F467135

General Info

Members Datasets Scaffolds Average Seq Length
592 304 1184 371

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10030914|Ga0207688_100309144
Length 411
Sequence MEFEYWWLLGFPLFFGLGWIAARIDIRQIVSESRALPSSYFKGLNFLLNEQPDKAIEAFIEVVKVDPETIELHFALGSLFRRRGEYDRAIRMHQNLLERPGLGADQKLIALAELGQDYLKAGILDRAEEAFRKLEKSPQAAAARRHLLEIYEQEKDWDRAIEMTKLVQPDPRDLAQYYCELAAADSAESRPDAARRHLEAALEANRKCVRASLLLGDLDKNQGNTDHAMEHWKRVESQNPAYLALVAQRLLDAYREAGHAEEGLTLLTGYLERYPSLDLLDTVFQHTLQDLELVRNLVNQHIKRLGMYRCEQCGFRARQYYWRCPGCQKWETYSPKRTETPEAWLAFGFDEDLDEAAALAIEGMLDLMEREHGLARREALALASVVVDLRVTQLVNGARGIHARLAHDALR

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
304 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 0.51
Rhizosphere 98.65
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10030914 3300025901 Bacteria 2954
2 JGI24743J22301_10001098 3300001991 Bacteria 3607
3 Ga0070658_10014546 3300005327 Bacteria 6316
4 Ga0070676_10021972 3300005328 Bacteria 3575
5 Ga0070676_10039044 3300005328 Bacteria 2744
6 Ga0070683_100011549 3300005329 Bacteria 7643
7 Ga0070690_100000475 3300005330 Bacteria 20181
8 Ga0070690_100000638 3300005330 Bacteria 17796
9 Ga0070670_100099369 3300005331 Bacteria 2504
10 Ga0070670_100260422 3300005331 Bacteria 1512
11 Ga0070677_10006583 3300005333 Bacteria 3860
12 Ga0070677_10058165 3300005333 Bacteria 1587
13 Ga0068869_100006230 3300005334 Bacteria 7553
14 Ga0068869_100133177 3300005334 Bacteria 1913
15 Ga0070666_10002615 3300005335 Bacteria 10876
16 Ga0070666_10041963 3300005335 Bacteria 3059
17 Ga0070680_100011997 3300005336 Bacteria 6723
18 Ga0070680_100025672 3300005336 Bacteria 4710
19 Ga0070680_100029248 3300005336 Bacteria 4426
20 Ga0070680_100094246 3300005336 Bacteria 2481
21 Ga0070682_100020905 3300005337 Bacteria 3857
22 Ga0068868_100021130 3300005338 Bacteria 4901
23 Ga0068868_100308976 3300005338 Bacteria 1345
24 Ga0070660_100146676 3300005339 Bacteria 1896
25 Ga0070689_100025672 3300005340 Bacteria 4429
26 Ga0070689_100114787 3300005340 Bacteria 2146
27 Ga0070691_10038813 3300005341 Bacteria 2249
28 Ga0070687_100037393 3300005343 Bacteria 2426
29 Ga0070661_100001121 3300005344 Bacteria 18811
30 Ga0070661_100010344 3300005344 Bacteria 6486
31 Ga0070661_100012343 3300005344 Bacteria 5977
32 Ga0070661_100066474 3300005344 Bacteria 2649
33 Ga0070692_10032475 3300005345 Bacteria 2625
34 Ga0070692_10035702 3300005345 Bacteria 2518
35 Ga0070692_10128192 3300005345 Bacteria 1423
36 Ga0070668_100004642 3300005347 Bacteria 10178
37 Ga0070668_100018675 3300005347 Bacteria 5206
38 Ga0070668_100047262 3300005347 Bacteria 3308
39 Ga0070668_100072784 3300005347 Bacteria 2678
40 Ga0070668_100087913 3300005347 Bacteria 2446
41 Ga0070668_100100977 3300005347 Bacteria 2286
42 Ga0070668_100129672 3300005347 Bacteria 2023
43 Ga0070668_100198815 3300005347 Bacteria 1645
44 Ga0070669_100158163 3300005353 Bacteria 1759
45 Ga0070669_100253631 3300005353 Bacteria 1401
46 Ga0070675_100021779 3300005354 Bacteria 5120
47 Ga0070675_100045882 3300005354 Bacteria 3577
48 Ga0070675_100065923 3300005354 Bacteria 2994
49 Ga0070671_100012724 3300005355 Bacteria 6781
50 Ga0070671_100028276 3300005355 Bacteria 4616
51 Ga0070671_100071917 3300005355 Bacteria 2887
52 Ga0070674_100004668 3300005356 Bacteria 7830
53 Ga0070674_100019640 3300005356 Bacteria 4296
54 Ga0070674_100148846 3300005356 Bacteria 1765
55 Ga0070673_100037197 3300005364 Bacteria 3707
56 Ga0070659_100028118 3300005366 Bacteria 4339
57 Ga0070667_100059624 3300005367 Bacteria 3229
58 Ga0070667_100097091 3300005367 Bacteria 2542
59 Ga0070667_100144073 3300005367 Bacteria 2088
60 Ga0070667_100217806 3300005367 Bacteria 1698
61 Ga0070709_10015780 3300005434 Bacteria 4301
62 Ga0070709_10068968 3300005434 Bacteria 2276
63 Ga0070714_100008570 3300005435 Bacteria 7995
64 Ga0070714_100010271 3300005435 Bacteria 7392
65 Ga0070714_100042482 3300005435 Bacteria 3841
66 Ga0070714_100100892 3300005435 Bacteria 2542
67 Ga0070714_100181218 3300005435 Bacteria 1917
68 Ga0070713_100000032 3300005436 Bacteria 86800
69 Ga0070713_100028953 3300005436 Bacteria 4378
70 Ga0070710_10020440 3300005437 Bacteria 3435
71 Ga0070701_10001045 3300005438 Bacteria 10103
72 Ga0070701_10031063 3300005438 Bacteria 2648
73 Ga0070705_100000661 3300005440 Bacteria 19713
74 Ga0070705_100004699 3300005440 Bacteria 6653
75 Ga0070705_100032266 3300005440 Bacteria 2908
76 Ga0070705_100140499 3300005440 Bacteria 1588
77 Ga0070700_100001634 3300005441 Bacteria 11206
78 Ga0070694_100014563 3300005444 Bacteria 4923
79 Ga0070694_100024587 3300005444 Bacteria 3889
80 Ga0070694_100031272 3300005444 Bacteria 3490
81 Ga0070663_100012506 3300005455 Bacteria 5372
82 Ga0070678_100000540 3300005456 Bacteria 18444
83 Ga0070681_10000685 3300005458 Bacteria 28045
84 Ga0070681_10000797 3300005458 Bacteria 26270
85 Ga0070681_10020388 3300005458 Bacteria 6644
86 Ga0070681_10065940 3300005458 Bacteria 3589
87 Ga0068867_100002134 3300005459 Bacteria 13894
88 Ga0068867_100002723 3300005459 Bacteria 12466
89 Ga0068867_100004094 3300005459 Bacteria 10251
90 Ga0068867_100051948 3300005459 Bacteria 3024
91 Ga0070685_10048485 3300005466 Bacteria 2446
92 Ga0070706_100149990 3300005467 Bacteria 2176
93 Ga0070706_100226141 3300005467 Bacteria 1746
94 Ga0070707_100082262 3300005468 Bacteria 3109
95 Ga0070707_100201138 3300005468 Bacteria 1942
96 Ga0070698_100191503 3300005471 Bacteria 1983
97 Ga0070699_100036016 3300005518 Bacteria 4279
98 Ga0070699_100081355 3300005518 Bacteria 2823
99 Ga0070699_100157066 3300005518 Bacteria 2013
100 Ga0070679_100029741 3300005530 Bacteria 5389
101 Ga0070679_100062702 3300005530 Bacteria 3706
102 Ga0070679_100067707 3300005530 Bacteria 3561
103 Ga0070679_100205549 3300005530 Bacteria 1934
104 Ga0070684_100002622 3300005535 Bacteria 13284
105 Ga0070684_100130770 3300005535 Bacteria 2264
106 Ga0070697_100008217 3300005536 Bacteria 8147
107 Ga0070697_100089350 3300005536 Bacteria 2545
108 Ga0068853_100080159 3300005539 Bacteria 2856
109 Ga0070672_100000208 3300005543 Bacteria 32511
110 Ga0070672_100007930 3300005543 Bacteria 7253
111 Ga0070672_100109891 3300005543 Bacteria 2246
112 Ga0070686_100000425 3300005544 Bacteria 26563
113 Ga0070686_100000798 3300005544 Bacteria 18204
114 Ga0070686_100112167 3300005544 Bacteria 1859
115 Ga0070695_100000377 3300005545 Bacteria 22935
116 Ga0070695_100040382 3300005545 Bacteria 2954
117 Ga0070695_100085392 3300005545 Bacteria 2096
118 Ga0070696_100000445 3300005546 Bacteria 25891
119 Ga0070696_100004260 3300005546 Bacteria 9540
120 Ga0070696_100057150 3300005546 Bacteria 2722
121 Ga0070696_100110879 3300005546 Bacteria 1976
122 Ga0070693_100000791 3300005547 Bacteria 13962
123 Ga0070693_100155769 3300005547 Bacteria 1451
124 Ga0070665_100011792 3300005548 Bacteria 8828
125 Ga0070704_100012176 3300005549 Bacteria 5308
126 Ga0070704_100026025 3300005549 Bacteria 3860
127 Ga0070704_100150357 3300005549 Bacteria 1830
128 Ga0068855_100002584 3300005563 Bacteria 22314
129 Ga0068855_100077891 3300005563 Bacteria 3847
130 Ga0068855_100130167 3300005563 Bacteria 2874
131 Ga0070664_100006606 3300005564 Bacteria 9349
132 Ga0070664_100063924 3300005564 Bacteria 3138
133 Ga0068857_100001876 3300005577 Bacteria 16915
134 Ga0068857_100024576 3300005577 Bacteria 5305
135 Ga0068854_100014599 3300005578 Bacteria 5182
136 Ga0068854_100029454 3300005578 Bacteria 3801
137 Ga0068854_100045381 3300005578 Bacteria 3125
138 Ga0068856_100002048 3300005614 Bacteria 20920
139 Ga0068856_100005386 3300005614 Bacteria 12613
140 Ga0068856_100027487 3300005614 Bacteria 5550
141 Ga0068856_100056700 3300005614 Bacteria 3867
142 Ga0068856_100083862 3300005614 Bacteria 3165
143 Ga0068856_100228217 3300005614 Bacteria 1877
144 Ga0070702_100003032 3300005615 Bacteria 7431
145 Ga0070702_100005281 3300005615 Bacteria 5997
146 Ga0068852_100011284 3300005616 Bacteria 6719
147 Ga0068852_100034856 3300005616 Bacteria 4192
148 Ga0068852_100171622 3300005616 Bacteria 2033
149 Ga0068852_100183400 3300005616 Bacteria 1970
150 Ga0068859_100004872 3300005617 Bacteria 13665
151 Ga0068859_100312595 3300005617 Bacteria 1665
152 Ga0068864_100001387 3300005618 Bacteria 20080
153 Ga0068864_100019228 3300005618 Bacteria 5709
154 Ga0068864_100039595 3300005618 Bacteria 4028
155 Ga0068864_100068042 3300005618 Bacteria 3093
156 Ga0068864_100233289 3300005618 Bacteria 1702
157 Ga0068866_10000880 3300005718 Bacteria 13251
158 Ga0068866_10001083 3300005718 Bacteria 12007
159 Ga0068861_100000406 3300005719 Bacteria 24917
160 Ga0068861_100059820 3300005719 Bacteria 2918
161 Ga0068861_100227839 3300005719 Bacteria 1579
162 Ga0068851_10015904 3300005834 Bacteria 3592
163 Ga0068851_10024302 3300005834 Bacteria 2966
164 Ga0068870_10120193 3300005840 Bacteria 1512
165 Ga0068863_100003575 3300005841 Bacteria 15335
166 Ga0068863_100211247 3300005841 Bacteria 1869
167 Ga0068858_100002859 3300005842 Bacteria 17360
168 Ga0068858_100009035 3300005842 Bacteria 9528
169 Ga0068858_100118250 3300005842 Bacteria 2478
170 Ga0068860_100006859 3300005843 Bacteria 11418
171 Ga0068860_100033982 3300005843 Bacteria 4892
172 Ga0068860_100103450 3300005843 Bacteria 2718
173 Ga0068862_100002081 3300005844 Bacteria 18045
174 Ga0068862_100021782 3300005844 Bacteria 5359
175 Ga0068862_100198209 3300005844 Bacteria 1809
176 Ga0081539_10000311 3300005985 Bacteria 108579
177 Ga0081539_10011614 3300005985 Bacteria 6936
178 Ga0070715_10015507 3300006163 Bacteria 2844
179 Ga0070716_100055714 3300006173 Bacteria 2264
180 Ga0075366_10002502 3300006195 Bacteria 9436
181 Ga0097621_100002838 3300006237 Bacteria 11883
182 Ga0097621_100010230 3300006237 Bacteria 6850
183 Ga0097621_100017762 3300006237 Bacteria 5412
184 Ga0097621_100187332 3300006237 Bacteria 1790
185 Ga0068871_100000638 3300006358 Bacteria 24082
186 Ga0068871_100248889 3300006358 Bacteria 1547
187 Ga0075428_100373062 3300006844 Bacteria 1530
188 Ga0075430_100029076 3300006846 Bacteria 4692
189 Ga0075430_100187731 3300006846 Bacteria 1718
190 Ga0075431_100130535 3300006847 Bacteria 2592
191 Ga0075431_100162982 3300006847 Bacteria 2292
192 Ga0075433_10007026 3300006852 Bacteria 8918
193 Ga0075433_10015445 3300006852 Bacteria 6262
194 Ga0075433_10283115 3300006852 Bacteria 1469
195 Ga0075434_100000017 3300006871 Bacteria 74154
196 Ga0075434_100003459 3300006871 Bacteria 14111
197 Ga0075434_100087433 3300006871 Bacteria 3117
198 Ga0075434_100119502 3300006871 Bacteria 2649
199 Ga0068865_100001425 3300006881 Bacteria 13951
200 Ga0075436_100000688 3300006914 Bacteria 22284
201 Ga0075436_100073557 3300006914 Bacteria 2366
202 Ga0075436_100117420 3300006914 Bacteria 1860
203 Ga0097620_100004872 3300006931 Bacteria 13665
204 Ga0075435_100000527 3300007076 Bacteria 23374
205 Ga0075435_100002573 3300007076 Bacteria 12099
206 Ga0075435_100012931 3300007076 Bacteria 6192
207 Ga0105240_10002531 3300009093 Bacteria 29323
208 Ga0105240_10006195 3300009093 Bacteria 17610
209 Ga0105240_10255084 3300009093 Bacteria 2026
210 Ga0105245_10000182 3300009098 Bacteria 59361
211 Ga0114129_10001456 3300009147 Bacteria 31971
212 Ga0114129_10138426 3300009147 Bacteria 3339
213 Ga0114129_10140316 3300009147 Bacteria 3313
214 Ga0114129_10293288 3300009147 Bacteria 2170
215 Ga0105243_10004540 3300009148 Bacteria 10967
216 Ga0105243_10010358 3300009148 Bacteria 7081
217 Ga0105241_10001698 3300009174 Bacteria 16738
218 Ga0105241_10051135 3300009174 Bacteria 3150
219 Ga0105242_10001174 3300009176 Bacteria 20608
220 Ga0105242_10001384 3300009176 Bacteria 19123
221 Ga0105242_10249421 3300009176 Bacteria 1599
222 Ga0105248_10004618 3300009177 Bacteria 15229
223 Ga0105248_10164888 3300009177 Bacteria 2498
224 Ga0105248_10205732 3300009177 Bacteria 2218
225 Ga0105248_10225959 3300009177 Bacteria 2107
226 Ga0105237_10063069 3300009545 Bacteria 3704
227 Ga0105237_10081960 3300009545 Bacteria 3217
228 Ga0105238_10000484 3300009551 Bacteria 41852
229 Ga0105249_10030458 3300009553 Bacteria 4877
230 Ga0105239_10169945 3300010375 Bacteria 2437
231 Ga0157373_10002280 3300013100 Bacteria 14536
232 Ga0157373_10038031 3300013100 Bacteria 3449
233 Ga0157371_10056321 3300013102 Bacteria 2789
234 Ga0157370_10028071 3300013104 Bacteria 5541
235 Ga0157370_10034092 3300013104 Bacteria 4960
236 Ga0157370_10067649 3300013104 Bacteria 3376
237 Ga0157370_10111413 3300013104 Bacteria 2558
238 Ga0157369_10008068 3300013105 Bacteria 12073
239 Ga0157369_10033728 3300013105 Bacteria 5623
240 Ga0157369_10050441 3300013105 Bacteria 4507
241 Ga0157369_10110837 3300013105 Bacteria 2917
242 Ga0157374_10271768 3300013296 Bacteria 1671
243 Ga0157374_10318180 3300013296 Bacteria 1542
244 Ga0157378_10000867 3300013297 Bacteria 27962
245 Ga0157378_10010545 3300013297 Bacteria 8075
246 Ga0157378_10034636 3300013297 Bacteria 4465
247 Ga0163162_10087144 3300013306 Bacteria 3201
248 Ga0157372_10002247 3300013307 Bacteria 20968
249 Ga0157372_10004771 3300013307 Bacteria 14401
250 Ga0157372_10023739 3300013307 Bacteria 6652
251 Ga0157372_10196015 3300013307 Bacteria 2340
252 Ga0157375_10020166 3300013308 Bacteria 6084
253 Ga0157375_10062586 3300013308 Bacteria 3698
254 Ga0163163_10245777 3300014325 Bacteria 1839
255 Ga0157380_10008415 3300014326 Bacteria 7363
256 Ga0157380_10029327 3300014326 Bacteria 4205
257 Ga0157380_10112168 3300014326 Bacteria 2294
258 Ga0157379_10079086 3300014968 Bacteria 2945
259 Ga0157379_10270698 3300014968 Bacteria 1545
260 Ga0157376_10053213 3300014969 Bacteria 3369
261 Ga0207697_10038391 3300025315 Bacteria 1963
262 Ga0207697_10064321 3300025315 Bacteria 1530
263 Ga0207682_10035244 3300025893 Bacteria 2021
264 Ga0207642_10001604 3300025899 Bacteria 6966
265 Ga0207642_10008040 3300025899 Bacteria 3596
266 Ga0207680_10004689 3300025903 Bacteria 6494
267 Ga0207680_10077308 3300025903 Bacteria 2081
268 Ga0207685_10002724 3300025905 Bacteria 4118
269 Ga0207699_10089818 3300025906 Bacteria 1926
270 Ga0207645_10015396 3300025907 Bacteria 5083
271 Ga0207643_10006861 3300025908 Bacteria 6110
272 Ga0207643_10010203 3300025908 Bacteria 5052
273 Ga0207684_10026350 3300025910 Bacteria 4957
274 Ga0207707_10004703 3300025912 Bacteria 11980
275 Ga0207707_10013171 3300025912 Bacteria 7208
276 Ga0207707_10015259 3300025912 Bacteria 6689
277 Ga0207707_10031284 3300025912 Bacteria 4657
278 Ga0207695_10008493 3300025913 Bacteria 12841
279 Ga0207695_10019709 3300025913 Bacteria 7756
280 Ga0207695_10372349 3300025913 Bacteria 1314
281 Ga0207663_10030299 3300025916 Bacteria 3190
282 Ga0207663_10218849 3300025916 Bacteria 1384
283 Ga0207660_10031839 3300025917 Bacteria 3636
284 Ga0207660_10032971 3300025917 Bacteria 3579
285 Ga0207660_10290825 3300025917 Bacteria 1299
286 Ga0207662_10000357 3300025918 Bacteria 20541
287 Ga0207662_10070736 3300025918 Bacteria 2111
288 Ga0207657_10000412 3300025919 Bacteria 45322
289 Ga0207657_10012658 3300025919 Bacteria 8314
290 Ga0207657_10179670 3300025919 Bacteria 1711
291 Ga0207649_10007747 3300025920 Bacteria 5843
292 Ga0207652_10002644 3300025921 Bacteria 15037
293 Ga0207681_10000700 3300025923 Bacteria 22001
294 Ga0207681_10021102 3300025923 Bacteria 4136
295 Ga0207681_10028876 3300025923 Bacteria 3596
296 Ga0207681_10205874 3300025923 Bacteria 1513
297 Ga0207694_10004994 3300025924 Bacteria 10264
298 Ga0207650_10017635 3300025925 Bacteria 5000
299 Ga0207650_10121706 3300025925 Bacteria 2033
300 Ga0207659_10092734 3300025926 Bacteria 2259
301 Ga0207659_10159848 3300025926 Bacteria 1768
302 Ga0207687_10003672 3300025927 Bacteria 10334
303 Ga0207687_10018986 3300025927 Bacteria 4548
304 Ga0207700_10000148 3300025928 Bacteria 41738
305 Ga0207664_10059686 3300025929 Bacteria 3039
306 Ga0207664_10222623 3300025929 Bacteria 1637
307 Ga0207644_10025103 3300025931 Bacteria 4095
308 Ga0207690_10026298 3300025932 Bacteria 3663
309 Ga0207706_10116167 3300025933 Bacteria 2353
310 Ga0207706_10166314 3300025933 Bacteria 1938
311 Ga0207686_10004273 3300025934 Bacteria 7658
312 Ga0207686_10005500 3300025934 Bacteria 6798
313 Ga0207709_10004113 3300025935 Bacteria 8477
314 Ga0207709_10006985 3300025935 Bacteria 6311
315 Ga0207709_10014849 3300025935 Bacteria 4308
316 Ga0207670_10044639 3300025936 Bacteria 2933
317 Ga0207669_10008511 3300025937 Bacteria 4821
318 Ga0207704_10039992 3300025938 Bacteria 2736
319 Ga0207665_10027171 3300025939 Bacteria 3781
320 Ga0207691_10000087 3300025940 Bacteria 78167
321 Ga0207691_10000162 3300025940 Bacteria 62729
322 Ga0207691_10052875 3300025940 Bacteria 3708
323 Ga0207691_10066508 3300025940 Bacteria 3260
324 Ga0207711_10138574 3300025941 Bacteria 2187
325 Ga0207711_10204569 3300025941 Unclassified 1802
326 Ga0207689_10000074 3300025942 Bacteria 80723
327 Ga0207689_10008477 3300025942 Bacteria 8956
328 Ga0207679_10000969 3300025945 Bacteria 18437
329 Ga0207679_10058062 3300025945 Bacteria 2865
330 Ga0207667_10002529 3300025949 Bacteria 22762
331 Ga0207667_10014440 3300025949 Bacteria 9005
332 Ga0207667_10112331 3300025949 Bacteria 2810
333 Ga0207667_10132043 3300025949 Bacteria 2572
334 Ga0207667_10428915 3300025949 Bacteria 1345
335 Ga0207651_10003513 3300025960 Bacteria 7702
336 Ga0207712_10022493 3300025961 Bacteria 4152
337 Ga0207712_10053588 3300025961 Bacteria 2830
338 Ga0207668_10010157 3300025972 Bacteria 5677
339 Ga0207668_10025255 3300025972 Bacteria 3842
340 Ga0207668_10025805 3300025972 Bacteria 3807
341 Ga0207668_10063053 3300025972 Bacteria 2613
342 Ga0207668_10093281 3300025972 Bacteria 2218
343 Ga0207668_10105672 3300025972 Bacteria 2102
344 Ga0207640_10007519 3300025981 Bacteria 6016
345 Ga0207640_10011534 3300025981 Bacteria 5006
346 Ga0207640_10041947 3300025981 Bacteria 2914
347 Ga0207658_10012710 3300025986 Bacteria 5749
348 Ga0207658_10068892 3300025986 Bacteria 2671
349 Ga0207677_10016701 3300026023 Bacteria 4356
350 Ga0207677_10028414 3300026023 Bacteria 3536
351 Ga0207703_10012545 3300026035 Bacteria 6607
352 Ga0207703_10040805 3300026035 Bacteria 3716
353 Ga0207703_10235112 3300026035 Bacteria 1645
354 Ga0207639_10030635 3300026041 Bacteria 3947
355 Ga0207639_10113044 3300026041 Bacteria 2217
356 Ga0207678_10000654 3300026067 Bacteria 31838
357 Ga0207678_10088981 3300026067 Bacteria 2639
358 Ga0207708_10001899 3300026075 Bacteria 15444
359 Ga0207702_10003864 3300026078 Bacteria 13505
360 Ga0207702_10037483 3300026078 Bacteria 4058
361 Ga0207702_10112976 3300026078 Bacteria 2418
362 Ga0207702_10198490 3300026078 Bacteria 1858
363 Ga0207641_10004243 3300026088 Bacteria 12491
364 Ga0207641_10092108 3300026088 Bacteria 2654
365 Ga0207641_10155063 3300026088 Bacteria 2077
366 Ga0207641_10340095 3300026088 Bacteria 1428
367 Ga0207648_10000059 3300026089 Bacteria 103580
368 Ga0207648_10013063 3300026089 Bacteria 7742
369 Ga0207648_10023652 3300026089 Bacteria 5501
370 Ga0207648_10029906 3300026089 Bacteria 4831
371 Ga0207648_10164187 3300026089 Bacteria 1962
372 Ga0207676_10014506 3300026095 Bacteria 5671
373 Ga0207676_10030616 3300026095 Bacteria 4041
374 Ga0207676_10064179 3300026095 Bacteria 2919
375 Ga0207676_10218873 3300026095 Bacteria 1694
376 Ga0207674_10000040 3300026116 Bacteria 130571
377 Ga0207674_10008004 3300026116 Bacteria 12264
378 Ga0207674_10040482 3300026116 Bacteria 4827
379 Ga0207675_100000261 3300026118 Bacteria 50218
380 Ga0207675_100118174 3300026118 Bacteria 2507
381 Ga0207675_100209304 3300026118 Bacteria 1875
382 Ga0207675_100298696 3300026118 Bacteria 1568
383 Ga0207683_10006302 3300026121 Bacteria 10162
384 Ga0207683_10009516 3300026121 Bacteria 8284
385 Ga0207683_10060398 3300026121 Bacteria 3332
386 Ga0207698_10003056 3300026142 Bacteria 10033
387 Ga0207698_10004483 3300026142 Bacteria 8518
388 Ga0209969_1003359 3300027360 Bacteria 2212
389 Ga0209967_1002835 3300027364 Bacteria 2262
390 Ga0209981_1000742 3300027378 Bacteria 4130
391 Ga0210000_1002561 3300027462 Bacteria 2592
392 Ga0209995_1001228 3300027471 Bacteria 3940
393 Ga0209968_1008472 3300027526 Bacteria 1567
394 Ga0209968_1012517 3300027526 Bacteria 1323
395 Ga0209999_1000589 3300027543 Bacteria 5736
396 Ga0209970_1001457 3300027614 Bacteria 4133
397 Ga0209971_1011123 3300027682 Bacteria 2132
398 Ga0209974_10015356 3300027876 Bacteria 2542
399 Ga0207428_10005987 3300027907 Bacteria 11260
400 Ga0268266_10012375 3300028379 Bacteria 7375
401 Ga0268266_10022764 3300028379 Bacteria 5334
402 Ga0268265_10000957 3300028380 Bacteria 26523
403 Ga0268264_10004082 3300028381 Bacteria 12499
404 Ga0268264_10008434 3300028381 Bacteria 8568
405 Ga0316575_10023338 3300031665 Bacteria 2391
406 Ga0316579_10000265 3300031691 Bacteria 16028
407 Ga0307410_10001786 3300031852 Bacteria 9960
408 Ga0307406_10087477 3300031901 Bacteria 2088
409 Ga0307412_10002530 3300031911 Bacteria 10161
410 Ga0307412_10077485 3300031911 Bacteria 2287
411 Ga0307412_10239015 3300031911 Bacteria 1404
412 Ga0307409_100005425 3300031995 Bacteria 7338
413 Ga0307416_100183943 3300032002 Bacteria 1962
414 Ga0307414_10028662 3300032004 Bacteria 3614
415 Ga0307411_10056356 3300032005 Bacteria 2590
416 Ga0316583_10034186 3300032133 Bacteria 1803
417 Ga0373938_0016345 3300034957 Bacteria 1449
418 Ga0373926_0000858 3300035083 Bacteria 8685
419 Ga0373934_0040632 3300035086 Bacteria 1835
420 Ga0373940_0001580 3300035088 Bacteria 4182
421 Ga0373944_0002731 3300035089 Bacteria 4507
422 Ga0373952_0002134 3300035092 Bacteria 3555
423 Ga0373923_0040657 3300035111 Bacteria 1915
424 Ga0373923_0040690 3300035111 Bacteria 1914
425 Ga0373923_0078670 3300035111 Bacteria 1427
426 Ga0373932_0002024 3300035112 Bacteria 5326
427 Ga0373936_0028442 3300035113 Bacteria 2197
428 Ga0373945_0005500 3300035116 Bacteria 4056
429 Ga0373953_0029266 3300035117 Bacteria 2129
430 Ga0373953_0085213 3300035117 Bacteria 1318
431 Ga0373954_0000072 3300035118 Bacteria 35827
432 Ga0373943_0027187 3300035170 Bacteria 2686
433 Ga0373946_0005416 3300035171 Bacteria 4601
434 Ga0373955_0013791 3300035172 Bacteria 3919
435 Ga0373942_0006170 3300035207 Bacteria 2767
436 Ga0316574_0018999 3300035398 Bacteria 4049
437 Ga0373924_0009204 3300035410 Bacteria 3615
438 Ga0373931_0001759 3300035691 Bacteria 9402
439 Ga0373935_0053964 3300035692 Bacteria 2558
440 Ga0373935_0082105 3300035692 Bacteria 2096
441 Ga0373935_0182304 3300035692 Bacteria 1442
442 Ga0373927_0011091 3300035695 Bacteria 6001
443 Ga0373927_0157249 3300035695 Bacteria 1489
444 Ga0373933_0002853 3300035724 Bacteria 9650
445 Ga0373937_0010098 3300036401 Bacteria 8232
446 Ga0373937_0012729 3300036401 Bacteria 7403
447 Ga0373937_0040246 3300036401 Bacteria 4260
448 Ga0316582_0019983 3300036647 Bacteria 3930
449 Ga0316584_0112494 3300036712 Bacteria 2037
450 Ga0373925_0035912 3300037068 Bacteria 3658
451 Ga0373925_0230261 3300037068 Bacteria 1481
452 Ga0395898_0047452 3300037466 Bacteria 4215
453 Ga0316581_0005556 3300037588 Bacteria 3297
454 Ga0395901_0038494 3300038443 Bacteria 4947
455 Ga0242420_012100 3300038996 Bacteria 1456
456 Ga0439441_001175 3300042001 Bacteria 3315
457 Ga0439441_001659 3300042001 Bacteria 2976
458 Ga0439434_0018164 3300042435 Bacteria 2103
459 Ga0439435_0001568 3300042436 Bacteria 4277
460 Ga0439444_0006070 3300042437 Bacteria 1812
461 Ga0439444_0017492 3300042437 Bacteria 1231
462 Ga0439460_0000582 3300042461 Bacteria 8010
463 Ga0451577_0068645 3300042876 Bacteria 3161
464 Ga0451577_0073946 3300042876 Bacteria 3041
465 Ga0451577_0082171 3300042876 Bacteria 2874
466 Ga0451577_0222463 3300042876 Bacteria 1706
467 Ga0453683_0032864 3300044673 Bacteria 3271
468 Ga0451576_0002462 3300045051 Bacteria 27558
469 Ga0451576_0024642 3300045051 Bacteria 6496
470 Ga0451576_0051909 3300045051 Bacteria 4298
471 Ga0451576_0091804 3300045051 Bacteria 3158
472 Ga0451576_0107541 3300045051 Bacteria 2902
473 Ga0451576_0215965 3300045051 Bacteria 2002
474 Ga0466967_0077184 3300045976 Bacteria 2998
475 Ga0495603_0024744 3300046455 Bacteria 3632
476 Ga0495580_0015470 3300046472 Bacteria 5752
477 Ga0495580_0204682 3300046472 Bacteria 1359
478 Ga0495662_0006562 3300046476 Bacteria 5808
479 Ga0495662_0009219 3300046476 Bacteria 4841
480 Ga0495608_0002667 3300046511 Bacteria 12806
481 Ga0495628_0200493 3300046516 Bacteria 1504
482 Ga0495630_0032387 3300046517 Bacteria 3895
483 Ga0495666_0004754 3300046526 Bacteria 6869
484 Ga0495666_0026138 3300046526 Bacteria 2880
485 Ga0495642_0029943 3300046528 Bacteria 2176
486 Ga0495665_0019422 3300046531 Bacteria 3655
487 Ga0495640_0013567 3300046533 Bacteria 6193
488 Ga0495586_0006401 3300046535 Bacteria 6290
489 Ga0495586_0087840 3300046535 Bacteria 1714
490 Ga0495587_0047686 3300046536 Bacteria 2539
491 Ga0495645_0040157 3300046543 Bacteria 3414
492 Ga0495667_0043553 3300046559 Bacteria 2974
493 Ga0495634_0063512 3300046642 Bacteria 2450
494 Ga0495635_0122639 3300046663 Bacteria 1772
495 Ga0495599_0014275 3300046678 Bacteria 4918
496 Ga0495647_0015993 3300046681 Bacteria 2636
497 Ga0495658_0002346 3300046683 Bacteria 9561
498 Ga0495669_0003821 3300046684 Bacteria 6187
499 Ga0495600_0008709 3300046809 Bacteria 6242
500 Ga0495604_0007218 3300047317 Bacteria 8803
501 Ga0495674_0089676 3300047319 Bacteria 2628
502 Ga0495680_0066704 3300047322 Bacteria 2753
503 Ga0495684_0078796 3300047471 Bacteria 2501
504 Ga0496112_0008942 3300048915 Bacteria 8993
505 Ga0496112_0080559 3300048915 Bacteria 3220
506 Ga0496113_0159812 3300048916 Bacteria 1781
507 Ga0501031_0023364 3300049568 Bacteria 4032
508 Ga0501032_0083715 3300049569 Bacteria 2121
509 Ga0501033_0005186 3300049570 Bacteria 10356
510 Ga0501034_0000519 3300049571 Bacteria 61966
511 Ga0501036_0021356 3300049572 Bacteria 5442
512 Ga0501038_0015914 3300049574 Bacteria 6834
513 Ga0501039_0001479 3300049575 Bacteria 17266
514 Ga0501039_0022658 3300049575 Bacteria 4820
515 Ga0501040_0000157 3300049576 Bacteria 37516
516 Ga0501040_0010683 3300049576 Bacteria 6005
517 Ga0501040_0021844 3300049576 Bacteria 4279
518 Ga0501041_0015681 3300049577 Bacteria 4501
519 Ga0501041_0015791 3300049577 Bacteria 4486
520 Ga0501041_0081435 3300049577 Bacteria 1993
521 Ga0501042_0014922 3300049578 Bacteria 5311
522 Ga0501042_0073493 3300049578 Bacteria 2446
523 Ga0501043_0018039 3300049579 Bacteria 5536
524 Ga0501046_0002929 3300049580 Bacteria 15791
525 Ga0501046_0048772 3300049580 Bacteria 3352
526 Ga0501046_0133801 3300049580 Bacteria 1879
527 Ga0501048_0001604 3300049582 Bacteria 17192
528 Ga0501048_0041592 3300049582 Bacteria 3291
529 Ga0501068_0006229 3300049584 Bacteria 6561
530 Ga0501070_0009482 3300049586 Bacteria 8229
531 Ga0501070_0159596 3300049586 Bacteria 1859
532 Ga0501071_0008643 3300049587 Bacteria 6733
533 Ga0501072_0012358 3300049588 Bacteria 6524
534 Ga0501072_0076425 3300049588 Bacteria 2649
535 Ga0501073_0015076 3300049589 Bacteria 5607
536 Ga0501074_0043154 3300049590 Bacteria 3264
537 Ga0501075_0002063 3300049591 Bacteria 13273
538 Ga0501075_0010022 3300049591 Bacteria 6648
539 Ga0501076_0000166 3300049592 Bacteria 38261
540 Ga0501076_0000657 3300049592 Bacteria 22175
541 Ga0501077_0002057 3300049593 Bacteria 12131
542 Ga0501077_0006233 3300049593 Bacteria 7291
543 Ga0501079_0000563 3300049741 Bacteria 24366
544 Ga0501080_0022433 3300049742 Bacteria 5849
545 Ga0501080_0075452 3300049742 Bacteria 3136
546 Ga0501081_0016539 3300049743 Bacteria 4876
547 Ga0501035_0094839 3300049822 Bacteria 2623
548 Ga0501044_0066560 3300049823 Bacteria 3673
549 Ga0501045_0001283 3300049824 Bacteria 16680
550 Ga0501045_0093205 3300049824 Bacteria 2228
551 nmdc:mga0k408_2174_c1 3300050493 Bacteria 10521
552 nmdc:mga05p37_151544_c1 3300050507 Bacteria 2835
553 nmdc:mga05p37_3598_c1 3300050507 Bacteria 18103
554 nmdc:mga09592_14472_c1 3300050508 Bacteria 6440
555 nmdc:mga0qj67_10859_c1 3300050509 Bacteria 6812
556 nmdc:mga0qj67_140849_c1 3300050509 Bacteria 1956
557 nmdc:mga0qj67_16312_c1 3300050509 Bacteria 5631
558 nmdc:mga0qj67_23909_c1 3300050509 Bacteria 4706
559 nmdc:mga06r32_111856_c1 3300050510 Bacteria 2687
560 nmdc:mga06r32_114301_c1 3300050510 Bacteria 2658
561 nmdc:mga06r32_126516_c1 3300050510 Bacteria 2525
562 nmdc:mga06r32_352250_c1 3300050510 Bacteria 1457
563 nmdc:mga08y16_191767_c1 3300050511 Bacteria 2120
564 nmdc:mga08y16_215162_c1 3300050511 Bacteria 1990
565 nmdc:mga08y16_24499_c1 3300050511 Bacteria 6369
566 nmdc:mga08y16_39139_c1 3300050511 Bacteria 4975
567 nmdc:mga08y16_56740_c1 3300050511 Bacteria 4093
568 nmdc:mga0n895_12472_c1 3300050512 Bacteria 7626
569 nmdc:mga0n895_151_c1 3300050512 Bacteria 42739
570 nmdc:mga0n895_3365_c1 3300050512 Bacteria 12860
571 nmdc:mga0n895_54781_c1 3300050512 Bacteria 3924
572 nmdc:mga0rr50_1962_c1 3300050513 Bacteria 11421
573 nmdc:mga0rr50_278961_c1 3300050513 Bacteria 1394
574 nmdc:mga0rr50_33694_c1 3300050513 Bacteria 3661
575 nmdc:mga08x19_12955_c1 3300050514 Bacteria 5034
576 nmdc:mga08x19_45089_c1 3300050514 Bacteria 2817
577 nmdc:mga08x19_6780_c1 3300050514 Bacteria 6801
578 nmdc:mga0a205_12973_c1 3300050515 Bacteria 7735
579 nmdc:mga0a205_218108_c1 3300050515 Bacteria 1794
580 nmdc:mga0a205_387225_c1 3300050515 Bacteria 1263
581 nmdc:mga0a205_6308_c1 3300050515 Bacteria 10706
582 nmdc:mga0a205_89292_c1 3300050515 Bacteria 2979
583 Ga0495601_0007077 3300053077 Bacteria 6572
584 Ga0495619_0077954 3300053085 Bacteria 2227
585 Ga0500636_0000055 3300053177 Bacteria 54438
586 Ga0500637_0127601 3300053178 Bacteria 1475
587 Ga0501084_0003711 3300054114 Bacteria 12401
588 Ga0590077_017893 3300059426 Bacteria 1494
589 Ga0501082_0001808 3300060353 Bacteria 18827
590 Ga0530510_0000740 3300061734 Bacteria 21175
591 Ga0530510_0004453 3300061734 Bacteria 9693
592 2526210868 2526164512 Bacteria 4025691
593 Ga0207688_10030914
594 JGI24743J22301_10001098
595 Ga0070658_10014546
596 Ga0070676_10021972
597 Ga0070676_10039044
598 Ga0070683_100011549
599 Ga0070690_100000475
600 Ga0070690_100000638
601 Ga0070670_100099369
602 Ga0070670_100260422
603 Ga0070677_10006583
604 Ga0070677_10058165
605 Ga0068869_100006230
606 Ga0068869_100133177
607 Ga0070666_10002615
608 Ga0070666_10041963
609 Ga0070680_100011997
610 Ga0070680_100025672
611 Ga0070680_100029248
612 Ga0070680_100094246
613 Ga0070682_100020905
614 Ga0068868_100021130
615 Ga0068868_100308976
616 Ga0070660_100146676
617 Ga0070689_100025672
618 Ga0070689_100114787
619 Ga0070691_10038813
620 Ga0070687_100037393
621 Ga0070661_100001121
622 Ga0070661_100010344
623 Ga0070661_100012343
624 Ga0070661_100066474
625 Ga0070692_10032475
626 Ga0070692_10035702
627 Ga0070692_10128192
628 Ga0070668_100004642
629 Ga0070668_100018675
630 Ga0070668_100047262
631 Ga0070668_100072784
632 Ga0070668_100087913
633 Ga0070668_100100977
634 Ga0070668_100129672
635 Ga0070668_100198815
636 Ga0070669_100158163
637 Ga0070669_100253631
638 Ga0070675_100021779
639 Ga0070675_100045882
640 Ga0070675_100065923
641 Ga0070671_100012724
642 Ga0070671_100028276
643 Ga0070671_100071917
644 Ga0070674_100004668
645 Ga0070674_100019640
646 Ga0070674_100148846
647 Ga0070673_100037197
648 Ga0070659_100028118
649 Ga0070667_100059624
650 Ga0070667_100097091
651 Ga0070667_100144073
652 Ga0070667_100217806
653 Ga0070709_10015780
654 Ga0070709_10068968
655 Ga0070714_100008570
656 Ga0070714_100010271
657 Ga0070714_100042482
658 Ga0070714_100100892
659 Ga0070714_100181218
660 Ga0070713_100000032
661 Ga0070713_100028953
662 Ga0070710_10020440
663 Ga0070701_10001045
664 Ga0070701_10031063
665 Ga0070705_100000661
666 Ga0070705_100004699
667 Ga0070705_100032266
668 Ga0070705_100140499
669 Ga0070700_100001634
670 Ga0070694_100014563
671 Ga0070694_100024587
672 Ga0070694_100031272
673 Ga0070663_100012506
674 Ga0070678_100000540
675 Ga0070681_10000685
676 Ga0070681_10000797
677 Ga0070681_10020388
678 Ga0070681_10065940
679 Ga0068867_100002134
680 Ga0068867_100002723
681 Ga0068867_100004094
682 Ga0068867_100051948
683 Ga0070685_10048485
684 Ga0070706_100149990
685 Ga0070706_100226141
686 Ga0070707_100082262
687 Ga0070707_100201138
688 Ga0070698_100191503
689 Ga0070699_100036016
690 Ga0070699_100081355
691 Ga0070699_100157066
692 Ga0070679_100029741
693 Ga0070679_100062702
694 Ga0070679_100067707
695 Ga0070679_100205549
696 Ga0070684_100002622
697 Ga0070684_100130770
698 Ga0070697_100008217
699 Ga0070697_100089350
700 Ga0068853_100080159
701 Ga0070672_100000208
702 Ga0070672_100007930
703 Ga0070672_100109891
704 Ga0070686_100000425
705 Ga0070686_100000798
706 Ga0070686_100112167
707 Ga0070695_100000377
708 Ga0070695_100040382
709 Ga0070695_100085392
710 Ga0070696_100000445
711 Ga0070696_100004260
712 Ga0070696_100057150
713 Ga0070696_100110879
714 Ga0070693_100000791
715 Ga0070693_100155769
716 Ga0070665_100011792
717 Ga0070704_100012176
718 Ga0070704_100026025
719 Ga0070704_100150357
720 Ga0068855_100002584
721 Ga0068855_100077891
722 Ga0068855_100130167
723 Ga0070664_100006606
724 Ga0070664_100063924
725 Ga0068857_100001876
726 Ga0068857_100024576
727 Ga0068854_100014599
728 Ga0068854_100029454
729 Ga0068854_100045381
730 Ga0068856_100002048
731 Ga0068856_100005386
732 Ga0068856_100027487
733 Ga0068856_100056700
734 Ga0068856_100083862
735 Ga0068856_100228217
736 Ga0070702_100003032
737 Ga0070702_100005281
738 Ga0068852_100011284
739 Ga0068852_100034856
740 Ga0068852_100171622
741 Ga0068852_100183400
742 Ga0068859_100004872
743 Ga0068859_100312595
744 Ga0068864_100001387
745 Ga0068864_100019228
746 Ga0068864_100039595
747 Ga0068864_100068042
748 Ga0068864_100233289
749 Ga0068866_10000880
750 Ga0068866_10001083
751 Ga0068861_100000406
752 Ga0068861_100059820
753 Ga0068861_100227839
754 Ga0068851_10015904
755 Ga0068851_10024302
756 Ga0068870_10120193
757 Ga0068863_100003575
758 Ga0068863_100211247
759 Ga0068858_100002859
760 Ga0068858_100009035
761 Ga0068858_100118250
762 Ga0068860_100006859
763 Ga0068860_100033982
764 Ga0068860_100103450
765 Ga0068862_100002081
766 Ga0068862_100021782
767 Ga0068862_100198209
768 Ga0081539_10000311
769 Ga0081539_10011614
770 Ga0070715_10015507
771 Ga0070716_100055714
772 Ga0075366_10002502
773 Ga0097621_100002838
774 Ga0097621_100010230
775 Ga0097621_100017762
776 Ga0097621_100187332
777 Ga0068871_100000638
778 Ga0068871_100248889
779 Ga0075428_100373062
780 Ga0075430_100029076
781 Ga0075430_100187731
782 Ga0075431_100130535
783 Ga0075431_100162982
784 Ga0075433_10007026
785 Ga0075433_10015445
786 Ga0075433_10283115
787 Ga0075434_100000017
788 Ga0075434_100003459
789 Ga0075434_100087433
790 Ga0075434_100119502
791 Ga0068865_100001425
792 Ga0075436_100000688
793 Ga0075436_100073557
794 Ga0075436_100117420
795 Ga0097620_100004872
796 Ga0075435_100000527
797 Ga0075435_100002573
798 Ga0075435_100012931
799 Ga0105240_10002531
800 Ga0105240_10006195
801 Ga0105240_10255084
802 Ga0105245_10000182
803 Ga0114129_10001456
804 Ga0114129_10138426
805 Ga0114129_10140316
806 Ga0114129_10293288
807 Ga0105243_10004540
808 Ga0105243_10010358
809 Ga0105241_10001698
810 Ga0105241_10051135
811 Ga0105242_10001174
812 Ga0105242_10001384
813 Ga0105242_10249421
814 Ga0105248_10004618
815 Ga0105248_10164888
816 Ga0105248_10205732
817 Ga0105248_10225959
818 Ga0105237_10063069
819 Ga0105237_10081960
820 Ga0105238_10000484
821 Ga0105249_10030458
822 Ga0105239_10169945
823 Ga0157373_10002280
824 Ga0157373_10038031
825 Ga0157371_10056321
826 Ga0157370_10028071
827 Ga0157370_10034092
828 Ga0157370_10067649
829 Ga0157370_10111413
830 Ga0157369_10008068
831 Ga0157369_10033728
832 Ga0157369_10050441
833 Ga0157369_10110837
834 Ga0157374_10271768
835 Ga0157374_10318180
836 Ga0157378_10000867
837 Ga0157378_10010545
838 Ga0157378_10034636
839 Ga0163162_10087144
840 Ga0157372_10002247
841 Ga0157372_10004771
842 Ga0157372_10023739
843 Ga0157372_10196015
844 Ga0157375_10020166
845 Ga0157375_10062586
846 Ga0163163_10245777
847 Ga0157380_10008415
848 Ga0157380_10029327
849 Ga0157380_10112168
850 Ga0157379_10079086
851 Ga0157379_10270698
852 Ga0157376_10053213
853 Ga0207697_10038391
854 Ga0207697_10064321
855 Ga0207682_10035244
856 Ga0207642_10001604
857 Ga0207642_10008040
858 Ga0207680_10004689
859 Ga0207680_10077308
860 Ga0207685_10002724
861 Ga0207699_10089818
862 Ga0207645_10015396
863 Ga0207643_10006861
864 Ga0207643_10010203
865 Ga0207684_10026350
866 Ga0207707_10004703
867 Ga0207707_10013171
868 Ga0207707_10015259
869 Ga0207707_10031284
870 Ga0207695_10008493
871 Ga0207695_10019709
872 Ga0207695_10372349
873 Ga0207663_10030299
874 Ga0207663_10218849
875 Ga0207660_10031839
876 Ga0207660_10032971
877 Ga0207660_10290825
878 Ga0207662_10000357
879 Ga0207662_10070736
880 Ga0207657_10000412
881 Ga0207657_10012658
882 Ga0207657_10179670
883 Ga0207649_10007747
884 Ga0207652_10002644
885 Ga0207681_10000700
886 Ga0207681_10021102
887 Ga0207681_10028876
888 Ga0207681_10205874
889 Ga0207694_10004994
890 Ga0207650_10017635
891 Ga0207650_10121706
892 Ga0207659_10092734
893 Ga0207659_10159848
894 Ga0207687_10003672
895 Ga0207687_10018986
896 Ga0207700_10000148
897 Ga0207664_10059686
898 Ga0207664_10222623
899 Ga0207644_10025103
900 Ga0207690_10026298
901 Ga0207706_10116167
902 Ga0207706_10166314
903 Ga0207686_10004273
904 Ga0207686_10005500
905 Ga0207709_10004113
906 Ga0207709_10006985
907 Ga0207709_10014849
908 Ga0207670_10044639
909 Ga0207669_10008511
910 Ga0207704_10039992
911 Ga0207665_10027171
912 Ga0207691_10000087
913 Ga0207691_10000162
914 Ga0207691_10052875
915 Ga0207691_10066508
916 Ga0207711_10138574
917 Ga0207711_10204569
918 Ga0207689_10000074
919 Ga0207689_10008477
920 Ga0207679_10000969
921 Ga0207679_10058062
922 Ga0207667_10002529
923 Ga0207667_10014440
924 Ga0207667_10112331
925 Ga0207667_10132043
926 Ga0207667_10428915
927 Ga0207651_10003513
928 Ga0207712_10022493
929 Ga0207712_10053588
930 Ga0207668_10010157
931 Ga0207668_10025255
932 Ga0207668_10025805
933 Ga0207668_10063053
934 Ga0207668_10093281
935 Ga0207668_10105672
936 Ga0207640_10007519
937 Ga0207640_10011534
938 Ga0207640_10041947
939 Ga0207658_10012710
940 Ga0207658_10068892
941 Ga0207677_10016701
942 Ga0207677_10028414
943 Ga0207703_10012545
944 Ga0207703_10040805
945 Ga0207703_10235112
946 Ga0207639_10030635
947 Ga0207639_10113044
948 Ga0207678_10000654
949 Ga0207678_10088981
950 Ga0207708_10001899
951 Ga0207702_10003864
952 Ga0207702_10037483
953 Ga0207702_10112976
954 Ga0207702_10198490
955 Ga0207641_10004243
956 Ga0207641_10092108
957 Ga0207641_10155063
958 Ga0207641_10340095
959 Ga0207648_10000059
960 Ga0207648_10013063
961 Ga0207648_10023652
962 Ga0207648_10029906
963 Ga0207648_10164187
964 Ga0207676_10014506
965 Ga0207676_10030616
966 Ga0207676_10064179
967 Ga0207676_10218873
968 Ga0207674_10000040
969 Ga0207674_10008004
970 Ga0207674_10040482
971 Ga0207675_100000261
972 Ga0207675_100118174
973 Ga0207675_100209304
974 Ga0207675_100298696
975 Ga0207683_10006302
976 Ga0207683_10009516
977 Ga0207683_10060398
978 Ga0207698_10003056
979 Ga0207698_10004483
980 Ga0209969_1003359
981 Ga0209967_1002835
982 Ga0209981_1000742
983 Ga0210000_1002561
984 Ga0209995_1001228
985 Ga0209968_1008472
986 Ga0209968_1012517
987 Ga0209999_1000589
988 Ga0209970_1001457
989 Ga0209971_1011123
990 Ga0209974_10015356
991 Ga0207428_10005987
992 Ga0268266_10012375
993 Ga0268266_10022764
994 Ga0268265_10000957
995 Ga0268264_10004082
996 Ga0268264_10008434
997 Ga0316575_10023338
998 Ga0316579_10000265
999 Ga0307410_10001786
1000 Ga0307406_10087477
1001 Ga0307412_10002530
1002 Ga0307412_10077485
1003 Ga0307412_10239015
1004 Ga0307409_100005425
1005 Ga0307416_100183943
1006 Ga0307414_10028662
1007 Ga0307411_10056356
1008 Ga0316583_10034186
1009 Ga0373938_0016345
1010 Ga0373926_0000858
1011 Ga0373934_0040632
1012 Ga0373940_0001580
1013 Ga0373944_0002731
1014 Ga0373952_0002134
1015 Ga0373923_0040657
1016 Ga0373923_0040690
1017 Ga0373923_0078670
1018 Ga0373932_0002024
1019 Ga0373936_0028442
1020 Ga0373945_0005500
1021 Ga0373953_0029266
1022 Ga0373953_0085213
1023 Ga0373954_0000072
1024 Ga0373943_0027187
1025 Ga0373946_0005416
1026 Ga0373955_0013791
1027 Ga0373942_0006170
1028 Ga0316574_0018999
1029 Ga0373924_0009204
1030 Ga0373931_0001759
1031 Ga0373935_0053964
1032 Ga0373935_0082105
1033 Ga0373935_0182304
1034 Ga0373927_0011091
1035 Ga0373927_0157249
1036 Ga0373933_0002853
1037 Ga0373937_0010098
1038 Ga0373937_0012729
1039 Ga0373937_0040246
1040 Ga0316582_0019983
1041 Ga0316584_0112494
1042 Ga0373925_0035912
1043 Ga0373925_0230261
1044 Ga0395898_0047452
1045 Ga0316581_0005556
1046 Ga0395901_0038494
1047 Ga0242420_012100
1048 Ga0439441_001175
1049 Ga0439441_001659
1050 Ga0439434_0018164
1051 Ga0439435_0001568
1052 Ga0439444_0006070
1053 Ga0439444_0017492
1054 Ga0439460_0000582
1055 Ga0451577_0068645
1056 Ga0451577_0073946
1057 Ga0451577_0082171
1058 Ga0451577_0222463
1059 Ga0453683_0032864
1060 Ga0451576_0002462
1061 Ga0451576_0024642
1062 Ga0451576_0051909
1063 Ga0451576_0091804
1064 Ga0451576_0107541
1065 Ga0451576_0215965
1066 Ga0466967_0077184
1067 Ga0495603_0024744
1068 Ga0495580_0015470
1069 Ga0495580_0204682
1070 Ga0495662_0006562
1071 Ga0495662_0009219
1072 Ga0495608_0002667
1073 Ga0495628_0200493
1074 Ga0495630_0032387
1075 Ga0495666_0004754
1076 Ga0495666_0026138
1077 Ga0495642_0029943
1078 Ga0495665_0019422
1079 Ga0495640_0013567
1080 Ga0495586_0006401
1081 Ga0495586_0087840
1082 Ga0495587_0047686
1083 Ga0495645_0040157
1084 Ga0495667_0043553
1085 Ga0495634_0063512
1086 Ga0495635_0122639
1087 Ga0495599_0014275
1088 Ga0495647_0015993
1089 Ga0495658_0002346
1090 Ga0495669_0003821
1091 Ga0495600_0008709
1092 Ga0495604_0007218
1093 Ga0495674_0089676
1094 Ga0495680_0066704
1095 Ga0495684_0078796
1096 Ga0496112_0008942
1097 Ga0496112_0080559
1098 Ga0496113_0159812
1099 Ga0501031_0023364
1100 Ga0501032_0083715
1101 Ga0501033_0005186
1102 Ga0501034_0000519
1103 Ga0501036_0021356
1104 Ga0501038_0015914
1105 Ga0501039_0001479
1106 Ga0501039_0022658
1107 Ga0501040_0000157
1108 Ga0501040_0010683
1109 Ga0501040_0021844
1110 Ga0501041_0015681
1111 Ga0501041_0015791
1112 Ga0501041_0081435
1113 Ga0501042_0014922
1114 Ga0501042_0073493
1115 Ga0501043_0018039
1116 Ga0501046_0002929
1117 Ga0501046_0048772
1118 Ga0501046_0133801
1119 Ga0501048_0001604
1120 Ga0501048_0041592
1121 Ga0501068_0006229
1122 Ga0501070_0009482
1123 Ga0501070_0159596
1124 Ga0501071_0008643
1125 Ga0501072_0012358
1126 Ga0501072_0076425
1127 Ga0501073_0015076
1128 Ga0501074_0043154
1129 Ga0501075_0002063
1130 Ga0501075_0010022
1131 Ga0501076_0000166
1132 Ga0501076_0000657
1133 Ga0501077_0002057
1134 Ga0501077_0006233
1135 Ga0501079_0000563
1136 Ga0501080_0022433
1137 Ga0501080_0075452
1138 Ga0501081_0016539
1139 Ga0501035_0094839
1140 Ga0501044_0066560
1141 Ga0501045_0001283
1142 Ga0501045_0093205
1143 nmdc:mga0k408_2174_c1
1144 nmdc:mga05p37_151544_c1
1145 nmdc:mga05p37_3598_c1
1146 nmdc:mga09592_14472_c1
1147 nmdc:mga0qj67_10859_c1
1148 nmdc:mga0qj67_140849_c1
1149 nmdc:mga0qj67_16312_c1
1150 nmdc:mga0qj67_23909_c1
1151 nmdc:mga06r32_111856_c1
1152 nmdc:mga06r32_114301_c1
1153 nmdc:mga06r32_126516_c1
1154 nmdc:mga06r32_352250_c1
1155 nmdc:mga08y16_191767_c1
1156 nmdc:mga08y16_215162_c1
1157 nmdc:mga08y16_24499_c1
1158 nmdc:mga08y16_39139_c1
1159 nmdc:mga08y16_56740_c1
1160 nmdc:mga0n895_12472_c1
1161 nmdc:mga0n895_151_c1
1162 nmdc:mga0n895_3365_c1
1163 nmdc:mga0n895_54781_c1
1164 nmdc:mga0rr50_1962_c1
1165 nmdc:mga0rr50_278961_c1
1166 nmdc:mga0rr50_33694_c1
1167 nmdc:mga08x19_12955_c1
1168 nmdc:mga08x19_45089_c1
1169 nmdc:mga08x19_6780_c1
1170 nmdc:mga0a205_12973_c1
1171 nmdc:mga0a205_218108_c1
1172 nmdc:mga0a205_387225_c1
1173 nmdc:mga0a205_6308_c1
1174 nmdc:mga0a205_89292_c1
1175 Ga0495601_0007077
1176 Ga0495619_0077954
1177 Ga0500636_0000055
1178 Ga0500637_0127601
1179 Ga0501084_0003711
1180 Ga0590077_017893
1181 Ga0501082_0001808
1182 Ga0530510_0000740
1183 Ga0530510_0004453
1184 2526210868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18073

Rubredoxin_2

Rubredoxin metal binding domain

308

335

0.96

PF13432

TPR_16

Tetratricopeptide repeat

42

98

0.92

PF13176

TPR_7

Tetratricopeptide repeat

72

102

0.91

PF13432

TPR_16

Tetratricopeptide repeat

112

173

0.89

PF13432

TPR_16

Tetratricopeptide repeat

179

242

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzb-assembly1.cif.gz_A lipopolysaccharide assembly protein lapb (open) 0.9024 138 384
7wzb-assembly1.cif.gz_B lipopolysaccharide assembly protein lapb (open) 0.8987 136 385
4zlh-assembly1.cif.gz_A structure of the lapb cytoplasmic domain at 2 angstroms 0.8919 70 385
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8899 182 246
7wzb-assembly1.cif.gz_A lipopolysaccharide assembly protein lapb (open) 0.8824 138 384
ID Description Score Start End Superfamily
af_Q9CB03_549_635_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9605 181 246 1.25.40.10
af_Q8IUR5_613_682_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9384 181 245 1.25.40.10
af_Q8W591_237_353_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9229 69 173 1.25.40.10
af_A0A1D6MTC7_43_119_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9104 177 246 1.25.40.10
af_O22266_197_331_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9097 69 173 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1B8P1A4-F1-model_v4 Tetratricopeptide repeat protein 0.7888 8 315
AF-A0A662MEI0-F1-model_v4 Tetratricopeptide repeat protein 0.7773 176 339 GO:0016020
AF-A0A6P1B326-F1-model_v4 deleted 0.7619 32 148
AF-A0A3B8X1A9-F1-model_v4 LapB rubredoxin metal binding domain-containing protein 0.7612 9 381 GO:0046872
AF-A0A1B8P1A4-F1-model_v4 Tetratricopeptide repeat protein 0.7476 8 315

Map