F467158

General Info

Members Datasets Scaffolds Average Seq Length
592 273 1184 96

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0004905|Ga0466959_0004905_2714_3007
Length 91
Sequence MPAYIIVETDITDPEQYERYKAASPGAIAAAGGRFLAVLEGDWHPSRLVVLEFEDLDAAKRFYESEEYAAARKLREGAARLSMVAVAGVEP

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.39
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 11.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0004905 3300045049 Bacteria 9061
2 JGI25406J46586_10046131 3300003203 Bacteria 1495
3 rootH2_10070391 3300003320 Bacteria 1535
4 JGI25407J50210_10022749 3300003373 Bacteria 1629
5 Ga0070658_10009450 3300005327 Bacteria 7839
6 Ga0070658_10192754 3300005327 Bacteria 1718
7 Ga0070658_10212063 3300005327 Bacteria 1636
8 Ga0070658_10280594 3300005327 Bacteria 1418
9 Ga0070658_10423686 3300005327 Bacteria 1145
10 Ga0070658_10448519 3300005327 Bacteria 1111
11 Ga0070658_10572659 3300005327 Bacteria 978
12 Ga0070680_100217097 3300005336 Bacteria 1614
13 Ga0070680_100552767 3300005336 Bacteria 987
14 Ga0070680_101394368 3300005336 Unclassified 607
15 Ga0070682_100130681 3300005337 Bacteria 1699
16 Ga0070682_100605611 3300005337 Bacteria 866
17 Ga0070682_100726919 3300005337 Bacteria 799
18 Ga0070660_100006295 3300005339 Bacteria 8222
19 Ga0070660_100185104 3300005339 Bacteria 1686
20 Ga0070660_100522439 3300005339 Bacteria 989
21 Ga0070660_100901114 3300005339 Unclassified 746
22 Ga0070691_10169540 3300005341 Bacteria 1130
23 Ga0070661_100545945 3300005344 Bacteria 932
24 Ga0070668_100425936 3300005347 Bacteria 1137
25 Ga0070671_100202953 3300005355 Bacteria 1681
26 Ga0070671_101590387 3300005355 Bacteria 579
27 Ga0070659_100104588 3300005366 Bacteria 2281
28 Ga0070659_100419140 3300005366 Bacteria 1132
29 Ga0070709_10059036 3300005434 Bacteria 2435
30 Ga0070709_10132303 3300005434 Bacteria 1704
31 Ga0070709_10458383 3300005434 Unclassified 962
32 Ga0070714_100006800 3300005435 Bacteria 8864
33 Ga0070714_100050816 3300005435 Bacteria 3533
34 Ga0070714_100106907 3300005435 Bacteria 2472
35 Ga0070714_100172145 3300005435 Bacteria 1965
36 Ga0070714_100416896 3300005435 Bacteria 1271
37 Ga0070714_100933467 3300005435 Bacteria 843
38 Ga0070713_100029034 3300005436 Bacteria 4374
39 Ga0070713_100054419 3300005436 Bacteria 3320
40 Ga0070713_100114150 3300005436 Bacteria 2359
41 Ga0070713_101909018 3300005436 Unclassified 576
42 Ga0070710_10007726 3300005437 Bacteria 5214
43 Ga0070711_100031534 3300005439 Bacteria 3519
44 Ga0070711_101046150 3300005439 Unclassified 702
45 Ga0070711_101842963 3300005439 Bacteria 531
46 Ga0070705_100834774 3300005440 Bacteria 736
47 Ga0070700_100156540 3300005441 Bacteria 1564
48 Ga0070694_101103257 3300005444 Bacteria 662
49 Ga0070708_101234786 3300005445 Bacteria 699
50 Ga0070708_101807674 3300005445 Bacteria 567
51 Ga0070678_100662154 3300005456 Bacteria 937
52 Ga0070681_10043324 3300005458 Bacteria 4509
53 Ga0070681_10045322 3300005458 Bacteria 4400
54 Ga0070681_10141953 3300005458 Bacteria 2331
55 Ga0070681_10372808 3300005458 Bacteria 1338
56 Ga0070681_10935539 3300005458 Bacteria 786
57 Ga0070707_100846238 3300005468 Unclassified 879
58 Ga0070698_100152739 3300005471 Bacteria 2255
59 Ga0070698_100751000 3300005471 Unclassified 919
60 Ga0070699_100209676 3300005518 Bacteria 1734
61 Ga0070679_100185790 3300005530 Unclassified 2049
62 Ga0070679_100224029 3300005530 Bacteria 1841
63 Ga0070679_100224516 3300005530 Bacteria 1839
64 Ga0070679_100262111 3300005530 Unclassified 1683
65 Ga0070679_100421654 3300005530 Bacteria 1280
66 Ga0070679_100557141 3300005530 Bacteria 1090
67 Ga0070679_101925900 3300005530 Bacteria 540
68 Ga0070684_100213157 3300005535 Bacteria 1760
69 Ga0070684_100249127 3300005535 Bacteria 1623
70 Ga0068853_100658199 3300005539 Unclassified 997
71 Ga0070695_100000393 3300005545 Bacteria 22683
72 Ga0070695_100890657 3300005545 Bacteria 718
73 Ga0070693_100130382 3300005547 Bacteria 1571
74 Ga0070665_102647762 3300005548 Bacteria 502
75 Ga0068855_100218222 3300005563 Bacteria 2140
76 Ga0068855_100454303 3300005563 Bacteria 1397
77 Ga0068855_101612540 3300005563 Bacteria 664
78 Ga0068855_101637636 3300005563 Bacteria 658
79 Ga0070664_100116565 3300005564 Bacteria 2336
80 Ga0068857_100622715 3300005577 Bacteria 1021
81 Ga0068854_100364816 3300005578 Bacteria 1186
82 Ga0068856_100878027 3300005614 Bacteria 916
83 Ga0068856_101139016 3300005614 Bacteria 797
84 Ga0068856_101238604 3300005614 Bacteria 762
85 Ga0068856_102241033 3300005614 Unclassified 555
86 Ga0068852_100159024 3300005616 Bacteria 2108
87 Ga0068852_101002001 3300005616 Bacteria 854
88 Ga0068864_101111706 3300005618 Bacteria 787
89 Ga0068858_102536587 3300005842 Unclassified 506
90 Ga0068858_102546356 3300005842 Unclassified 505
91 Ga0081455_10037432 3300005937 Bacteria 4309
92 Ga0081538_10001113 3300005981 Bacteria 28482
93 Ga0081538_10011209 3300005981 Bacteria 7281
94 Ga0081539_10016103 3300005985 Bacteria 5370
95 Ga0070717_10028548 3300006028 Bacteria 4467
96 Ga0070717_10124547 3300006028 Bacteria 2211
97 Ga0070717_10400465 3300006028 Bacteria 1233
98 Ga0070716_100016476 3300006173 Bacteria 3815
99 Ga0070712_100122418 3300006175 Bacteria 1959
100 Ga0075427_10000590 3300006194 Bacteria 4242
101 Ga0075428_100029322 3300006844 Bacteria 6087
102 Ga0075428_100200463 3300006844 Bacteria 2157
103 Ga0075430_100007745 3300006846 Bacteria 9072
104 Ga0075431_100020961 3300006847 Bacteria 6679
105 Ga0075431_100335778 3300006847 Bacteria 1521
106 Ga0075433_10013824 3300006852 Bacteria 6580
107 Ga0075433_10013946 3300006852 Bacteria 6552
108 Ga0075434_100018664 3300006871 Bacteria 6702
109 Ga0075434_100183739 3300006871 Bacteria 2111
110 Ga0075429_100024384 3300006880 Bacteria 5248
111 Ga0075436_100919114 3300006914 Unclassified 655
112 Ga0075435_100583535 3300007076 Bacteria 969
113 Ga0075435_101229320 3300007076 Unclassified 656
114 Ga0075435_101254532 3300007076 Unclassified 649
115 Ga0105240_10024931 3300009093 Bacteria 7873
116 Ga0105240_10146420 3300009093 Bacteria 2818
117 Ga0105240_10200209 3300009093 Bacteria 2341
118 Ga0105240_10756032 3300009093 Bacteria 1056
119 Ga0105240_11104345 3300009093 Bacteria 844
120 Ga0111539_10028289 3300009094 Bacteria 6841
121 Ga0111539_10427798 3300009094 Bacteria 1542
122 Ga0105245_10212951 3300009098 Bacteria 1861
123 Ga0105245_10264112 3300009098 Bacteria 1676
124 Ga0114129_10012071 3300009147 Bacteria 12295
125 Ga0114129_10043881 3300009147 Bacteria 6291
126 Ga0105241_10923862 3300009174 Bacteria 812
127 Ga0105248_10655463 3300009177 Bacteria 1184
128 Ga0105237_10959375 3300009545 Bacteria 862
129 Ga0105237_11942488 3300009545 Unclassified 597
130 Ga0105237_12745622 3300009545 Bacteria 503
131 Ga0105238_10189611 3300009551 Bacteria 2032
132 Ga0105238_11367508 3300009551 Bacteria 735
133 Ga0105239_11743761 3300010375 Bacteria 721
134 Ga0105239_13473863 3300010375 Unclassified 512
135 Ga0157373_10524082 3300013100 Bacteria 858
136 Ga0157371_11217932 3300013102 Bacteria 580
137 Ga0157371_11537898 3300013102 Unclassified 520
138 Ga0157370_10016123 3300013104 Bacteria 7574
139 Ga0157370_10022411 3300013104 Bacteria 6284
140 Ga0157370_10041821 3300013104 Bacteria 4418
141 Ga0157370_11005617 3300013104 Bacteria 755
142 Ga0157370_11023825 3300013104 Unclassified 747
143 Ga0157369_10004660 3300013105 Bacteria 16119
144 Ga0157369_10255103 3300013105 Unclassified 1830
145 Ga0157369_10539709 3300013105 Bacteria 1206
146 Ga0157369_12213467 3300013105 Unclassified 557
147 Ga0157374_10030374 3300013296 Bacteria 4906
148 Ga0157372_10021043 3300013307 Bacteria 7044
149 Ga0157372_10276256 3300013307 Bacteria 1953
150 Ga0157372_11417669 3300013307 Bacteria 801
151 Ga0157372_11499639 3300013307 Unclassified 777
152 Ga0157372_11535550 3300013307 Bacteria 767
153 Ga0157372_11894864 3300013307 Unclassified 685
154 Ga0163163_12635275 3300014325 Bacteria 560
155 Ga0157380_10198918 3300014326 Bacteria 1776
156 Ga0182008_10022715 3300014497 Bacteria 3211
157 Ga0182008_10044103 3300014497 Bacteria 2218
158 Ga0182008_10159391 3300014497 Bacteria 1135
159 Ga0157377_10825116 3300014745 Bacteria 686
160 Ga0157379_11140813 3300014968 Unclassified 748
161 Ga0182006_1215840 3300015261 Bacteria 633
162 Ga0182007_10191617 3300015262 Bacteria 711
163 Ga0182005_1249758 3300015265 Bacteria 548
164 Ga0206356_11791757 3300020070 Bacteria 2442
165 Ga0206354_10534634 3300020081 Bacteria 1314
166 Ga0213875_10054897 3300021388 Bacteria 1865
167 Ga0207692_10769539 3300025898 Bacteria 628
168 Ga0207685_10415115 3300025905 Bacteria 693
169 Ga0207699_10049801 3300025906 Bacteria 2467
170 Ga0207699_10050976 3300025906 Bacteria 2444
171 Ga0207699_10213505 3300025906 Bacteria 1313
172 Ga0207699_10860877 3300025906 Bacteria 668
173 Ga0207705_10012826 3300025909 Bacteria 6052
174 Ga0207705_10164124 3300025909 Bacteria 1670
175 Ga0207705_10199224 3300025909 Bacteria 1517
176 Ga0207705_10282637 3300025909 Bacteria 1270
177 Ga0207705_10362974 3300025909 Bacteria 1117
178 Ga0207707_10033680 3300025912 Bacteria 4483
179 Ga0207707_10154079 3300025912 Bacteria 2009
180 Ga0207707_10657421 3300025912 Bacteria 883
181 Ga0207707_10928319 3300025912 Bacteria 718
182 Ga0207695_10177963 3300025913 Bacteria 2049
183 Ga0207695_10237900 3300025913 Bacteria 1723
184 Ga0207695_10446189 3300025913 Bacteria 1177
185 Ga0207671_10164564 3300025914 Bacteria 1719
186 Ga0207693_10000964 3300025915 Bacteria 25831
187 Ga0207663_10030999 3300025916 Bacteria 3159
188 Ga0207663_10743448 3300025916 Bacteria 779
189 Ga0207660_10120381 3300025917 Bacteria 1987
190 Ga0207660_10128139 3300025917 Bacteria 1929
191 Ga0207660_11185890 3300025917 Bacteria 621
192 Ga0207657_10013269 3300025919 Bacteria 8084
193 Ga0207657_10192349 3300025919 Bacteria 1645
194 Ga0207657_10274661 3300025919 Bacteria 1339
195 Ga0207657_10750019 3300025919 Unclassified 756
196 Ga0207649_10139689 3300025920 Bacteria 1656
197 Ga0207649_10353800 3300025920 Bacteria 1088
198 Ga0207652_10038728 3300025921 Bacteria 4043
199 Ga0207652_10154228 3300025921 Bacteria 2057
200 Ga0207652_10182420 3300025921 Bacteria 1887
201 Ga0207652_10660449 3300025921 Bacteria 934
202 Ga0207652_10941014 3300025921 Bacteria 762
203 Ga0207646_10424447 3300025922 Unclassified 1200
204 Ga0207694_10224550 3300025924 Bacteria 1533
205 Ga0207694_11229355 3300025924 Bacteria 634
206 Ga0207687_10186143 3300025927 Bacteria 1612
207 Ga0207687_11355093 3300025927 Bacteria 611
208 Ga0207700_10008053 3300025928 Bacteria 6499
209 Ga0207700_10047569 3300025928 Bacteria 3180
210 Ga0207700_11875538 3300025928 Bacteria 526
211 Ga0207664_10005790 3300025929 Bacteria 8451
212 Ga0207664_10077497 3300025929 Bacteria 2693
213 Ga0207664_10165711 3300025929 Bacteria 1888
214 Ga0207664_10211736 3300025929 Bacteria 1677
215 Ga0207664_10321852 3300025929 Bacteria 1365
216 Ga0207664_10365407 3300025929 Bacteria 1279
217 Ga0207664_10473922 3300025929 Bacteria 1119
218 Ga0207664_10487097 3300025929 Bacteria 1103
219 Ga0207664_10868285 3300025929 Bacteria 811
220 Ga0207664_11925129 3300025929 Unclassified 514
221 Ga0207644_10288647 3300025931 Bacteria 1319
222 Ga0207644_11008232 3300025931 Bacteria 699
223 Ga0207690_10029640 3300025932 Bacteria 3483
224 Ga0207690_10335033 3300025932 Bacteria 1193
225 Ga0207669_10135749 3300025937 Bacteria 1699
226 Ga0207704_10148872 3300025938 Bacteria 1649
227 Ga0207665_10013449 3300025939 Bacteria 5381
228 Ga0207691_10760564 3300025940 Unclassified 815
229 Ga0207711_10397713 3300025941 Bacteria 1280
230 Ga0207711_11341213 3300025941 Bacteria 658
231 Ga0207679_10092077 3300025945 Bacteria 2348
232 Ga0207667_10125374 3300025949 Bacteria 2645
233 Ga0207667_10223449 3300025949 Bacteria 1929
234 Ga0207667_11052084 3300025949 Bacteria 799
235 Ga0207703_12005476 3300026035 Unclassified 555
236 Ga0207639_10581606 3300026041 Unclassified 1031
237 Ga0207639_11469845 3300026041 Bacteria 640
238 Ga0207678_10274274 3300026067 Bacteria 1447
239 Ga0207708_10225274 3300026075 Bacteria 1504
240 Ga0207702_10391668 3300026078 Bacteria 1338
241 Ga0207702_10886400 3300026078 Bacteria 884
242 Ga0207702_12107708 3300026078 Unclassified 553
243 Ga0207702_12341002 3300026078 Unclassified 522
244 Ga0207676_11420523 3300026095 Bacteria 690
245 Ga0207674_10431926 3300026116 Bacteria 1273
246 Ga0207683_10634836 3300026121 Bacteria 989
247 Ga0207698_10067080 3300026142 Bacteria 2828
248 Ga0207698_10490712 3300026142 Bacteria 1193
249 Ga0207428_10001190 3300027907 Bacteria 28004
250 Ga0265337_1057367 3300028556 Bacteria 1084
251 Ga0265337_1063791 3300028556 Bacteria 1018
252 Ga0265337_1093821 3300028556 Bacteria 818
253 Ga0265326_10022511 3300028558 Bacteria 1805
254 Ga0265319_1002310 3300028563 Bacteria 10520
255 Ga0265319_1002945 3300028563 Bacteria 9062
256 Ga0265319_1054326 3300028563 Bacteria 1314
257 Ga0265334_10009809 3300028573 Bacteria 4048
258 Ga0265334_10158113 3300028573 Bacteria 797
259 Ga0265318_10002950 3300028577 Bacteria 8818
260 Ga0265318_10010568 3300028577 Bacteria 4012
261 Ga0265323_10146950 3300028653 Bacteria 756
262 Ga0265322_10009592 3300028654 Bacteria 2809
263 Ga0265322_10080691 3300028654 Bacteria 923
264 Ga0265336_10001570 3300028666 Bacteria 10254
265 Ga0265336_10022541 3300028666 Bacteria 2004
266 Ga0265336_10041327 3300028666 Bacteria 1410
267 Ga0265338_10004508 3300028800 Bacteria 18779
268 Ga0265338_10016515 3300028800 Bacteria 8024
269 Ga0265338_10016873 3300028800 Bacteria 7905
270 Ga0265338_10021437 3300028800 Bacteria 6737
271 Ga0265338_10021638 3300028800 Bacteria 6695
272 Ga0265338_10026870 3300028800 Bacteria 5791
273 Ga0265338_10045918 3300028800 Bacteria 4010
274 Ga0265338_10059124 3300028800 Bacteria 3378
275 Ga0265324_10011282 3300029957 Bacteria 3410
276 Ga0265324_10277865 3300029957 Unclassified 569
277 Ga0265330_10028516 3300031235 Bacteria 2515
278 Ga0265330_10029044 3300031235 Bacteria 2488
279 Ga0265332_10014621 3300031238 Bacteria 3471
280 Ga0265332_10018345 3300031238 Bacteria 3087
281 Ga0265332_10407797 3300031238 Bacteria 561
282 Ga0265332_10486575 3300031238 Unclassified 511
283 Ga0265328_10032438 3300031239 Bacteria 1938
284 Ga0265320_10026485 3300031240 Bacteria 3033
285 Ga0265320_10064391 3300031240 Bacteria 1741
286 Ga0265325_10000453 3300031241 Bacteria 29634
287 Ga0265329_10004254 3300031242 Bacteria 6011
288 Ga0265329_10104851 3300031242 Bacteria 901
289 Ga0265340_10003413 3300031247 Bacteria 8974
290 Ga0265340_10037720 3300031247 Bacteria 2393
291 Ga0265339_10005781 3300031249 Bacteria 8211
292 Ga0265339_10031744 3300031249 Bacteria 2983
293 Ga0265339_10036063 3300031249 Bacteria 2769
294 Ga0265339_10044507 3300031249 Bacteria 2448
295 Ga0265331_10012453 3300031250 Bacteria 4607
296 Ga0265331_10030466 3300031250 Bacteria 2686
297 Ga0265331_10045650 3300031250 Bacteria 2115
298 Ga0265327_10010269 3300031251 Bacteria 6602
299 Ga0265327_10012478 3300031251 Bacteria 5726
300 Ga0265327_10032624 3300031251 Bacteria 2912
301 Ga0265327_10121724 3300031251 Bacteria 1236
302 Ga0265316_10033792 3300031344 Bacteria 4160
303 Ga0265316_10052875 3300031344 Bacteria 3184
304 Ga0265316_10455245 3300031344 Bacteria 917
305 Ga0265313_10025257 3300031595 Bacteria 3153
306 Ga0265313_10043563 3300031595 Bacteria 2197
307 Ga0265313_10049938 3300031595 Bacteria 2010
308 Ga0265314_10002833 3300031711 Bacteria 17262
309 Ga0265314_10022158 3300031711 Bacteria 4869
310 Ga0265342_10002319 3300031712 Bacteria 16552
311 Ga0265342_10030763 3300031712 Bacteria 3323
312 Ga0307405_10020909 3300031731 Bacteria 3668
313 Ga0307413_10203025 3300031824 Bacteria 1433
314 Ga0307413_10302607 3300031824 Bacteria 1213
315 Ga0307410_10239301 3300031852 Unclassified 1406
316 Ga0307410_10736049 3300031852 Bacteria 834
317 Ga0307410_10751081 3300031852 Bacteria 826
318 Ga0307406_10057377 3300031901 Bacteria 2497
319 Ga0307406_10256491 3300031901 Bacteria 1320
320 Ga0307406_12000520 3300031901 Bacteria 518
321 Ga0307407_10011507 3300031903 Bacteria 4215
322 Ga0307407_10267836 3300031903 Bacteria 1178
323 Ga0307412_10209278 3300031911 Bacteria 1487
324 Ga0307409_100082779 3300031995 Bacteria 2599
325 Ga0307409_100376968 3300031995 Bacteria 1347
326 Ga0307416_100000306 3300032002 Bacteria 25268
327 Ga0307416_100065882 3300032002 Bacteria 2979
328 Ga0307416_100100885 3300032002 Bacteria 2512
329 Ga0307416_100844102 3300032002 Bacteria 1014
330 Ga0307416_102613189 3300032002 Bacteria 602
331 Ga0307414_10503769 3300032004 Bacteria 1072
332 Ga0307414_11347049 3300032004 Unclassified 663
333 Ga0307411_10030410 3300032005 Bacteria 3310
334 Ga0307415_100000930 3300032126 Bacteria 13418
335 Ga0307415_100062175 3300032126 Bacteria 2588
336 Ga0307415_100158116 3300032126 Bacteria 1753
337 Ga0307415_100513206 3300032126 Bacteria 1050
338 Ga0307415_100697687 3300032126 Bacteria 915
339 Ga0373934_0089974 3300035086 Unclassified 1237
340 Ga0373934_0226779 3300035086 Bacteria 771
341 Ga0373951_0035178 3300035091 Bacteria 1192
342 Ga0373939_0149791 3300035114 Bacteria 848
343 Ga0373954_0066752 3300035118 Bacteria 1704
344 Ga0373954_0255267 3300035118 Bacteria 863
345 Ga0373957_0361873 3300035120 Bacteria 621
346 Ga0373955_0148769 3300035172 Bacteria 1377
347 Ga0373924_0255472 3300035410 Bacteria 776
348 Ga0373933_0029412 3300035724 Bacteria 3177
349 Ga0373937_0184320 3300036401 Bacteria 1960
350 Ga0373937_0455363 3300036401 Bacteria 1215
351 Ga0395899_0040170 3300037312 Unclassified 3499
352 Ga0395899_0450104 3300037312 Bacteria 843
353 Ga0395900_0178615 3300037418 Bacteria 2158
354 Ga0395900_0276795 3300037418 Bacteria 1671
355 Ga0395900_0849191 3300037418 Bacteria 839
356 Ga0395900_0883116 3300037418 Bacteria 818
357 Ga0395900_1656174 3300037418 Bacteria 551
358 Ga0395900_1718069 3300037418 Unclassified 538
359 Ga0395898_0075428 3300037466 Bacteria 3257
360 Ga0395898_0153315 3300037466 Bacteria 2204
361 Ga0395898_0338849 3300037466 Bacteria 1434
362 Ga0395898_0351996 3300037466 Bacteria 1404
363 Ga0395898_1226098 3300037466 Bacteria 681
364 Ga0395898_1373564 3300037466 Bacteria 634
365 Ga0395905_0150706 3300037471 Bacteria 2188
366 Ga0395905_0344112 3300037471 Bacteria 1382
367 Ga0436364_0601973 3300037853 Bacteria 29284
368 Ga0395901_0252028 3300038443 Unclassified 1839
369 Ga0395901_0269636 3300038443 Bacteria 1771
370 Ga0395901_0590990 3300038443 Bacteria 1120
371 Ga0395901_0730722 3300038443 Bacteria 985
372 Ga0395901_1304902 3300038443 Bacteria 687
373 Ga0436363_0088266 3300039450 Bacteria 8561
374 Ga0436363_0839180 3300039450 Unclassified 1001
375 Ga0451839_1027749 3300041496 Bacteria 817
376 Ga0439448_0030869 3300042005 Bacteria 1701
377 Ga0450914_046087 3300042118 Unclassified 564
378 Ga0439458_0074899 3300042157 Bacteria 859
379 Ga0439440_0020634 3300042993 Bacteria 1479
380 Ga0439440_0104752 3300042993 Unclassified 773
381 Ga0439440_0153640 3300042993 Bacteria 660
382 Ga0466969_0041058 3300044656 Bacteria 2316
383 Ga0466972_0207411 3300044658 Bacteria 917
384 Ga0466966_0005166 3300044684 Bacteria 8579
385 Ga0466966_0036173 3300044684 Bacteria 3189
386 Ga0466961_0140424 3300044693 Unclassified 1512
387 Ga0466961_0177989 3300044693 Bacteria 1321
388 Ga0466963_0004956 3300044694 Bacteria 7763
389 Ga0466963_0008918 3300044694 Bacteria 6020
390 Ga0466963_0014973 3300044694 Bacteria 4792
391 Ga0466963_0064071 3300044694 Bacteria 2461
392 Ga0466963_0088074 3300044694 Bacteria 2111
393 Ga0466963_0169355 3300044694 Bacteria 1522
394 Ga0466963_0314891 3300044694 Bacteria 1101
395 Ga0466963_0749912 3300044694 Bacteria 689
396 Ga0466963_0874936 3300044694 Bacteria 633
397 Ga0466963_0919930 3300044694 Bacteria 616
398 Ga0466963_1337025 3300044694 Bacteria 503
399 Ga0466964_0001680 3300044706 Bacteria 7642
400 Ga0466964_0001976 3300044706 Bacteria 7194
401 Ga0466964_0069379 3300044706 Bacteria 1486
402 Ga0466964_0306683 3300044706 Unclassified 802
403 Ga0466971_0004164 3300044719 Bacteria 6233
404 Ga0466971_0063093 3300044719 Unclassified 1677
405 Ga0466971_0099539 3300044719 Bacteria 1335
406 Ga0466971_0127653 3300044719 Unclassified 1179
407 Ga0466971_0144444 3300044719 Bacteria 1109
408 Ga0466971_0204630 3300044719 Bacteria 932
409 Ga0466968_0001841 3300044735 Bacteria 7657
410 Ga0466968_0036892 3300044735 Bacteria 2049
411 Ga0466968_0061994 3300044735 Bacteria 1614
412 Ga0466968_0091241 3300044735 Bacteria 1350
413 Ga0466968_0353674 3300044735 Bacteria 714
414 Ga0466970_0055263 3300044765 Bacteria 2120
415 Ga0466970_0228513 3300044765 Bacteria 1039
416 Ga0466957_0000839 3300044842 Bacteria 15709
417 Ga0466957_0005602 3300044842 Bacteria 7057
418 Ga0466957_0011876 3300044842 Bacteria 5034
419 Ga0466957_0014602 3300044842 Bacteria 4576
420 Ga0466957_0055290 3300044842 Bacteria 2426
421 Ga0466957_0363862 3300044842 Bacteria 983
422 Ga0466957_0537836 3300044842 Bacteria 813
423 Ga0466957_0945702 3300044842 Bacteria 617
424 Ga0466959_0002503 3300045049 Bacteria 11770
425 Ga0466959_0133999 3300045049 Bacteria 1755
426 Ga0466959_0260048 3300045049 Bacteria 1195
427 Ga0466959_0543850 3300045049 Bacteria 783
428 Ga0466958_0001766 3300045836 Bacteria 10466
429 Ga0466958_0004935 3300045836 Bacteria 7113
430 Ga0466958_0028945 3300045836 Bacteria 3286
431 Ga0466958_0165325 3300045836 Bacteria 1400
432 Ga0466958_0326668 3300045836 Bacteria 986
433 Ga0466958_0439240 3300045836 Bacteria 844
434 Ga0466967_0005346 3300045976 Bacteria 8876
435 Ga0466967_0006620 3300045976 Bacteria 8234
436 Ga0466967_0008127 3300045976 Bacteria 7657
437 Ga0466967_0009557 3300045976 Bacteria 7204
438 Ga0466967_0034363 3300045976 Bacteria 4302
439 Ga0466967_0074693 3300045976 Bacteria 3045
440 Ga0466967_0091170 3300045976 Bacteria 2769
441 Ga0466967_0112223 3300045976 Bacteria 2506
442 Ga0466967_0129314 3300045976 Bacteria 2343
443 Ga0466967_0173973 3300045976 Bacteria 2027
444 Ga0466967_0192421 3300045976 Bacteria 1928
445 Ga0466967_0197028 3300045976 Bacteria 1906
446 Ga0466967_0317509 3300045976 Bacteria 1502
447 Ga0466967_0406344 3300045976 Unclassified 1325
448 Ga0466967_1268203 3300045976 Bacteria 734
449 Ga0466967_1312219 3300045976 Unclassified 721
450 Ga0466967_1365879 3300045976 Unclassified 706
451 Ga0466967_2054956 3300045976 Unclassified 568
452 Ga0495592_0112615 3300046454 Bacteria 1923
453 Ga0495651_0121844 3300046462 Bacteria 1915
454 Ga0495653_0364669 3300046463 Unclassified 926
455 Ga0495582_0708626 3300046473 Bacteria 582
456 Ga0495608_0047598 3300046511 Bacteria 2850
457 Ga0495608_0929760 3300046511 Bacteria 508
458 Ga0495618_0045317 3300046514 Bacteria 2774
459 Ga0495618_0576770 3300046514 Bacteria 671
460 Ga0495628_0307212 3300046516 Bacteria 1173
461 Ga0495630_0167052 3300046517 Bacteria 1675
462 Ga0495630_0529115 3300046517 Bacteria 904
463 Ga0495630_0709201 3300046517 Bacteria 770
464 Ga0495640_0016020 3300046533 Bacteria 5621
465 Ga0495645_0451700 3300046543 Bacteria 810
466 Ga0495667_0306847 3300046559 Bacteria 1005
467 Ga0495634_0056266 3300046642 Bacteria 2628
468 Ga0495634_0201502 3300046642 Unclassified 1236
469 Ga0495635_0013904 3300046663 Bacteria 5631
470 Ga0495635_0062502 3300046663 Bacteria 2557
471 Ga0495635_0351977 3300046663 Bacteria 982
472 Ga0495657_0129175 3300046675 Unclassified 1584
473 Ga0495657_0549142 3300046675 Bacteria 671
474 Ga0495657_0892697 3300046675 Bacteria 505
475 Ga0495646_0301132 3300046680 Bacteria 848
476 Ga0495613_0394405 3300046689 Bacteria 945
477 Ga0495613_0750231 3300046689 Bacteria 640
478 Ga0495604_0169862 3300047317 Bacteria 1535
479 Ga0495636_0366278 3300047318 Bacteria 682
480 Ga0495674_0090385 3300047319 Bacteria 2616
481 Ga0495674_0770242 3300047319 Bacteria 750
482 Ga0495680_0839345 3300047322 Unclassified 598
483 Ga0495680_1060270 3300047322 Unclassified 514
484 Ga0495680_1083873 3300047322 Unclassified 507
485 Ga0495675_0306137 3300047444 Bacteria 943
486 Ga0495684_0097766 3300047471 Bacteria 2220
487 Ga0495684_0103387 3300047471 Bacteria 2153
488 Ga0495684_0285790 3300047471 Bacteria 1188
489 Ga0495602_0777455 3300048088 Bacteria 644
490 Ga0495602_1088199 3300048088 Unclassified 524
491 Ga0496100_0012368 3300048903 Bacteria 4890
492 Ga0496102_0032716 3300048905 Bacteria 4673
493 Ga0496102_0236273 3300048905 Bacteria 1723
494 Ga0496103_0019776 3300048906 Bacteria 4042
495 Ga0496103_0077535 3300048906 Bacteria 2086
496 Ga0496104_0497929 3300048907 Bacteria 1129
497 Ga0496105_0057053 3300048908 Bacteria 3224
498 Ga0496106_0030374 3300048909 Bacteria 4030
499 Ga0496107_0059855 3300048910 Bacteria 2756
500 Ga0496108_0031623 3300048911 Bacteria 4392
501 Ga0496109_0053696 3300048912 Bacteria 3675
502 Ga0496110_0038024 3300048913 Bacteria 4185
503 Ga0496110_0485280 3300048913 Bacteria 1126
504 Ga0496111_0021414 3300048914 Bacteria 4514
505 Ga0496111_0700314 3300048914 Bacteria 737
506 Ga0496112_0047465 3300048915 Bacteria 4213
507 Ga0496112_0068960 3300048915 Bacteria 3493
508 Ga0496112_0102958 3300048915 Bacteria 2824
509 Ga0496112_0472137 3300048915 Bacteria 1191
510 Ga0496112_0757643 3300048915 Bacteria 897
511 Ga0496113_0040740 3300048916 Bacteria 3424
512 Ga0496113_0304233 3300048916 Bacteria 1277
513 Ga0496113_0802609 3300048916 Bacteria 748
514 Ga0496113_0955262 3300048916 Unclassified 676
515 Ga0496114_0068218 3300048917 Bacteria 2985
516 Ga0496115_0096138 3300048918 Bacteria 2425
517 Ga0501031_0001219 3300049568 Bacteria 15732
518 Ga0501032_0136844 3300049569 Bacteria 1614
519 Ga0501033_0013698 3300049570 Bacteria 6170
520 Ga0501034_0004154 3300049571 Bacteria 16214
521 Ga0501034_1029845 3300049571 Bacteria 706
522 Ga0501036_0001012 3300049572 Bacteria 21208
523 Ga0501037_0118841 3300049573 Bacteria 1901
524 Ga0501038_0131989 3300049574 Bacteria 2049
525 Ga0501039_0000777 3300049575 Bacteria 22938
526 Ga0501040_0000970 3300049576 Bacteria 18153
527 Ga0501041_0000521 3300049577 Bacteria 19853
528 Ga0501042_0000384 3300049578 Bacteria 22447
529 Ga0501043_0005685 3300049579 Bacteria 10045
530 Ga0501046_0005314 3300049580 Bacteria 11518
531 Ga0501048_0000488 3300049582 Bacteria 27710
532 Ga0501067_0076281 3300049583 Unclassified 1857
533 Ga0501067_0106131 3300049583 Bacteria 1561
534 Ga0501067_0156485 3300049583 Bacteria 1270
535 Ga0501067_0841133 3300049583 Bacteria 517
536 Ga0501068_0081940 3300049584 Bacteria 1981
537 Ga0501069_0029782 3300049585 Bacteria 2997
538 Ga0501069_0314783 3300049585 Bacteria 919
539 Ga0501070_0005070 3300049586 Bacteria 11223
540 Ga0501070_0050585 3300049586 Bacteria 3449
541 Ga0501070_0507919 3300049586 Bacteria 968
542 Ga0501071_0001049 3300049587 Bacteria 15310
543 Ga0501072_0002834 3300049588 Bacteria 13015
544 Ga0501072_0015504 3300049588 Bacteria 5841
545 Ga0501073_0115410 3300049589 Bacteria 1861
546 Ga0501073_0242548 3300049589 Bacteria 1244
547 Ga0501074_0001561 3300049590 Bacteria 15492
548 Ga0501074_0010895 3300049590 Bacteria 6600
549 Ga0501074_0029258 3300049590 Bacteria 3990
550 Ga0501075_0007067 3300049591 Bacteria 7755
551 Ga0501076_0000670 3300049592 Bacteria 21958
552 Ga0501077_0000979 3300049593 Bacteria 17210
553 Ga0501079_0000766 3300049741 Bacteria 21943
554 Ga0501079_0094604 3300049741 Bacteria 2315
555 Ga0501080_0002096 3300049742 Bacteria 17315
556 Ga0501080_0004391 3300049742 Bacteria 12530
557 Ga0501080_0065727 3300049742 Bacteria 3373
558 Ga0501081_0000421 3300049743 Bacteria 23417
559 Ga0501083_0009464 3300049744 Bacteria 6883
560 Ga0501083_0032395 3300049744 Bacteria 3584
561 Ga0501035_0009537 3300049822 Bacteria 9026
562 Ga0501044_0174414 3300049823 Bacteria 2120
563 Ga0501044_0608092 3300049823 Bacteria 986
564 Ga0501045_0001105 3300049824 Bacteria 17822
565 nmdc:mga05p37_19132_c1 3300050507 Bacteria 8284
566 nmdc:mga05p37_56249_c1 3300050507 Bacteria 4843
567 nmdc:mga09592_32597_c1 3300050508 Bacteria 4344
568 nmdc:mga0qj67_6104_c1 3300050509 Bacteria 8830
569 nmdc:mga06r32_473678_c1 3300050510 Unclassified 1231
570 nmdc:mga06r32_571254_c1 3300050510 Bacteria 1103
571 nmdc:mga06r32_7228_c1 3300050510 Bacteria 10009
572 nmdc:mga08y16_493_c1 3300050511 Bacteria 36438
573 nmdc:mga0n895_13975_c1 3300050512 Bacteria 7271
574 nmdc:mga0n895_511440_c1 3300050512 Bacteria 1209
575 nmdc:mga0n895_89825_c1 3300050512 Bacteria 3073
576 nmdc:mga0rr50_100538_c1 3300050513 Bacteria 2271
577 nmdc:mga0rr50_1297854_c1 3300050513 Unclassified 617
578 nmdc:mga0a205_44534_c3 3300050515 Bacteria 1321
579 nmdc:mga0a205_6411_c1 3300050515 Bacteria 10633
580 Ga0495601_0159394 3300053077 Bacteria 1474
581 Ga0495601_0247133 3300053077 Bacteria 1165
582 Ga0495595_0364801 3300053084 Unclassified 730
583 Ga0495619_0089025 3300053085 Bacteria 2088
584 Ga0500566_0253153 3300053094 Bacteria 855
585 Ga0501084_0000718 3300054114 Bacteria 25255
586 Ga0501082_0004632 3300060353 Bacteria 12001
587 Ga0501082_0098702 3300060353 Bacteria 2525
588 Ga0466962_0110085 3300061719 Unclassified 1326
589 Ga0466962_0143216 3300061719 Bacteria 1158
590 Ga0466962_0178183 3300061719 Unclassified 1036
591 Ga0466962_0534266 3300061719 Bacteria 595
592 Ga0530510_0000732 3300061734 Bacteria 21330
593 Ga0466959_0004905
594 JGI25406J46586_10046131
595 rootH2_10070391
596 JGI25407J50210_10022749
597 Ga0070658_10009450
598 Ga0070658_10192754
599 Ga0070658_10212063
600 Ga0070658_10280594
601 Ga0070658_10423686
602 Ga0070658_10448519
603 Ga0070658_10572659
604 Ga0070680_100217097
605 Ga0070680_100552767
606 Ga0070680_101394368
607 Ga0070682_100130681
608 Ga0070682_100605611
609 Ga0070682_100726919
610 Ga0070660_100006295
611 Ga0070660_100185104
612 Ga0070660_100522439
613 Ga0070660_100901114
614 Ga0070691_10169540
615 Ga0070661_100545945
616 Ga0070668_100425936
617 Ga0070671_100202953
618 Ga0070671_101590387
619 Ga0070659_100104588
620 Ga0070659_100419140
621 Ga0070709_10059036
622 Ga0070709_10132303
623 Ga0070709_10458383
624 Ga0070714_100006800
625 Ga0070714_100050816
626 Ga0070714_100106907
627 Ga0070714_100172145
628 Ga0070714_100416896
629 Ga0070714_100933467
630 Ga0070713_100029034
631 Ga0070713_100054419
632 Ga0070713_100114150
633 Ga0070713_101909018
634 Ga0070710_10007726
635 Ga0070711_100031534
636 Ga0070711_101046150
637 Ga0070711_101842963
638 Ga0070705_100834774
639 Ga0070700_100156540
640 Ga0070694_101103257
641 Ga0070708_101234786
642 Ga0070708_101807674
643 Ga0070678_100662154
644 Ga0070681_10043324
645 Ga0070681_10045322
646 Ga0070681_10141953
647 Ga0070681_10372808
648 Ga0070681_10935539
649 Ga0070707_100846238
650 Ga0070698_100152739
651 Ga0070698_100751000
652 Ga0070699_100209676
653 Ga0070679_100185790
654 Ga0070679_100224029
655 Ga0070679_100224516
656 Ga0070679_100262111
657 Ga0070679_100421654
658 Ga0070679_100557141
659 Ga0070679_101925900
660 Ga0070684_100213157
661 Ga0070684_100249127
662 Ga0068853_100658199
663 Ga0070695_100000393
664 Ga0070695_100890657
665 Ga0070693_100130382
666 Ga0070665_102647762
667 Ga0068855_100218222
668 Ga0068855_100454303
669 Ga0068855_101612540
670 Ga0068855_101637636
671 Ga0070664_100116565
672 Ga0068857_100622715
673 Ga0068854_100364816
674 Ga0068856_100878027
675 Ga0068856_101139016
676 Ga0068856_101238604
677 Ga0068856_102241033
678 Ga0068852_100159024
679 Ga0068852_101002001
680 Ga0068864_101111706
681 Ga0068858_102536587
682 Ga0068858_102546356
683 Ga0081455_10037432
684 Ga0081538_10001113
685 Ga0081538_10011209
686 Ga0081539_10016103
687 Ga0070717_10028548
688 Ga0070717_10124547
689 Ga0070717_10400465
690 Ga0070716_100016476
691 Ga0070712_100122418
692 Ga0075427_10000590
693 Ga0075428_100029322
694 Ga0075428_100200463
695 Ga0075430_100007745
696 Ga0075431_100020961
697 Ga0075431_100335778
698 Ga0075433_10013824
699 Ga0075433_10013946
700 Ga0075434_100018664
701 Ga0075434_100183739
702 Ga0075429_100024384
703 Ga0075436_100919114
704 Ga0075435_100583535
705 Ga0075435_101229320
706 Ga0075435_101254532
707 Ga0105240_10024931
708 Ga0105240_10146420
709 Ga0105240_10200209
710 Ga0105240_10756032
711 Ga0105240_11104345
712 Ga0111539_10028289
713 Ga0111539_10427798
714 Ga0105245_10212951
715 Ga0105245_10264112
716 Ga0114129_10012071
717 Ga0114129_10043881
718 Ga0105241_10923862
719 Ga0105248_10655463
720 Ga0105237_10959375
721 Ga0105237_11942488
722 Ga0105237_12745622
723 Ga0105238_10189611
724 Ga0105238_11367508
725 Ga0105239_11743761
726 Ga0105239_13473863
727 Ga0157373_10524082
728 Ga0157371_11217932
729 Ga0157371_11537898
730 Ga0157370_10016123
731 Ga0157370_10022411
732 Ga0157370_10041821
733 Ga0157370_11005617
734 Ga0157370_11023825
735 Ga0157369_10004660
736 Ga0157369_10255103
737 Ga0157369_10539709
738 Ga0157369_12213467
739 Ga0157374_10030374
740 Ga0157372_10021043
741 Ga0157372_10276256
742 Ga0157372_11417669
743 Ga0157372_11499639
744 Ga0157372_11535550
745 Ga0157372_11894864
746 Ga0163163_12635275
747 Ga0157380_10198918
748 Ga0182008_10022715
749 Ga0182008_10044103
750 Ga0182008_10159391
751 Ga0157377_10825116
752 Ga0157379_11140813
753 Ga0182006_1215840
754 Ga0182007_10191617
755 Ga0182005_1249758
756 Ga0206356_11791757
757 Ga0206354_10534634
758 Ga0213875_10054897
759 Ga0207692_10769539
760 Ga0207685_10415115
761 Ga0207699_10049801
762 Ga0207699_10050976
763 Ga0207699_10213505
764 Ga0207699_10860877
765 Ga0207705_10012826
766 Ga0207705_10164124
767 Ga0207705_10199224
768 Ga0207705_10282637
769 Ga0207705_10362974
770 Ga0207707_10033680
771 Ga0207707_10154079
772 Ga0207707_10657421
773 Ga0207707_10928319
774 Ga0207695_10177963
775 Ga0207695_10237900
776 Ga0207695_10446189
777 Ga0207671_10164564
778 Ga0207693_10000964
779 Ga0207663_10030999
780 Ga0207663_10743448
781 Ga0207660_10120381
782 Ga0207660_10128139
783 Ga0207660_11185890
784 Ga0207657_10013269
785 Ga0207657_10192349
786 Ga0207657_10274661
787 Ga0207657_10750019
788 Ga0207649_10139689
789 Ga0207649_10353800
790 Ga0207652_10038728
791 Ga0207652_10154228
792 Ga0207652_10182420
793 Ga0207652_10660449
794 Ga0207652_10941014
795 Ga0207646_10424447
796 Ga0207694_10224550
797 Ga0207694_11229355
798 Ga0207687_10186143
799 Ga0207687_11355093
800 Ga0207700_10008053
801 Ga0207700_10047569
802 Ga0207700_11875538
803 Ga0207664_10005790
804 Ga0207664_10077497
805 Ga0207664_10165711
806 Ga0207664_10211736
807 Ga0207664_10321852
808 Ga0207664_10365407
809 Ga0207664_10473922
810 Ga0207664_10487097
811 Ga0207664_10868285
812 Ga0207664_11925129
813 Ga0207644_10288647
814 Ga0207644_11008232
815 Ga0207690_10029640
816 Ga0207690_10335033
817 Ga0207669_10135749
818 Ga0207704_10148872
819 Ga0207665_10013449
820 Ga0207691_10760564
821 Ga0207711_10397713
822 Ga0207711_11341213
823 Ga0207679_10092077
824 Ga0207667_10125374
825 Ga0207667_10223449
826 Ga0207667_11052084
827 Ga0207703_12005476
828 Ga0207639_10581606
829 Ga0207639_11469845
830 Ga0207678_10274274
831 Ga0207708_10225274
832 Ga0207702_10391668
833 Ga0207702_10886400
834 Ga0207702_12107708
835 Ga0207702_12341002
836 Ga0207676_11420523
837 Ga0207674_10431926
838 Ga0207683_10634836
839 Ga0207698_10067080
840 Ga0207698_10490712
841 Ga0207428_10001190
842 Ga0265337_1057367
843 Ga0265337_1063791
844 Ga0265337_1093821
845 Ga0265326_10022511
846 Ga0265319_1002310
847 Ga0265319_1002945
848 Ga0265319_1054326
849 Ga0265334_10009809
850 Ga0265334_10158113
851 Ga0265318_10002950
852 Ga0265318_10010568
853 Ga0265323_10146950
854 Ga0265322_10009592
855 Ga0265322_10080691
856 Ga0265336_10001570
857 Ga0265336_10022541
858 Ga0265336_10041327
859 Ga0265338_10004508
860 Ga0265338_10016515
861 Ga0265338_10016873
862 Ga0265338_10021437
863 Ga0265338_10021638
864 Ga0265338_10026870
865 Ga0265338_10045918
866 Ga0265338_10059124
867 Ga0265324_10011282
868 Ga0265324_10277865
869 Ga0265330_10028516
870 Ga0265330_10029044
871 Ga0265332_10014621
872 Ga0265332_10018345
873 Ga0265332_10407797
874 Ga0265332_10486575
875 Ga0265328_10032438
876 Ga0265320_10026485
877 Ga0265320_10064391
878 Ga0265325_10000453
879 Ga0265329_10004254
880 Ga0265329_10104851
881 Ga0265340_10003413
882 Ga0265340_10037720
883 Ga0265339_10005781
884 Ga0265339_10031744
885 Ga0265339_10036063
886 Ga0265339_10044507
887 Ga0265331_10012453
888 Ga0265331_10030466
889 Ga0265331_10045650
890 Ga0265327_10010269
891 Ga0265327_10012478
892 Ga0265327_10032624
893 Ga0265327_10121724
894 Ga0265316_10033792
895 Ga0265316_10052875
896 Ga0265316_10455245
897 Ga0265313_10025257
898 Ga0265313_10043563
899 Ga0265313_10049938
900 Ga0265314_10002833
901 Ga0265314_10022158
902 Ga0265342_10002319
903 Ga0265342_10030763
904 Ga0307405_10020909
905 Ga0307413_10203025
906 Ga0307413_10302607
907 Ga0307410_10239301
908 Ga0307410_10736049
909 Ga0307410_10751081
910 Ga0307406_10057377
911 Ga0307406_10256491
912 Ga0307406_12000520
913 Ga0307407_10011507
914 Ga0307407_10267836
915 Ga0307412_10209278
916 Ga0307409_100082779
917 Ga0307409_100376968
918 Ga0307416_100000306
919 Ga0307416_100065882
920 Ga0307416_100100885
921 Ga0307416_100844102
922 Ga0307416_102613189
923 Ga0307414_10503769
924 Ga0307414_11347049
925 Ga0307411_10030410
926 Ga0307415_100000930
927 Ga0307415_100062175
928 Ga0307415_100158116
929 Ga0307415_100513206
930 Ga0307415_100697687
931 Ga0373934_0089974
932 Ga0373934_0226779
933 Ga0373951_0035178
934 Ga0373939_0149791
935 Ga0373954_0066752
936 Ga0373954_0255267
937 Ga0373957_0361873
938 Ga0373955_0148769
939 Ga0373924_0255472
940 Ga0373933_0029412
941 Ga0373937_0184320
942 Ga0373937_0455363
943 Ga0395899_0040170
944 Ga0395899_0450104
945 Ga0395900_0178615
946 Ga0395900_0276795
947 Ga0395900_0849191
948 Ga0395900_0883116
949 Ga0395900_1656174
950 Ga0395900_1718069
951 Ga0395898_0075428
952 Ga0395898_0153315
953 Ga0395898_0338849
954 Ga0395898_0351996
955 Ga0395898_1226098
956 Ga0395898_1373564
957 Ga0395905_0150706
958 Ga0395905_0344112
959 Ga0436364_0601973
960 Ga0395901_0252028
961 Ga0395901_0269636
962 Ga0395901_0590990
963 Ga0395901_0730722
964 Ga0395901_1304902
965 Ga0436363_0088266
966 Ga0436363_0839180
967 Ga0451839_1027749
968 Ga0439448_0030869
969 Ga0450914_046087
970 Ga0439458_0074899
971 Ga0439440_0020634
972 Ga0439440_0104752
973 Ga0439440_0153640
974 Ga0466969_0041058
975 Ga0466972_0207411
976 Ga0466966_0005166
977 Ga0466966_0036173
978 Ga0466961_0140424
979 Ga0466961_0177989
980 Ga0466963_0004956
981 Ga0466963_0008918
982 Ga0466963_0014973
983 Ga0466963_0064071
984 Ga0466963_0088074
985 Ga0466963_0169355
986 Ga0466963_0314891
987 Ga0466963_0749912
988 Ga0466963_0874936
989 Ga0466963_0919930
990 Ga0466963_1337025
991 Ga0466964_0001680
992 Ga0466964_0001976
993 Ga0466964_0069379
994 Ga0466964_0306683
995 Ga0466971_0004164
996 Ga0466971_0063093
997 Ga0466971_0099539
998 Ga0466971_0127653
999 Ga0466971_0144444
1000 Ga0466971_0204630
1001 Ga0466968_0001841
1002 Ga0466968_0036892
1003 Ga0466968_0061994
1004 Ga0466968_0091241
1005 Ga0466968_0353674
1006 Ga0466970_0055263
1007 Ga0466970_0228513
1008 Ga0466957_0000839
1009 Ga0466957_0005602
1010 Ga0466957_0011876
1011 Ga0466957_0014602
1012 Ga0466957_0055290
1013 Ga0466957_0363862
1014 Ga0466957_0537836
1015 Ga0466957_0945702
1016 Ga0466959_0002503
1017 Ga0466959_0133999
1018 Ga0466959_0260048
1019 Ga0466959_0543850
1020 Ga0466958_0001766
1021 Ga0466958_0004935
1022 Ga0466958_0028945
1023 Ga0466958_0165325
1024 Ga0466958_0326668
1025 Ga0466958_0439240
1026 Ga0466967_0005346
1027 Ga0466967_0006620
1028 Ga0466967_0008127
1029 Ga0466967_0009557
1030 Ga0466967_0034363
1031 Ga0466967_0074693
1032 Ga0466967_0091170
1033 Ga0466967_0112223
1034 Ga0466967_0129314
1035 Ga0466967_0173973
1036 Ga0466967_0192421
1037 Ga0466967_0197028
1038 Ga0466967_0317509
1039 Ga0466967_0406344
1040 Ga0466967_1268203
1041 Ga0466967_1312219
1042 Ga0466967_1365879
1043 Ga0466967_2054956
1044 Ga0495592_0112615
1045 Ga0495651_0121844
1046 Ga0495653_0364669
1047 Ga0495582_0708626
1048 Ga0495608_0047598
1049 Ga0495608_0929760
1050 Ga0495618_0045317
1051 Ga0495618_0576770
1052 Ga0495628_0307212
1053 Ga0495630_0167052
1054 Ga0495630_0529115
1055 Ga0495630_0709201
1056 Ga0495640_0016020
1057 Ga0495645_0451700
1058 Ga0495667_0306847
1059 Ga0495634_0056266
1060 Ga0495634_0201502
1061 Ga0495635_0013904
1062 Ga0495635_0062502
1063 Ga0495635_0351977
1064 Ga0495657_0129175
1065 Ga0495657_0549142
1066 Ga0495657_0892697
1067 Ga0495646_0301132
1068 Ga0495613_0394405
1069 Ga0495613_0750231
1070 Ga0495604_0169862
1071 Ga0495636_0366278
1072 Ga0495674_0090385
1073 Ga0495674_0770242
1074 Ga0495680_0839345
1075 Ga0495680_1060270
1076 Ga0495680_1083873
1077 Ga0495675_0306137
1078 Ga0495684_0097766
1079 Ga0495684_0103387
1080 Ga0495684_0285790
1081 Ga0495602_0777455
1082 Ga0495602_1088199
1083 Ga0496100_0012368
1084 Ga0496102_0032716
1085 Ga0496102_0236273
1086 Ga0496103_0019776
1087 Ga0496103_0077535
1088 Ga0496104_0497929
1089 Ga0496105_0057053
1090 Ga0496106_0030374
1091 Ga0496107_0059855
1092 Ga0496108_0031623
1093 Ga0496109_0053696
1094 Ga0496110_0038024
1095 Ga0496110_0485280
1096 Ga0496111_0021414
1097 Ga0496111_0700314
1098 Ga0496112_0047465
1099 Ga0496112_0068960
1100 Ga0496112_0102958
1101 Ga0496112_0472137
1102 Ga0496112_0757643
1103 Ga0496113_0040740
1104 Ga0496113_0304233
1105 Ga0496113_0802609
1106 Ga0496113_0955262
1107 Ga0496114_0068218
1108 Ga0496115_0096138
1109 Ga0501031_0001219
1110 Ga0501032_0136844
1111 Ga0501033_0013698
1112 Ga0501034_0004154
1113 Ga0501034_1029845
1114 Ga0501036_0001012
1115 Ga0501037_0118841
1116 Ga0501038_0131989
1117 Ga0501039_0000777
1118 Ga0501040_0000970
1119 Ga0501041_0000521
1120 Ga0501042_0000384
1121 Ga0501043_0005685
1122 Ga0501046_0005314
1123 Ga0501048_0000488
1124 Ga0501067_0076281
1125 Ga0501067_0106131
1126 Ga0501067_0156485
1127 Ga0501067_0841133
1128 Ga0501068_0081940
1129 Ga0501069_0029782
1130 Ga0501069_0314783
1131 Ga0501070_0005070
1132 Ga0501070_0050585
1133 Ga0501070_0507919
1134 Ga0501071_0001049
1135 Ga0501072_0002834
1136 Ga0501072_0015504
1137 Ga0501073_0115410
1138 Ga0501073_0242548
1139 Ga0501074_0001561
1140 Ga0501074_0010895
1141 Ga0501074_0029258
1142 Ga0501075_0007067
1143 Ga0501076_0000670
1144 Ga0501077_0000979
1145 Ga0501079_0000766
1146 Ga0501079_0094604
1147 Ga0501080_0002096
1148 Ga0501080_0004391
1149 Ga0501080_0065727
1150 Ga0501081_0000421
1151 Ga0501083_0009464
1152 Ga0501083_0032395
1153 Ga0501035_0009537
1154 Ga0501044_0174414
1155 Ga0501044_0608092
1156 Ga0501045_0001105
1157 nmdc:mga05p37_19132_c1
1158 nmdc:mga05p37_56249_c1
1159 nmdc:mga09592_32597_c1
1160 nmdc:mga0qj67_6104_c1
1161 nmdc:mga06r32_473678_c1
1162 nmdc:mga06r32_571254_c1
1163 nmdc:mga06r32_7228_c1
1164 nmdc:mga08y16_493_c1
1165 nmdc:mga0n895_13975_c1
1166 nmdc:mga0n895_511440_c1
1167 nmdc:mga0n895_89825_c1
1168 nmdc:mga0rr50_100538_c1
1169 nmdc:mga0rr50_1297854_c1
1170 nmdc:mga0a205_44534_c3
1171 nmdc:mga0a205_6411_c1
1172 Ga0495601_0159394
1173 Ga0495601_0247133
1174 Ga0495595_0364801
1175 Ga0495619_0089025
1176 Ga0500566_0253153
1177 Ga0501084_0000718
1178 Ga0501082_0004632
1179 Ga0501082_0098702
1180 Ga0466962_0110085
1181 Ga0466962_0143216
1182 Ga0466962_0178183
1183 Ga0466962_0534266
1184 Ga0530510_0000732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

2

89

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9344 2 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9318 2 93
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9068 2 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8946 2 93
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7795 2 95
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8934 1 94 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8845 1 94 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8626 1 90 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8286 1 90 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.728 2 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2U9SCK0-F1-model_v4 DUF1330 domain-containing protein 0.9963 1 95
AF-A0A2S2CR32-F1-model_v4 DUF1330 domain-containing protein 0.9947 1 95
AF-A0A1A3SNH3-F1-model_v4 DUF1330 domain-containing protein 0.9931 2 95
AF-A0A1J5S512-F1-model_v4 DUF1330 domain-containing protein 0.9919 1 95
AF-A0A258TXZ2-F1-model_v4 deleted 0.9919 2 95

Map