105248_10005891 | |||
| 783 | Ga0105237_10000261 | |||
| 784 | Ga0105237_10001123 | |||
| 785 | Ga0105237_10003683 | |||
| 786 | Ga0105237_10015708 | |||
| 787 | Ga0105237_10062344 | |||
| 788 | Ga0105237_10073006 | |||
| 789 | Ga0105237_10126341 | |||
| 790 | Ga0105237_10415234 | |||
| 791 | Ga0105238_10025613 | |||
| 792 | Ga0105238_10050805 | |||
| 793 | Ga0105238_10177648 | |||
| 794 | Ga0105238_10219439 | |||
| 795 | Ga0105238_10256400 | |||
| 796 | Ga0105238_10301311 | |||
| 797 | Ga0105249_10002874 | |||
| 798 | Ga0105249_10004490 | |||
| 799 | Ga0105249_10628398 | |||
| 800 | Ga0105239_10000345 | |||
| 801 | Ga0105239_10002155 | |||
| 802 | Ga0105239_10015165 | |||
| 803 | Ga0105239_10019999 | |||
| 804 | Ga0105239_10022156 | |||
| 805 | Ga0105239_10138170 | |||
| 806 | Ga0105246_10096265 | |||
| 807 | Ga0105246_10168894 | |||
| 808 | Ga0157373_10000489 | |||
| 809 | Ga0157373_10100299 | |||
| 810 | Ga0157373_10567530 | |||
| 811 | Ga0157371_10024966 | |||
| 812 | Ga0157371_10030010 | |||
| 813 | Ga0157371_10033027 | |||
| 814 | Ga0157370_10001887 | |||
| 815 | Ga0157370_10013074 | |||
| 816 | Ga0157370_10046983 | |||
| 817 | Ga0157370_10188546 | |||
| 818 | Ga0157370_10554644 | |||
| 819 | Ga0157369_10004105 | |||
| 820 | Ga0157369_10035765 | |||
| 821 | Ga0157369_10280244 | |||
| 822 | Ga0157369_10383465 | |||
| 823 | Ga0157374_10000002 | |||
| 824 | Ga0157374_10000089 | |||
| 825 | Ga0157374_10018673 | |||
| 826 | Ga0157378_10005286 | |||
| 827 | Ga0157378_10013042 | |||
| 828 | Ga0157378_10055412 | |||
| 829 | Ga0157378_10163789 | |||
| 830 | Ga0157378_10224091 | |||
| 831 | Ga0157378_10287443 | |||
| 832 | Ga0163162_10000084 | |||
| 833 | Ga0163162_10000624 | |||
| 834 | Ga0163162_10000972 | |||
| 835 | Ga0163162_10013609 | |||
| 836 | Ga0163162_10241613 | |||
| 837 | Ga0157372_10001814 | |||
| 838 | Ga0157372_10062059 | |||
| 839 | Ga0157372_10063614 | |||
| 840 | Ga0157372_10065892 | |||
| 841 | Ga0157372_10073967 | |||
| 842 | Ga0157372_10092527 | |||
| 843 | Ga0157372_10209595 | |||
| 844 | Ga0157372_10279351 | |||
| 845 | Ga0157372_10671706 | |||
| 846 | Ga0157375_10000057 | |||
| 847 | Ga0157375_10015071 | |||
| 848 | Ga0157375_10029151 | |||
| 849 | Ga0157375_10038254 | |||
| 850 | Ga0157375_10168438 | |||
| 851 | Ga0163163_10000804 | |||
| 852 | Ga0163163_10014347 | |||
| 853 | Ga0163163_10178860 | |||
| 854 | Ga0163163_10191920 | |||
| 855 | Ga0163163_11281841 | |||
| 856 | Ga0157380_10006684 | |||
| 857 | Ga0157380_10139444 | |||
| 858 | Ga0157380_10272033 | |||
| 859 | Ga0157380_11169535 | |||
| 860 | Ga0157377_10087715 | |||
| 861 | Ga0157379_10000032 | |||
| 862 | Ga0157379_10098322 | |||
| 863 | Ga0157379_10112568 | |||
| 864 | Ga0157379_10157515 | |||
| 865 | Ga0157379_10213885 | |||
| 866 | Ga0157379_10269379 | |||
| 867 | Ga0157376_10000318 | |||
| 868 | Ga0157376_10031895 | |||
| 869 | Ga0157376_10041388 | |||
| 870 | Ga0157376_10052117 | |||
| 871 | Ga0157376_10473199 | |||
| 872 | Ga0157376_10473342 | |||
| 873 | Ga0157376_10813269 | |||
| 874 | Ga0182005_1030952 | |||
| 875 | Ga0163161_10030785 | |||
| 876 | Ga0163161_10092713 | |||
| 877 | Ga0213876_10002070 | |||
| 878 | Ga0213876_10033800 | |||
| 879 | Ga0209646_1003036 | |||
| 880 | Ga0207697_10069725 | |||
| 881 | Ga0207697_10106373 | |||
| 882 | Ga0207656_10026563 | |||
| 883 | Ga0207682_10030531 | |||
| 884 | Ga0207710_10110945 | |||
| 885 | Ga0207680_10000125 | |||
| 886 | Ga0207647_10014949 | |||
| 887 | Ga0207647_10021474 | |||
| 888 | Ga0207647_10094092 | |||
| 889 | Ga0207645_10000638 | |||
| 890 | Ga0207643_10094115 | |||
| 891 | Ga0207705_10002058 | |||
| 892 | Ga0207654_10045309 | |||
| 893 | Ga0207654_10172768 | |||
| 894 | Ga0207654_10400034 | |||
| 895 | Ga0207707_10001194 | |||
| 896 | Ga0207707_10058317 | |||
| 897 | Ga0207695_10000016 | |||
| 898 | Ga0207695_10000128 | |||
| 899 | Ga0207695_10000296 | |||
| 900 | Ga0207695_10022769 | |||
| 901 | Ga0207695_10063191 | |||
| 902 | Ga0207695_10125536 | |||
| 903 | Ga0207695_10237715 | |||
| 904 | Ga0207695_10299981 | |||
| 905 | Ga0207671_10001029 | |||
| 906 | Ga0207671_10009779 | |||
| 907 | Ga0207671_10126635 | |||
| 908 | Ga0207671_10209717 | |||
| 909 | Ga0207660_10023829 | |||
| 910 | Ga0207657_10109630 | |||
| 911 | Ga0207649_10446468 | |||
| 912 | Ga0207649_10593743 | |||
| 913 | Ga0207652_10002054 | |||
| 914 | Ga0207681_10843348 | |||
| 915 | Ga0207694_10165333 | |||
| 916 | Ga0207694_10220280 | |||
| 917 | Ga0207694_10982428 | |||
| 918 | Ga0207650_10021737 | |||
| 919 | Ga0207650_10024854 | |||
| 920 | Ga0207650_10236709 | |||
| 921 | Ga0207650_10606368 | |||
| 922 | Ga0207659_10033521 | |||
| 923 | Ga0207659_10650160 | |||
| 924 | Ga0207687_10248283 | |||
| 925 | Ga0207644_10058900 | |||
| 926 | Ga0207644_10110786 | |||
| 927 | Ga0207644_10205744 | |||
| 928 | Ga0207690_10025692 | |||
| 929 | Ga0207690_10057660 | |||
| 930 | Ga0207706_10007388 | |||
| 931 | Ga0207706_10039794 | |||
| 932 | Ga0207706_10117833 | |||
| 933 | Ga0207706_10315637 | |||
| 934 | Ga0207686_10078238 | |||
| 935 | Ga0207670_10287078 | |||
| 936 | Ga0207669_10060010 | |||
| 937 | Ga0207669_10186785 | |||
| 938 | Ga0207704_10547495 | |||
| 939 | Ga0207704_10677686 | |||
| 940 | Ga0207691_10000014 | |||
| 941 | Ga0207691_10010650 | |||
| 942 | Ga0207691_10068604 | |||
| 943 | Ga0207691_10764289 | |||
| 944 | Ga0207711_10990229 | |||
| 945 | Ga0207689_10000853 | |||
| 946 | Ga0207689_10002211 | |||
| 947 | Ga0207689_10004402 | |||
| 948 | Ga0207689_10140956 | |||
| 949 | Ga0207661_10012502 | |||
| 950 | Ga0207661_10553957 | |||
| 951 | Ga0207679_10001197 | |||
| 952 | Ga0207679_10060263 | |||
| 953 | Ga0207679_10153517 | |||
| 954 | Ga0207679_10288993 | |||
| 955 | Ga0207667_10000143 | |||
| 956 | Ga0207667_10002746 | |||
| 957 | Ga0207667_10015337 | |||
| 958 | Ga0207667_10056411 | |||
| 959 | Ga0207667_10291910 | |||
| 960 | Ga0207667_10369207 | |||
| 961 | Ga0207667_10427435 | |||
| 962 | Ga0207667_10637976 | |||
| 963 | Ga0207651_10000826 | |||
| 964 | Ga0207651_10042111 | |||
| 965 | Ga0207651_10146854 | |||
| 966 | Ga0207651_10169089 | |||
| 967 | Ga0207712_10002069 | |||
| 968 | Ga0207712_10012835 | |||
| 969 | Ga0207712_10457286 | |||
| 970 | Ga0207668_10000124 | |||
| 971 | Ga0207668_10183958 | |||
| 972 | Ga0207668_10291744 | |||
| 973 | Ga0207640_10485806 | |||
| 974 | Ga0207658_10000242 | |||
| 975 | Ga0207658_10010441 | |||
| 976 | Ga0207658_10847830 | |||
| 977 | Ga0207677_10003043 | |||
| 978 | Ga0207677_10005391 | |||
| 979 | Ga0207677_10030799 | |||
| 980 | Ga0207703_10000735 | |||
| 981 | Ga0207703_10003904 | |||
| 982 | Ga0207703_10180578 | |||
| 983 | Ga0207639_10008018 | |||
| 984 | Ga0207639_10037426 | |||
| 985 | Ga0207639_10140366 | |||
| 986 | Ga0207639_10176785 | |||
| 987 | Ga0207678_10017896 | |||
| 988 | Ga0207678_10123011 | |||
| 989 | Ga0207678_10180545 | |||
| 990 | Ga0207702_10067599 | |||
| 991 | Ga0207702_10163484 | |||
| 992 | Ga0207641_10000082 | |||
| 993 | Ga0207641_10013162 | |||
| 994 | Ga0207641_10015499 | |||
| 995 | Ga0207641_10123075 | |||
| 996 | Ga0207641_10483665 | |||
| 997 | Ga0207648_10028788 | |||
| 998 | Ga0207648_10046144 | |||
| 999 | Ga0207648_10124845 | |||
| 1000 | Ga0207648_10319854 | |||
| 1001 | Ga0207676_10005134 | |||
| 1002 | Ga0207676_10010368 | |||
| 1003 | Ga0207676_10123859 | |||
| 1004 | Ga0207676_10371361 | |||
| 1005 | Ga0207674_10002304 | |||
| 1006 | Ga0207674_10013597 | |||
| 1007 | Ga0207674_10048747 | |||
| 1008 | Ga0207674_10053181 | |||
| 1009 | Ga0207674_10067721 | |||
| 1010 | Ga0207675_100070459 | |||
| 1011 | Ga0207683_10058659 | |||
| 1012 | Ga0207683_10075606 | |||
| 1013 | Ga0207683_10117290 | |||
| 1014 | Ga0207683_10436421 | |||
| 1015 | Ga0207698_10003520 | |||
| 1016 | Ga0207698_10037010 | |||
| 1017 | Ga0207698_10069847 | |||
| 1018 | Ga0207698_10359933 | |||
| 1019 | Ga0207698_10373039 | |||
| 1020 | Ga0207698_10617294 | |||
| 1021 | Ga0207428_10173053 | |||
| 1022 | Ga0268266_10005443 | |||
| 1023 | Ga0268265_10126345 | |||
| 1024 | Ga0268264_10000105 | |||
| 1025 | Ga0268264_10003731 | |||
| 1026 | Ga0268264_10003887 | |||
| 1027 | Ga0268264_10012385 | |||
| 1028 | Ga0268264_10254766 | |||
| 1029 | Ga0268264_11277044 | |||
| 1030 | Ga0307515_10000190 | |||
| 1031 | Ga0265327_10012523 | |||
| 1032 | Ga0307513_10046944 | |||
| 1033 | Ga0307513_10264577 | |||
| 1034 | Ga0307513_10415718 | |||
| 1035 | Ga0307513_10506009 | |||
| 1036 | Ga0307513_10532264 | |||
| 1037 | Ga0307408_101161455 | |||
| 1038 | Ga0307508_10011571 | |||
| 1039 | Ga0307516_10001379 | |||
| 1040 | Ga0307507_10168630 | |||
| 1041 | Ga0307510_10003610 | |||
| 1042 | Ga0373955_0152035 | |||
| 1043 | Ga0373935_0268381 | |||
| 1044 | Ga0373927_0160003 | |||
| 1045 | Ga0373947_0610666 | |||
| 1046 | Ga0373937_0050719 | |||
| 1047 | Ga0373937_0099570 | |||
| 1048 | Ga0373937_0143636 | |||
| 1049 | Ga0373937_0244773 | |||
| 1050 | Ga0373925_0220750 | |||
| 1051 | Ga0395899_0045814 | |||
| 1052 | Ga0395900_0020435 | |||
| 1053 | Ga0395905_0176292 | |||
| 1054 | Ga0436365_1052711 | |||
| 1055 | Ga0436365_1077961 | |||
| 1056 | Ga0439436_0019396 | |||
| 1057 | Ga0439436_0043707 | |||
| 1058 | Ga0451802_1346588 | |||
| 1059 | Ga0451833_0591057 | |||
| 1060 | Ga0451845_0686587 | |||
| 1061 | Ga0439442_007902 | |||
| 1062 | Ga0439449_0014897 | |||
| 1063 | Ga0439457_047020 | |||
| 1064 | Ga0439462_0091908 | |||
| 1065 | Ga0450922_006358 | |||
| 1066 | Ga0450923_107344 | |||
| 1067 | Ga0439446_0109164 | |||
| 1068 | Ga0439434_0107341 | |||
| 1069 | Ga0439434_0109255 | |||
| 1070 | Ga0451577_0061124 | |||
| 1071 | Ga0451577_0251788 | |||
| 1072 | Ga0451577_0449942 | |||
| 1073 | Ga0451577_0835648 | |||
| 1074 | Ga0466969_0000244 | |||
| 1075 | Ga0466972_0000011 | |||
| 1076 | Ga0466972_0003024 | |||
| 1077 | Ga0466966_0017726 | |||
| 1078 | Ga0466961_0016976 | |||
| 1079 | Ga0466964_0028126 | |||
| 1080 | Ga0466964_0076007 | |||
| 1081 | Ga0453684_0006196 | |||
| 1082 | Ga0453684_0295857 | |||
| 1083 | Ga0453684_0947206 | |||
| 1084 | Ga0466971_0016800 | |||
| 1085 | Ga0466971_0053354 | |||
| 1086 | Ga0466970_0090108 | |||
| 1087 | Ga0466970_0229291 | |||
| 1088 | Ga0466970_0334776 | |||
| 1089 | Ga0466957_0000218 | |||
| 1090 | Ga0466957_0020990 | |||
| 1091 | Ga0466960_0171154 | |||
| 1092 | Ga0466959_0000039 | |||
| 1093 | Ga0466959_0004171 | |||
| 1094 | Ga0466958_0119347 | |||
| 1095 | Ga0495592_0200274 | |||
| 1096 | Ga0495629_0549349 | |||
| 1097 | Ga0495580_0334582 | |||
| 1098 | Ga0495606_0129160 | |||
| 1099 | Ga0495608_0429829 | |||
| 1100 | Ga0495630_0069116 | |||
| 1101 | Ga0495652_0067790 | |||
| 1102 | Ga0495586_0290687 | |||
| 1103 | Ga0495667_0386575 | |||
| 1104 | Ga0495634_0103090 | |||
| 1105 | Ga0495611_0000983 | |||
| 1106 | Ga0495657_0239976 | |||
| 1107 | Ga0495657_0353296 | |||
| 1108 | Ga0495646_0082683 | |||
| 1109 | Ga0495647_0274515 | |||
| 1110 | Ga0495674_0285910 | |||
| 1111 | Ga0495675_0218665 | |||
| 1112 | Ga0495675_0384218 | |||
| 1113 | Ga0495686_0000016 | |||
| 1114 | Ga0496104_0458513 | |||
| 1115 | Ga0496105_0082646 | |||
| 1116 | Ga0496108_0765268 | |||
| 1117 | Ga0496109_0079110 | |||
| 1118 | Ga0496110_0583305 | |||
| 1119 | Ga0496115_0807860 | |||
| 1120 | Ga0501032_0011621 | |||
| 1121 | Ga0501033_0010981 | |||
| 1122 | Ga0501034_0019547 | |||
| 1123 | Ga0501034_0061244 | |||
| 1124 | Ga0501034_0109211 | |||
| 1125 | Ga0501034_0315740 | |||
| 1126 | Ga0501036_0015703 | |||
| 1127 | Ga0501036_0786596 | |||
| 1128 | Ga0501037_0011454 | |||
| 1129 | Ga0501037_0226749 | |||
| 1130 | Ga0501037_0272104 | |||
| 1131 | Ga0501038_0031846 | |||
| 1132 | Ga0501038_0515662 | |||
| 1133 | Ga0501043_0067826 | |||
| 1134 | Ga0501043_0084398 | |||
| 1135 | Ga0501046_0060700 | |||
| 1136 | Ga0501047_0008167 | |||
| 1137 | Ga0501047_0032597 | |||
| 1138 | Ga0501047_0164028 | |||
| 1139 | Ga0501047_0379798 | |||
| 1140 | Ga0501067_0283732 | |||
| 1141 | Ga0501068_0344340 | |||
| 1142 | Ga0501069_0011943 | |||
| 1143 | Ga0501073_0009700 | |||
| 1144 | Ga0501073_0516548 | |||
| 1145 | Ga0501219_000085 | |||
| 1146 | Ga0501079_0057323 | |||
| 1147 | Ga0501265_026840 | |||
| 1148 | Ga0501280_014976 | |||
| 1149 | Ga0501035_0052143 | |||
| 1150 | Ga0501035_0904840 | |||
| 1151 | Ga0501044_0011702 | |||
| 1152 | Ga0501044_0019524 | |||
| 1153 | Ga0501044_0031489 | |||
| 1154 | Ga0501044_0074228 | |||
| 1155 | Ga0501044_0218722 | |||
| 1156 | Ga0501044_0254480 | |||
| 1157 | Ga0501044_0453525 | |||
| 1158 | Ga0501284_00074 | |||
| 1159 | nmdc:mga0k408_156910_c1 | |||
| 1160 | nmdc:mga07m45_239325_c1 | |||
| 1161 | nmdc:mga05p37_143831_c1 | |||
| 1162 | nmdc:mga05p37_970_c1 | |||
| 1163 | nmdc:mga09592_5087_c1 | |||
| 1164 | nmdc:mga06r32_7936_c1 | |||
| 1165 | nmdc:mga08y16_1571933_c1 | |||
| 1166 | nmdc:mga08y16_346884_c1 | |||
| 1167 | Ga0495619_0093557 | |||
| 1168 | Ga0500578_0000027 | |||
| 1169 | Ga0500578_0337170 | |||
| 1170 | Ga0500583_0000004 | |||
| 1171 | Ga0500583_0004553 | |||
| 1172 | Ga0500651_0108465 | |||
| 1173 | Ga0500562_000007 | |||
| 1174 | Ga0500568_0000374 | |||
| 1175 | Ga0500568_0042545 | |||
| 1176 | Ga0500573_0224858 | |||
| 1177 | Ga0500604_0012960 | |||
| 1178 | Ga0500616_0036711 | |||
| 1179 | Ga0500622_0002683 | |||
| 1180 | Ga0500622_0047466 | |||
| 1181 | Ga0501084_0055796 | |||
| 1182 | Ga0501082_0175300 | |||
| 1183 | Ga0466962_0003550 | |||
| 1184 | 2738727589 | |||
| 1185 | 2819591002 | |||
| 1186 | 2929156266 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zi3-assembly1.cif.gz_B | c4s-e247a dck variant of dck in complex with d-da+adp | 0.8744 | 4 | 196 |
| 4q1c-assembly1.cif.gz_A | human dck c4s-s74e mutant in complex with udp and the inhibitor 8 {2,2'-[{4-[(2r)-4-{[(4,6-diaminopyrimidin-2-yl)sulfanyl]methyl}-5-propyl-2,3-dihydro-1,3-thiazol-2-yl]benzene-1,2-diyl}bis(oxy)]diethanol} | 0.8716 | 4 | 200 |
| 1p60-assembly1.cif.gz_B | structure of human dck complexed with 2'-deoxycytidine and adp, space group c 2 2 21 | 0.8696 | 2 | 196 |
| 5mqt-assembly1.cif.gz_B | crystal structure of dck mutant c3s in complex with imatinib and udp | 0.8668 | 2 | 200 |
| 2no9-assembly1.cif.gz_B | the structure of deoxycytidine kinase complexed with troxacitabine and adp. | 0.8667 | 2 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0M0_4_200_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9153 | 5 | 196 | 3.40.50.300 |
| af_Q54UT2_32_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.894 | 4 | 199 | 3.40.50.300 |
| af_Q2G0M1_9_214_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8901 | 4 | 196 | 3.40.50.300 |
| af_Q54YL2_23_219_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8851 | 6 | 198 | 3.40.50.300 |
| af_Q2G0M0_4_200_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8845 | 5 | 196 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G8TFB5-F1-model_v4 | Deoxynucleoside kinase | 0.9645 | 1 | 210 |
GO:0005524
GO:0005737 GO:0019136 |
| AF-A0A661YPS8-F1-model_v4 | deleted | 0.9641 | 2 | 172 |
|
| AF-A0A7X9KP01-F1-model_v4 | Deoxynucleoside kinase | 0.9629 | 1 | 176 |
GO:0005524
GO:0005737 GO:0019136 |
| AF-A0A4U3L3J7-F1-model_v4 | Deoxynucleoside kinase | 0.9624 | 1 | 210 |
GO:0005524
GO:0005737 GO:0019136 |
| AF-A0A2E3VP59-F1-model_v4 | deleted | 0.962 | 2 | 197 |
|