F467112

General Info

Members Datasets Scaffolds Average Seq Length
592 356 1184 220

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100617641|Ga0070714_1006176411
Length 226
Sequence MSIRVLVADDQEIVRTGLTMLLNAQPGIEVVGEAADGEAAVELARRLRPDVCLFDIRMPGTDGIEATRRLAGPGVEDPLAVVVITTFDLDEYVYAALRAGARGFLLKNAGTQLLAQAVHAAATGDALIAPSVTARLLDAFAGAGSTAPSQPVEPRTDREEQVLLSVARGRTNREITEELYITLSTVKTHIASLMAKLGARNRVEIAIWAHETRRVRNAAPPPRRKY

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
187 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
195 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
196 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
197 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
198 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2517572101 Frankia sp. DC12 Isolate Nodule
288 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
289 2643221615 Nocardioides sp. Root224 Isolate Unclassified
290 2643221617 Nocardioides sp. Root79 Isolate Unclassified
291 2643221620 Nocardioides sp. Root240 Isolate Unclassified
292 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
293 2643221649 Leifsonia sp. Root4 Isolate Unclassified
294 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
295 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
296 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
297 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
298 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
299 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
300 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
301 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
302 2739367898 Nocardioides sp. CF479 Isolate Unclassified
303 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
304 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
305 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
306 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
307 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
308 2808606394 Promicromonospora sp. C35 Isolate Unclassified
309 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
310 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
311 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
312 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
313 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
314 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
315 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
316 2858882152 Micromonospora noduli MED15 Isolate Nodule
317 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
318 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
319 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
320 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
321 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
322 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
323 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
324 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
325 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
326 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
327 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
328 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
329 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
330 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
331 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
332 2891562705 Microbispora tritici MT50 Isolate Unclassified
333 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
334 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
335 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
336 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
337 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
338 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
339 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
340 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
341 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
342 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
343 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
344 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
345 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
346 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
347 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
348 8002775197 Frankia nepalensis CN7 Isolate Nodule
349 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
350 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
351 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
352 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
353 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
354 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
355 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
356 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.84
Metatranscriptomes 0.17
Isolates 11.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 1.35
Rhizoplane 7.26
Rhizosphere 72.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100617641 3300005435 Bacteria 1042
2 JGI25406J46586_10047596 3300003203 Bacteria 1460
3 JGI25406J46586_10055663 3300003203 Bacteria 1302
4 JGI25407J50210_10003560 3300003373 Bacteria 3740
5 JGI25407J50210_10022718 3300003373 Bacteria 1630
6 Ga0006562J51391_1110228 3300003578 Bacteria 3091
7 Ga0070683_100312809 3300005329 Bacteria 1494
8 Ga0070670_100097723 3300005331 Bacteria 2526
9 Ga0068869_100001156 3300005334 Bacteria 15435
10 Ga0068869_100082288 3300005334 Bacteria 2406
11 Ga0068869_100707126 3300005334 Bacteria 860
12 Ga0070680_100183772 3300005336 Bacteria 1761
13 Ga0070682_100066676 3300005337 Bacteria 2291
14 Ga0068868_100133490 3300005338 Bacteria 2033
15 Ga0070660_100033733 3300005339 Bacteria 3861
16 Ga0070692_10067282 3300005345 Bacteria 1901
17 Ga0070675_100012801 3300005354 Bacteria 6582
18 Ga0070674_100062075 3300005356 Bacteria 2610
19 Ga0070674_100531347 3300005356 Bacteria 984
20 Ga0070673_100752075 3300005364 Bacteria 898
21 Ga0070667_100029833 3300005367 Bacteria 4547
22 Ga0070667_100308844 3300005367 Bacteria 1425
23 Ga0070667_100759218 3300005367 Bacteria 899
24 Ga0070709_10070199 3300005434 Bacteria 2257
25 Ga0070709_10070448 3300005434 Bacteria 2254
26 Ga0070714_100002301 3300005435 Bacteria 14052
27 Ga0070713_100220240 3300005436 Bacteria 1721
28 Ga0070700_100006245 3300005441 Bacteria 6356
29 Ga0070663_100003994 3300005455 Bacteria 8607
30 Ga0070678_100595158 3300005456 Bacteria 987
31 Ga0070681_10443197 3300005458 Bacteria 1210
32 Ga0070681_10666889 3300005458 Bacteria 955
33 Ga0070685_10480873 3300005466 Bacteria 875
34 Ga0070706_100047806 3300005467 Bacteria 3949
35 Ga0070684_100018403 3300005535 Bacteria 5755
36 Ga0070684_100330475 3300005535 Bacteria 1401
37 Ga0068853_100321026 3300005539 Bacteria 1435
38 Ga0070672_100051484 3300005543 Bacteria 3212
39 Ga0070696_100344967 3300005546 Bacteria 1152
40 Ga0070665_100810990 3300005548 Bacteria 949
41 Ga0070664_100001380 3300005564 Bacteria 19347
42 Ga0068857_100025628 3300005577 Bacteria 5192
43 Ga0068857_100748860 3300005577 Bacteria 930
44 Ga0068854_100861332 3300005578 Bacteria 794
45 Ga0068856_100106465 3300005614 Bacteria 2799
46 Ga0068856_100262001 3300005614 Bacteria 1744
47 Ga0070702_100252580 3300005615 Bacteria 1196
48 Ga0068852_100070874 3300005616 Bacteria 3059
49 Ga0068852_100183537 3300005616 Bacteria 1969
50 Ga0068859_100002869 3300005617 Bacteria 17490
51 Ga0068859_101598401 3300005617 Bacteria 720
52 Ga0068870_10290643 3300005840 Bacteria 1028
53 Ga0068863_100002045 3300005841 Bacteria 20009
54 Ga0068858_100000054 3300005842 Bacteria 119686
55 Ga0068858_100006122 3300005842 Bacteria 11734
56 Ga0068860_100083929 3300005843 Bacteria 3030
57 Ga0068862_100000100 3300005844 Bacteria 103461
58 Ga0068862_100210024 3300005844 Bacteria 1759
59 Ga0081455_10017154 3300005937 Bacteria 6954
60 Ga0081455_10037817 3300005937 Bacteria 4279
61 Ga0081455_10041629 3300005937 Bacteria 4038
62 Ga0081455_10057429 3300005937 Bacteria 3298
63 Ga0081455_10095918 3300005937 Bacteria 2393
64 Ga0081455_10139190 3300005937 Bacteria 1887
65 Ga0081538_10000735 3300005981 Bacteria 35797
66 Ga0081538_10001786 3300005981 Bacteria 21706
67 Ga0081538_10004278 3300005981 Bacteria 13212
68 Ga0081538_10006368 3300005981 Bacteria 10413
69 Ga0081540_1030769 3300005983 Bacteria 2966
70 Ga0081539_10000485 3300005985 Bacteria 84010
71 Ga0081539_10000645 3300005985 Bacteria 70301
72 Ga0081539_10005373 3300005985 Bacteria 13117
73 Ga0081539_10010997 3300005985 Bacteria 7246
74 Ga0081539_10030149 3300005985 Bacteria 3373
75 Ga0070717_10022646 3300006028 Bacteria 4968
76 Ga0070717_10187253 3300006028 Bacteria 1807
77 Ga0075365_10002398 3300006038 Bacteria 9174
78 Ga0075365_10140517 3300006038 Bacteria 1676
79 Ga0075365_10172179 3300006038 Bacteria 1511
80 Ga0075368_10058087 3300006042 Bacteria 1545
81 Ga0075368_10068348 3300006042 Bacteria 1432
82 Ga0075363_100020647 3300006048 Bacteria 3306
83 Ga0075363_100376107 3300006048 Bacteria 832
84 Ga0075364_10003577 3300006051 Bacteria 8849
85 Ga0070715_10001333 3300006163 Bacteria 7109
86 Ga0070716_100018402 3300006173 Bacteria 3639
87 Ga0075367_10033442 3300006178 Bacteria 2963
88 Ga0075367_10040653 3300006178 Bacteria 2715
89 Ga0068871_100175146 3300006358 Bacteria 1841
90 Ga0075430_100061522 3300006846 Bacteria 3155
91 Ga0075430_100204794 3300006846 Bacteria 1638
92 Ga0075431_100053875 3300006847 Bacteria 4148
93 Ga0075431_100343268 3300006847 Bacteria 1502
94 Ga0075433_10028255 3300006852 Bacteria 4767
95 Ga0075429_100080013 3300006880 Bacteria 2848
96 Ga0075429_100175396 3300006880 Bacteria 1878
97 Ga0075429_100182323 3300006880 Bacteria 1840
98 Ga0068865_100165867 3300006881 Bacteria 1689
99 Ga0075436_100093153 3300006914 Bacteria 2095
100 Ga0097620_100000173 3300006931 Bacteria 62829
101 Ga0097620_100002869 3300006931 Bacteria 17490
102 Ga0075435_100015013 3300007076 Bacteria 5811
103 Ga0111539_10012775 3300009094 Bacteria 10508
104 Ga0105245_10003477 3300009098 Bacteria 14105
105 Ga0105245_10178127 3300009098 Bacteria 2029
106 Ga0105245_10237446 3300009098 Bacteria 1765
107 Ga0105247_10005853 3300009101 Bacteria 7683
108 Ga0105247_10017471 3300009101 Bacteria 4305
109 Ga0114129_10021291 3300009147 Bacteria 9205
110 Ga0114129_10033591 3300009147 Bacteria 7249
111 Ga0114129_10082660 3300009147 Bacteria 4462
112 Ga0114129_10389083 3300009147 Bacteria 1840
113 Ga0105243_10069854 3300009148 Bacteria 2834
114 Ga0105243_10391228 3300009148 Bacteria 1289
115 Ga0105243_10788055 3300009148 Bacteria 935
116 Ga0105242_10131265 3300009176 Bacteria 2163
117 Ga0105248_10037731 3300009177 Bacteria 5406
118 Ga0105238_10349106 3300009551 Bacteria 1468
119 Ga0105249_10379773 3300009553 Bacteria 1439
120 Ga0105249_10770480 3300009553 Bacteria 1025
121 Ga0105239_11154699 3300010375 Bacteria 892
122 Ga0105239_11562437 3300010375 Bacteria 763
123 Ga0105246_10269202 3300011119 Bacteria 1361
124 Ga0157322_1008034 3300012490 Bacteria 797
125 Ga0157370_10075270 3300013104 Bacteria 3183
126 Ga0157369_10262518 3300013105 Bacteria 1801
127 Ga0157372_10401738 3300013307 Bacteria 1597
128 Ga0157375_10011302 3300013308 Bacteria 7883
129 Ga0157375_10545956 3300013308 Bacteria 1321
130 Ga0163163_10000978 3300014325 Bacteria 24248
131 Ga0163163_10004451 3300014325 Bacteria 11951
132 Ga0163163_10040247 3300014325 Bacteria 4564
133 Ga0163163_10721437 3300014325 Bacteria 1060
134 Ga0157380_10018202 3300014326 Bacteria 5213
135 Ga0157380_10379477 3300014326 Bacteria 1333
136 Ga0157380_11091709 3300014326 Bacteria 836
137 Ga0157377_10011534 3300014745 Bacteria 4414
138 Ga0157379_10000122 3300014968 Bacteria 54098
139 Ga0157379_10000723 3300014968 Bacteria 26732
140 Ga0157376_10214591 3300014969 Bacteria 1779
141 Ga0183367_1014 3300015688 Bacteria 330534
142 Ga0163161_10348049 3300017792 Bacteria 1177
143 Ga0207692_10003712 3300025898 Bacteria 5993
144 Ga0207710_10001134 3300025900 Bacteria 13589
145 Ga0207710_10049783 3300025900 Bacteria 1878
146 Ga0207688_10095587 3300025901 Bacteria 1710
147 Ga0207685_10000504 3300025905 Bacteria 6650
148 Ga0207699_10005305 3300025906 Bacteria 6173
149 Ga0207645_10401493 3300025907 Bacteria 922
150 Ga0207684_10011773 3300025910 Bacteria 7631
151 Ga0207654_10523088 3300025911 Bacteria 840
152 Ga0207693_10009533 3300025915 Bacteria 7908
153 Ga0207663_10004876 3300025916 Bacteria 6717
154 Ga0207681_10662189 3300025923 Bacteria 866
155 Ga0207694_10378677 3300025924 Bacteria 1174
156 Ga0207650_10291950 3300025925 Bacteria 1330
157 Ga0207650_10322426 3300025925 Bacteria 1266
158 Ga0207659_10002456 3300025926 Bacteria 11051
159 Ga0207687_10168735 3300025927 Bacteria 1686
160 Ga0207687_10192013 3300025927 Bacteria 1590
161 Ga0207700_10001963 3300025928 Bacteria 11706
162 Ga0207700_10077321 3300025928 Bacteria 2585
163 Ga0207700_10334632 3300025928 Bacteria 1315
164 Ga0207700_10760634 3300025928 Bacteria 866
165 Ga0207664_10006464 3300025929 Bacteria 8066
166 Ga0207664_10011910 3300025929 Bacteria 6206
167 Ga0207706_10007244 3300025933 Bacteria 10256
168 Ga0207686_10092431 3300025934 Bacteria 2000
169 Ga0207709_10437655 3300025935 Bacteria 1008
170 Ga0207709_10810102 3300025935 Bacteria 756
171 Ga0207669_10211402 3300025937 Bacteria 1416
172 Ga0207669_10311636 3300025937 Bacteria 1201
173 Ga0207704_10126639 3300025938 Bacteria 1760
174 Ga0207665_10001384 3300025939 Bacteria 16335
175 Ga0207691_10462261 3300025940 Bacteria 1079
176 Ga0207711_10001649 3300025941 Bacteria 20592
177 Ga0207689_10003080 3300025942 Bacteria 15346
178 Ga0207689_10096022 3300025942 Bacteria 2435
179 Ga0207661_10331440 3300025944 Bacteria 1370
180 Ga0207679_10020374 3300025945 Bacteria 4475
181 Ga0207679_10396460 3300025945 Bacteria 1213
182 Ga0207651_10441574 3300025960 Bacteria 1115
183 Ga0207712_10205253 3300025961 Bacteria 1566
184 Ga0207712_10331249 3300025961 Bacteria 1259
185 Ga0207668_10002695 3300025972 Bacteria 10388
186 Ga0207668_10504107 3300025972 Bacteria 1042
187 Ga0207658_10015398 3300025986 Bacteria 5246
188 Ga0207658_10678449 3300025986 Bacteria 930
189 Ga0207677_10098996 3300026023 Bacteria 2140
190 Ga0207677_10686186 3300026023 Bacteria 907
191 Ga0207703_10000002 3300026035 Bacteria 600711
192 Ga0207703_10005622 3300026035 Bacteria 10064
193 Ga0207639_10140514 3300026041 Bacteria 2011
194 Ga0207678_10005365 3300026067 Bacteria 11482
195 Ga0207708_10013558 3300026075 Bacteria 6093
196 Ga0207708_10251758 3300026075 Bacteria 1423
197 Ga0207708_10722643 3300026075 Bacteria 853
198 Ga0207702_10047302 3300026078 Bacteria 3625
199 Ga0207641_10001322 3300026088 Bacteria 24533
200 Ga0207648_10161613 3300026089 Bacteria 1978
201 Ga0207648_10757693 3300026089 Bacteria 902
202 Ga0207674_10032025 3300026116 Bacteria 5517
203 Ga0207675_100083393 3300026118 Bacteria 2998
204 Ga0207675_100141972 3300026118 Bacteria 2282
205 Ga0207675_100147025 3300026118 Bacteria 2241
206 Ga0207675_100772879 3300026118 Bacteria 973
207 Ga0207683_10184664 3300026121 Bacteria 1891
208 Ga0207683_10303354 3300026121 Bacteria 1461
209 Ga0207698_10352704 3300026142 Bacteria 1390
210 Ga0207428_10077458 3300027907 Bacteria 2603
211 Ga0207428_10120697 3300027907 Bacteria 2010
212 Ga0268266_10587365 3300028379 Bacteria 1069
213 Ga0268265_10000110 3300028380 Bacteria 103447
214 Ga0268265_10220399 3300028380 Bacteria 1659
215 Ga0265334_10003108 3300028573 Bacteria 7575
216 Ga0307515_10006585 3300028794 Bacteria 23187
217 Ga0307515_10025112 3300028794 Bacteria 10332
218 Ga0307515_10078865 3300028794 Bacteria 4323
219 Ga0307515_10085424 3300028794 Bacteria 4038
220 Ga0307512_10008947 3300030522 Bacteria 9707
221 Ga0307512_10017080 3300030522 Bacteria 6675
222 Ga0307512_10032892 3300030522 Bacteria 4469
223 Ga0314311_1080802 3300030733 Bacteria 3095
224 Ga0307513_10009673 3300031456 Bacteria 12179
225 Ga0307513_10125130 3300031456 Bacteria 2528
226 Ga0307513_10256181 3300031456 Bacteria 1543
227 Ga0307509_10086189 3300031507 Bacteria 3230
228 Ga0307408_100060652 3300031548 Bacteria 2758
229 Ga0307408_100164165 3300031548 Bacteria 1767
230 Ga0307408_100393533 3300031548 Bacteria 1188
231 Ga0307508_10029045 3300031616 Bacteria 4999
232 Ga0307508_10145166 3300031616 Bacteria 1977
233 Ga0316575_10021998 3300031665 Bacteria 2458
234 Ga0316579_10095690 3300031691 Bacteria 1420
235 Ga0316576_10105091 3300031727 Bacteria 2113
236 Ga0316576_10146985 3300031727 Bacteria 1776
237 Ga0316578_10011462 3300031728 Bacteria 4639
238 Ga0316578_10031378 3300031728 Bacteria 3027
239 Ga0307516_10002263 3300031730 Bacteria 25980
240 Ga0307516_10053560 3300031730 Bacteria 3945
241 Ga0307516_10164695 3300031730 Bacteria 1963
242 Ga0307405_10052694 3300031731 Bacteria 2531
243 Ga0307405_10086816 3300031731 Bacteria 2060
244 Ga0307405_10128974 3300031731 Bacteria 1744
245 Ga0316577_10106959 3300031733 Bacteria 1569
246 Ga0307413_10028380 3300031824 Bacteria 3116
247 Ga0307413_10028579 3300031824 Bacteria 3108
248 Ga0307413_10243923 3300031824 Bacteria 1328
249 Ga0307413_10403288 3300031824 Bacteria 1072
250 Ga0307413_10463452 3300031824 Bacteria 1009
251 Ga0307413_10537771 3300031824 Bacteria 945
252 Ga0307410_10004069 3300031852 Bacteria 7480
253 Ga0307410_10018682 3300031852 Bacteria 4194
254 Ga0307410_10018815 3300031852 Bacteria 4184
255 Ga0307410_10535005 3300031852 Bacteria 969
256 Ga0307406_10194979 3300031901 Bacteria 1486
257 Ga0307406_10320495 3300031901 Bacteria 1199
258 Ga0307406_10798198 3300031901 Bacteria 796
259 Ga0307407_10011351 3300031903 Bacteria 4238
260 Ga0307407_10015197 3300031903 Bacteria 3795
261 Ga0307407_10052697 3300031903 Bacteria 2338
262 Ga0307407_10148813 3300031903 Bacteria 1519
263 Ga0307412_10145978 3300031911 Bacteria 1739
264 Ga0307412_10399159 3300031911 Bacteria 1119
265 Ga0307409_100010822 3300031995 Bacteria 5705
266 Ga0307409_100038144 3300031995 Bacteria 3550
267 Ga0307409_100056911 3300031995 Bacteria 3026
268 Ga0307409_100073644 3300031995 Bacteria 2725
269 Ga0307409_100107585 3300031995 Bacteria 2330
270 Ga0307409_100326920 3300031995 Bacteria 1437
271 Ga0307409_100759172 3300031995 Bacteria 974
272 Ga0307416_100020083 3300032002 Bacteria 4757
273 Ga0307416_100065621 3300032002 Bacteria 2984
274 Ga0307416_100110977 3300032002 Bacteria 2416
275 Ga0307416_100127186 3300032002 Bacteria 2285
276 Ga0307416_100135886 3300032002 Bacteria 2224
277 Ga0307416_101133224 3300032002 Bacteria 887
278 Ga0307414_10092552 3300032004 Bacteria 2251
279 Ga0307414_10161995 3300032004 Bacteria 1778
280 Ga0307411_10166437 3300032005 Bacteria 1658
281 Ga0307411_10247417 3300032005 Bacteria 1400
282 Ga0307415_100008638 3300032126 Bacteria 5659
283 Ga0307415_100031774 3300032126 Bacteria 3406
284 Ga0307415_100053271 3300032126 Bacteria 2756
285 Ga0307415_100106695 3300032126 Bacteria 2068
286 Ga0307415_100150599 3300032126 Bacteria 1790
287 Ga0307415_100194344 3300032126 Bacteria 1604
288 Ga0307415_100342143 3300032126 Bacteria 1256
289 Ga0307415_100403636 3300032126 Bacteria 1167
290 Ga0316583_10011699 3300032133 Bacteria 3166
291 Ga0307507_10006968 3300033179 Bacteria 16815
292 Ga0307507_10033708 3300033179 Bacteria 5309
293 Ga0307507_10085498 3300033179 Bacteria 2743
294 Ga0307510_10223571 3300033180 Bacteria 1391
295 Ga0373958_0038479 3300034819 Bacteria 969
296 Ga0373949_0043996 3300035090 Bacteria 1106
297 Ga0373951_0012507 3300035091 Bacteria 1909
298 Ga0373932_0054689 3300035112 Bacteria 1195
299 Ga0373939_0055840 3300035114 Bacteria 1241
300 Ga0373941_0006758 3300035115 Bacteria 2777
301 Ga0373957_0184529 3300035120 Bacteria 866
302 Ga0316574_0017306 3300035398 Bacteria 4218
303 Ga0316574_0047580 3300035398 Bacteria 2662
304 Ga0316574_0170337 3300035398 Bacteria 1402
305 Ga0316574_0363833 3300035398 Bacteria 914
306 Ga0373931_0089276 3300035691 Bacteria 1714
307 Ga0373931_0129315 3300035691 Bacteria 1452
308 Ga0373935_0463263 3300035692 Bacteria 917
309 Ga0316582_0001134 3300036647 Bacteria 11341
310 Ga0316582_0030605 3300036647 Bacteria 3280
311 Ga0316582_0054770 3300036647 Bacteria 2541
312 Ga0316584_0009291 3300036712 Bacteria 6818
313 Ga0316584_0322583 3300036712 Bacteria 1114
314 Ga0316584_0356509 3300036712 Bacteria 1049
315 Ga0373925_0515710 3300037068 Bacteria 982
316 Ga0395899_0039890 3300037312 Bacteria 3513
317 Ga0395900_0103530 3300037418 Bacteria 2924
318 Ga0395900_0178476 3300037418 Bacteria 2159
319 Ga0395900_0248492 3300037418 Bacteria 1781
320 Ga0395898_0076092 3300037466 Bacteria 3241
321 Ga0395898_0125238 3300037466 Bacteria 2461
322 Ga0395898_0139595 3300037466 Bacteria 2320
323 Ga0395898_0232319 3300037466 Bacteria 1759
324 Ga0395905_0133325 3300037471 Bacteria 2336
325 Ga0395905_0196901 3300037471 Bacteria 1889
326 Ga0395901_0094270 3300038443 Bacteria 3135
327 Ga0395901_0397936 3300038443 Bacteria 1415
328 Ga0400483_232525 3300039062 Bacteria 1743
329 Ga0436365_0681260 3300039437 Bacteria 917
330 Ga0439436_0005148 3300041404 Bacteria 4009
331 Ga0439436_0027536 3300041404 Bacteria 1662
332 Ga0439439_0006369 3300041406 Bacteria 2728
333 Ga0451789_0108528 3300041443 Bacteria 1040
334 Ga0451791_1408399 3300041451 Bacteria 821
335 Ga0451793_0984998 3300041452 Bacteria 2531
336 Ga0451837_1228681 3300041494 Bacteria 762
337 Ga0451837_1803014 3300041494 Bacteria 967
338 Ga0439442_059912 3300042002 Bacteria 807
339 Ga0439445_0079212 3300042004 Bacteria 917
340 Ga0439448_0021014 3300042005 Bacteria 2024
341 Ga0439448_0082053 3300042005 Bacteria 1083
342 Ga0439432_078877 3300042006 Bacteria 999
343 Ga0439432_080765 3300042006 Bacteria 985
344 Ga0439432_166591 3300042006 Bacteria 644
345 Ga0439449_0149925 3300042007 Bacteria 870
346 Ga0439454_006330 3300042011 Bacteria 1451
347 Ga0439455_0054191 3300042012 Bacteria 1053
348 Ga0439457_002533 3300042014 Bacteria 5193
349 Ga0450923_051579 3300042125 Bacteria 885
350 Ga0450888_015097 3300042126 Bacteria 940
351 Ga0450897_008724 3300042128 Bacteria 948
352 Ga0450903_000140 3300042138 Bacteria 15845
353 Ga0439446_0041061 3300042156 Bacteria 1363
354 Ga0466969_0007563 3300044656 Bacteria 5774
355 Ga0466972_0078615 3300044658 Bacteria 1571
356 Ga0466965_0000459 3300044683 Bacteria 14372
357 Ga0466961_0028508 3300044693 Bacteria 3590
358 Ga0466961_0070555 3300044693 Bacteria 2218
359 Ga0466970_0018368 3300044765 Bacteria 3619
360 Ga0466970_0040593 3300044765 Bacteria 2471
361 Ga0466960_0262778 3300044901 Bacteria 962
362 Ga0466958_0612230 3300045836 Bacteria 708
363 Ga0495590_0000221 3300046457 Bacteria 31122
364 Ga0495641_0059561 3300046461 Bacteria 1726
365 Ga0495630_0406875 3300046517 Bacteria 1043
366 Ga0495632_0159574 3300046519 Bacteria 1039
367 Ga0495668_0386167 3300046616 Bacteria 769
368 Ga0495635_0491760 3300046663 Bacteria 808
369 Ga0495671_0211103 3300046692 Bacteria 941
370 Ga0495600_0302489 3300046809 Bacteria 1009
371 Ga0495674_0227549 3300047319 Bacteria 1540
372 Ga0496100_0014340 3300048903 Bacteria 4600
373 Ga0496101_0155322 3300048904 Bacteria 1752
374 Ga0496102_0514282 3300048905 Bacteria 1120
375 Ga0496104_0008619 3300048907 Bacteria 9069
376 Ga0496104_0038895 3300048907 Bacteria 4453
377 Ga0496104_0095815 3300048907 Bacteria 2839
378 Ga0496104_0607971 3300048907 Bacteria 1003
379 Ga0496104_0637990 3300048907 Bacteria 974
380 Ga0496105_0030278 3300048908 Bacteria 4435
381 Ga0496105_0098988 3300048908 Bacteria 2408
382 Ga0496105_0307113 3300048908 Bacteria 1274
383 Ga0496105_0617282 3300048908 Bacteria 840
384 Ga0496106_0008349 3300048909 Bacteria 7666
385 Ga0496106_0011316 3300048909 Bacteria 6604
386 Ga0496106_0095178 3300048909 Bacteria 2303
387 Ga0496107_0005340 3300048910 Bacteria 8784
388 Ga0496108_0030840 3300048911 Bacteria 4443
389 Ga0496108_0117764 3300048911 Bacteria 2276
390 Ga0496108_0780437 3300048911 Bacteria 825
391 Ga0496109_0091324 3300048912 Bacteria 2816
392 Ga0496109_0151308 3300048912 Bacteria 2173
393 Ga0496109_0562587 3300048912 Bacteria 1075
394 Ga0496110_0057530 3300048913 Bacteria 3423
395 Ga0496110_0088036 3300048913 Bacteria 2773
396 Ga0496110_0098917 3300048913 Bacteria 2615
397 Ga0496110_0167604 3300048913 Bacteria 1992
398 Ga0496110_0679618 3300048913 Bacteria 930
399 Ga0496111_0161052 3300048914 Bacteria 1666
400 Ga0496111_0181187 3300048914 Bacteria 1566
401 Ga0496111_0222561 3300048914 Bacteria 1402
402 Ga0496112_0027914 3300048915 Bacteria 5445
403 Ga0496112_0033816 3300048915 Bacteria 4972
404 Ga0496112_0200866 3300048915 Bacteria 1953
405 Ga0496112_0231281 3300048915 Bacteria 1803
406 Ga0496113_0128368 3300048916 Bacteria 1987
407 Ga0496114_0022042 3300048917 Bacteria 5186
408 Ga0496114_0080694 3300048917 Bacteria 2747
409 Ga0496114_0136754 3300048917 Bacteria 2119
410 Ga0496114_0828901 3300048917 Bacteria 804
411 Ga0496115_0015241 3300048918 Bacteria 5827
412 Ga0496118_0143414 3300048921 Bacteria 1509
413 Ga0496119_0002378 3300048922 Bacteria 20672
414 Ga0496119_0011146 3300048922 Bacteria 7487
415 Ga0496120_0002165 3300048923 Bacteria 20893
416 Ga0496120_0099531 3300048923 Bacteria 1539
417 Ga0496121_0000882 3300048924 Bacteria 54258
418 Ga0496121_0023119 3300048924 Bacteria 6001
419 Ga0496121_0034995 3300048924 Bacteria 4508
420 Ga0496124_0191963 3300048927 Bacteria 1562
421 Ga0496126_0119455 3300048929 Bacteria 2287
422 Ga0501032_0043680 3300049569 Bacteria 3034
423 Ga0501033_0230184 3300049570 Bacteria 1317
424 Ga0501036_0026197 3300049572 Bacteria 4922
425 Ga0501038_0011298 3300049574 Bacteria 8152
426 Ga0501038_0142958 3300049574 Bacteria 1956
427 Ga0501038_0556515 3300049574 Bacteria 872
428 Ga0501039_0020422 3300049575 Bacteria 5076
429 Ga0501039_0046274 3300049575 Bacteria 3361
430 Ga0501039_0423762 3300049575 Bacteria 1045
431 Ga0501039_0564638 3300049575 Bacteria 893
432 Ga0501040_0002626 3300049576 Bacteria 11587
433 Ga0501040_0064380 3300049576 Bacteria 2524
434 Ga0501040_0463676 3300049576 Bacteria 912
435 Ga0501041_0024336 3300049577 Bacteria 3634
436 Ga0501041_0308137 3300049577 Bacteria 998
437 Ga0501041_0452104 3300049577 Bacteria 815
438 Ga0501042_0002697 3300049578 Bacteria 10924
439 Ga0501042_0040022 3300049578 Bacteria 3332
440 Ga0501042_0387051 3300049578 Bacteria 1013
441 Ga0501043_0444146 3300049579 Bacteria 975
442 Ga0501046_0011504 3300049580 Bacteria 7566
443 Ga0501046_0034729 3300049580 Bacteria 4067
444 Ga0501046_0482033 3300049580 Bacteria 890
445 Ga0501048_0062094 3300049582 Bacteria 2645
446 Ga0501048_0213391 3300049582 Bacteria 1369
447 Ga0501070_0379113 3300049586 Bacteria 1146
448 Ga0501071_0015259 3300049587 Bacteria 5272
449 Ga0501071_0073320 3300049587 Bacteria 2497
450 Ga0501072_0004385 3300049588 Bacteria 10710
451 Ga0501072_0031678 3300049588 Bacteria 4141
452 Ga0501072_0069104 3300049588 Bacteria 2789
453 Ga0501074_0331650 3300049590 Bacteria 1080
454 Ga0501075_0013665 3300049591 Bacteria 5799
455 Ga0501075_0044327 3300049591 Bacteria 3337
456 Ga0501075_0221473 3300049591 Bacteria 1443
457 Ga0501075_0285883 3300049591 Bacteria 1256
458 Ga0501076_0312291 3300049592 Bacteria 1289
459 Ga0501077_0021393 3300049593 Bacteria 4093
460 Ga0501077_0093500 3300049593 Bacteria 1906
461 Ga0501233_009310 3300049668 Bacteria 1914
462 Ga0501243_016559 3300049675 Bacteria 1191
463 Ga0501261_016864 3300049690 Bacteria 1017
464 Ga0501079_0002745 3300049741 Bacteria 12833
465 Ga0501079_0371725 3300049741 Bacteria 1121
466 Ga0501079_0608093 3300049741 Bacteria 860
467 Ga0501081_0050820 3300049743 Bacteria 2856
468 Ga0501081_0589535 3300049743 Bacteria 832
469 Ga0501083_0353626 3300049744 Bacteria 955
470 Ga0501035_0077608 3300049822 Bacteria 2935
471 Ga0501045_0008716 3300049824 Bacteria 7073
472 Ga0501045_0104497 3300049824 Bacteria 2099
473 nmdc:mga03683_24477_c1 3300050489 Bacteria 2362
474 nmdc:mga03n38_127942_c1 3300050490 Bacteria 1256
475 nmdc:mga03n38_407052_c1 3300050490 Bacteria 750
476 nmdc:mga00v17_1774_c1 3300050491 Bacteria 11195
477 nmdc:mga00v17_378769_c1 3300050491 Bacteria 920
478 nmdc:mga0yw44_27739_c1 3300050492 Bacteria 3249
479 nmdc:mga0yw44_311720_c1 3300050492 Bacteria 1056
480 nmdc:mga0yw44_4718_c1 3300050492 Bacteria 6308
481 nmdc:mga0yw44_643053_c1 3300050492 Bacteria 721
482 nmdc:mga04h51_190808_c1 3300050495 Bacteria 801
483 nmdc:mga07m45_342956_c1 3300050496 Bacteria 868
484 nmdc:mga05p37_10365_c1 3300050507 Bacteria 11064
485 nmdc:mga05p37_21051_c1 3300050507 Bacteria 7894
486 nmdc:mga05p37_36067_c1 3300050507 Bacteria 6067
487 nmdc:mga05p37_641026_c1 3300050507 Bacteria 1192
488 nmdc:mga09592_13639_c1 3300050508 Bacteria 6641
489 nmdc:mga09592_424874_c1 3300050508 Bacteria 1148
490 nmdc:mga09592_90701_c1 3300050508 Bacteria 2611
491 nmdc:mga0qj67_137345_c1 3300050509 Bacteria 1981
492 nmdc:mga0qj67_525054_c1 3300050509 Bacteria 951
493 nmdc:mga0qj67_58146_c1 3300050509 Bacteria 1572
494 nmdc:mga06r32_141823_c1 3300050510 Bacteria 2380
495 nmdc:mga06r32_42337_c1 3300050510 Bacteria 4330
496 nmdc:mga06r32_8289_c1 3300050510 Bacteria 9354
497 nmdc:mga08y16_20997_c1 3300050511 Bacteria 6894
498 nmdc:mga08y16_28829_c1 3300050511 Bacteria 5851
499 nmdc:mga08y16_306104_c1 3300050511 Bacteria 1637
500 nmdc:mga0n895_1050670_c1 3300050512 Bacteria 794
501 nmdc:mga0n895_806114_c1 3300050512 Bacteria 929
502 nmdc:mga0a205_5680_c1 3300050515 Bacteria 11239
503 Ga0495619_0258494 3300053085 Bacteria 1207
504 Ga0500646_0000278 3300053090 Bacteria 15722
505 Ga0500641_0031960 3300053096 Bacteria 2079
506 Ga0500594_0014167 3300053118 Bacteria 1906
507 Ga0500577_0166709 3300053142 Bacteria 940
508 Ga0500588_0000633 3300053146 Bacteria 5837
509 Ga0500588_0008890 3300053146 Bacteria 2366
510 Ga0500600_0065955 3300053149 Bacteria 2001
511 Ga0500616_0000368 3300053153 Bacteria 63584
512 Ga0500616_0000427 3300053153 Bacteria 56111
513 Ga0501084_0004683 3300054114 Bacteria 11169
514 Ga0501084_0519608 3300054114 Bacteria 1006
515 Ga0501082_0061579 3300060353 Bacteria 3230
516 Ga0501082_0107158 3300060353 Bacteria 2417
517 Ga0501082_0357949 3300060353 Bacteria 1273
518 Ga0530510_0004039 3300061734 Bacteria 10128
519 Ga0530510_0011539 3300061734 Bacteria 6200
520 Ga0530510_0014960 3300061734 Bacteria 5478
521 Ga0530510_0366077 3300061734 Bacteria 1084
522 2517761845 2517572101 Bacteria 6884336
523 2586061841 2585427649 Bacteria 9053857
524 2644088977 2643221615 Bacteria 5487866
525 2644098478 2643221617 Bacteria 5139111
526 2644114664 2643221620 Bacteria 5134593
527 2644177266 2643221631 Bacteria 8168043
528 2644279491 2643221649 Bacteria 3867359
529 2644318822 2643221657 Bacteria 5490246
530 2644441375 2643221678 Bacteria 9540101
531 2644506306 2643221690 Bacteria 4654705
532 2644526300 2643221694 Bacteria 4392972
533 2644670975 2643221722 Bacteria 4247614
534 2686538208 2684623035 Bacteria 8032739
535 2738695714 2738541272 Bacteria 6848551
536 2739326145 2738543027 Bacteria 6409078
537 2740166704 2739367898 Bacteria 4367674
538 2753072496 2751185734 Bacteria 8863695
539 2753263919 2751185782 Bacteria 11227053
540 2774393208 2773857762 Bacteria 5971770
541 2785342046 2784746763 Bacteria 9783172
542 2786673654 2786546132 Bacteria 10419719
543 2809028221 2808606394 Bacteria 6248540
544 2812350807 2811994878 Bacteria 5992952
545 2855676054 2855670206 Bacteria 7120389
546 2855678701 2855676851 Bacteria 7063653
547 2856745539 2856741275 Bacteria 8096094
548 2856863710 2856858025 Bacteria 7255264
549 2857291001 2857288857 Bacteria 7189066
550 2858850549 2858848962 Bacteria 6963058
551 2858882878 2858882152 Bacteria 7230291
552 2858895047 2858888857 Bacteria 7060307
553 2858900053 2858895516 Bacteria 7378898
554 2862295139 2862290372 Bacteria 7471434
555 2863411012 2863404153 Bacteria 9672205
556 2869049951 2869048445 Bacteria 6875584
557 2869065200 2869061728 Bacteria 7112407
558 2869068785 2869068681 Bacteria 7205615
559 2870727018 2870721527 Bacteria 9689237
560 2873316692 2873314349 Bacteria 8512634
561 2880490462 2880489317 Bacteria 7096270
562 2880502056 2880495981 Bacteria 7340502
563 2884703955 2884693830 Bacteria 11273186
564 2887478977 2887478801 Bacteria 8972725
565 2891397918 2891395885 Bacteria 9251614
566 2891559695 2891554331 Bacteria 8812224
567 2891563330 2891562705 Bacteria 8039471
568 2895429442 2895427314 Bacteria 13147766
569 2895448690 2895442618 Bacteria 11027144
570 2895882412 2895880812 Bacteria 11255272
571 2929230593 2929226422 Bacteria 7248583
572 2946042894 2946041624 Bacteria 4191385
573 2946082060 2946080515 Bacteria 4310960
574 2954691511 2954682443 Bacteria 9862841
575 2954719755 2954711539 Bacteria 10867210
576 2954729789 2954721474 Bacteria 10456478
577 2954731993 2954731030 Bacteria 10243860
578 2954748694 2954740390 Bacteria 10229294
579 2954767807 2954759201 Bacteria 9358192
580 2997604328 2997600082 Bacteria 9896405
581 3006486305 3006486233 Bacteria 8157040
582 8001784528 8001781756 Bacteria 9586736
583 8002782971 8002775197 Bacteria 10728764
584 8047713870 8047710418 Bacteria 11023148
585 8047718333 8047710418 Bacteria 11023148
586 8054613075 8054609563 Bacteria 5170090
587 8054708498 8054704163 Bacteria 7247792
588 8054734094 8054727385 Bacteria 7558670
589 8054735634 8054734606 Bacteria 6947278
590 8055074105 8055066027 Bacteria 9479577
591 8055180140 8055172936 Bacteria 9305943
592 8056066438 8056060235 Bacteria 7259403
593 Ga0070714_100617641
594 JGI25406J46586_10047596
595 JGI25406J46586_10055663
596 JGI25407J50210_10003560
597 JGI25407J50210_10022718
598 Ga0006562J51391_1110228
599 Ga0070683_100312809
600 Ga0070670_100097723
601 Ga0068869_100001156
602 Ga0068869_100082288
603 Ga0068869_100707126
604 Ga0070680_100183772
605 Ga0070682_100066676
606 Ga0068868_100133490
607 Ga0070660_100033733
608 Ga0070692_10067282
609 Ga0070675_100012801
610 Ga0070674_100062075
611 Ga0070674_100531347
612 Ga0070673_100752075
613 Ga0070667_100029833
614 Ga0070667_100308844
615 Ga0070667_100759218
616 Ga0070709_10070199
617 Ga0070709_10070448
618 Ga0070714_100002301
619 Ga0070713_100220240
620 Ga0070700_100006245
621 Ga0070663_100003994
622 Ga0070678_100595158
623 Ga0070681_10443197
624 Ga0070681_10666889
625 Ga0070685_10480873
626 Ga0070706_100047806
627 Ga0070684_100018403
628 Ga0070684_100330475
629 Ga0068853_100321026
630 Ga0070672_100051484
631 Ga0070696_100344967
632 Ga0070665_100810990
633 Ga0070664_100001380
634 Ga0068857_100025628
635 Ga0068857_100748860
636 Ga0068854_100861332
637 Ga0068856_100106465
638 Ga0068856_100262001
639 Ga0070702_100252580
640 Ga0068852_100070874
641 Ga0068852_100183537
642 Ga0068859_100002869
643 Ga0068859_101598401
644 Ga0068870_10290643
645 Ga0068863_100002045
646 Ga0068858_100000054
647 Ga0068858_100006122
648 Ga0068860_100083929
649 Ga0068862_100000100
650 Ga0068862_100210024
651 Ga0081455_10017154
652 Ga0081455_10037817
653 Ga0081455_10041629
654 Ga0081455_10057429
655 Ga0081455_10095918
656 Ga0081455_10139190
657 Ga0081538_10000735
658 Ga0081538_10001786
659 Ga0081538_10004278
660 Ga0081538_10006368
661 Ga0081540_1030769
662 Ga0081539_10000485
663 Ga0081539_10000645
664 Ga0081539_10005373
665 Ga0081539_10010997
666 Ga0081539_10030149
667 Ga0070717_10022646
668 Ga0070717_10187253
669 Ga0075365_10002398
670 Ga0075365_10140517
671 Ga0075365_10172179
672 Ga0075368_10058087
673 Ga0075368_10068348
674 Ga0075363_100020647
675 Ga0075363_100376107
676 Ga0075364_10003577
677 Ga0070715_10001333
678 Ga0070716_100018402
679 Ga0075367_10033442
680 Ga0075367_10040653
681 Ga0068871_100175146
682 Ga0075430_100061522
683 Ga0075430_100204794
684 Ga0075431_100053875
685 Ga0075431_100343268
686 Ga0075433_10028255
687 Ga0075429_100080013
688 Ga0075429_100175396
689 Ga0075429_100182323
690 Ga0068865_100165867
691 Ga0075436_100093153
692 Ga0097620_100000173
693 Ga0097620_100002869
694 Ga0075435_100015013
695 Ga0111539_10012775
696 Ga0105245_10003477
697 Ga0105245_10178127
698 Ga0105245_10237446
699 Ga0105247_10005853
700 Ga0105247_10017471
701 Ga0114129_10021291
702 Ga0114129_10033591
703 Ga0114129_10082660
704 Ga0114129_10389083
705 Ga0105243_10069854
706 Ga0105243_10391228
707 Ga0105243_10788055
708 Ga0105242_10131265
709 Ga0105248_10037731
710 Ga0105238_10349106
711 Ga0105249_10379773
712 Ga0105249_10770480
713 Ga0105239_11154699
714 Ga0105239_11562437
715 Ga0105246_10269202
716 Ga0157322_1008034
717 Ga0157370_10075270
718 Ga0157369_10262518
719 Ga0157372_10401738
720 Ga0157375_10011302
721 Ga0157375_10545956
722 Ga0163163_10000978
723 Ga0163163_10004451
724 Ga0163163_10040247
725 Ga0163163_10721437
726 Ga0157380_10018202
727 Ga0157380_10379477
728 Ga0157380_11091709
729 Ga0157377_10011534
730 Ga0157379_10000122
731 Ga0157379_10000723
732 Ga0157376_10214591
733 Ga0183367_1014
734 Ga0163161_10348049
735 Ga0207692_10003712
736 Ga0207710_10001134
737 Ga0207710_10049783
738 Ga0207688_10095587
739 Ga0207685_10000504
740 Ga0207699_10005305
741 Ga0207645_10401493
742 Ga0207684_10011773
743 Ga0207654_10523088
744 Ga0207693_10009533
745 Ga0207663_10004876
746 Ga0207681_10662189
747 Ga0207694_10378677
748 Ga0207650_10291950
749 Ga0207650_10322426
750 Ga0207659_10002456
751 Ga0207687_10168735
752 Ga0207687_10192013
753 Ga0207700_10001963
754 Ga0207700_10077321
755 Ga0207700_10334632
756 Ga0207700_10760634
757 Ga0207664_10006464
758 Ga0207664_10011910
759 Ga0207706_10007244
760 Ga0207686_10092431
761 Ga0207709_10437655
762 Ga0207709_10810102
763 Ga0207669_10211402
764 Ga0207669_10311636
765 Ga0207704_10126639
766 Ga0207665_10001384
767 Ga0207691_10462261
768 Ga0207711_10001649
769 Ga0207689_10003080
770 Ga0207689_10096022
771 Ga0207661_10331440
772 Ga0207679_10020374
773 Ga0207679_10396460
774 Ga0207651_10441574
775 Ga0207712_10205253
776 Ga0207712_10331249
777 Ga0207668_10002695
778 Ga0207668_10504107
779 Ga0207658_10015398
780 Ga0207658_10678449
781 Ga0207677_10098996
782 Ga0207677_10686186
783 Ga0207703_10000002
784 Ga0207703_10005622
785 Ga0207639_10140514
786 Ga0207678_10005365
787 Ga0207708_10013558
788 Ga0207708_10251758
789 Ga0207708_10722643
790 Ga0207702_10047302
791 Ga0207641_10001322
792 Ga0207648_10161613
793 Ga0207648_10757693
794 Ga0207674_10032025
795 Ga0207675_100083393
796 Ga0207675_100141972
797 Ga0207675_100147025
798 Ga0207675_100772879
799 Ga0207683_10184664
800 Ga0207683_10303354
801 Ga0207698_10352704
802 Ga0207428_10077458
803 Ga0207428_10120697
804 Ga0268266_10587365
805 Ga0268265_10000110
806 Ga0268265_10220399
807 Ga0265334_10003108
808 Ga0307515_10006585
809 Ga0307515_10025112
810 Ga0307515_10078865
811 Ga0307515_10085424
812 Ga0307512_10008947
813 Ga0307512_10017080
814 Ga0307512_10032892
815 Ga0314311_1080802
816 Ga0307513_10009673
817 Ga0307513_10125130
818 Ga0307513_10256181
819 Ga0307509_10086189
820 Ga0307408_100060652
821 Ga0307408_100164165
822 Ga0307408_100393533
823 Ga0307508_10029045
824 Ga0307508_10145166
825 Ga0316575_10021998
826 Ga0316579_10095690
827 Ga0316576_10105091
828 Ga0316576_10146985
829 Ga0316578_10011462
830 Ga0316578_10031378
831 Ga0307516_10002263
832 Ga0307516_10053560
833 Ga0307516_10164695
834 Ga0307405_10052694
835 Ga0307405_10086816
836 Ga0307405_10128974
837 Ga0316577_10106959
838 Ga0307413_10028380
839 Ga0307413_10028579
840 Ga0307413_10243923
841 Ga0307413_10403288
842 Ga0307413_10463452
843 Ga0307413_10537771
844 Ga0307410_10004069
845 Ga0307410_10018682
846 Ga0307410_10018815
847 Ga0307410_10535005
848 Ga0307406_10194979
849 Ga0307406_10320495
850 Ga0307406_10798198
851 Ga0307407_10011351
852 Ga0307407_10015197
853 Ga0307407_10052697
854 Ga0307407_10148813
855 Ga0307412_10145978
856 Ga0307412_10399159
857 Ga0307409_100010822
858 Ga0307409_100038144
859 Ga0307409_100056911
860 Ga0307409_100073644
861 Ga0307409_100107585
862 Ga0307409_100326920
863 Ga0307409_100759172
864 Ga0307416_100020083
865 Ga0307416_100065621
866 Ga0307416_100110977
867 Ga0307416_100127186
868 Ga0307416_100135886
869 Ga0307416_101133224
870 Ga0307414_10092552
871 Ga0307414_10161995
872 Ga0307411_10166437
873 Ga0307411_10247417
874 Ga0307415_100008638
875 Ga0307415_100031774
876 Ga0307415_100053271
877 Ga0307415_100106695
878 Ga0307415_100150599
879 Ga0307415_100194344
880 Ga0307415_100342143
881 Ga0307415_100403636
882 Ga0316583_10011699
883 Ga0307507_10006968
884 Ga0307507_10033708
885 Ga0307507_10085498
886 Ga0307510_10223571
887 Ga0373958_0038479
888 Ga0373949_0043996
889 Ga0373951_0012507
890 Ga0373932_0054689
891 Ga0373939_0055840
892 Ga0373941_0006758
893 Ga0373957_0184529
894 Ga0316574_0017306
895 Ga0316574_0047580
896 Ga0316574_0170337
897 Ga0316574_0363833
898 Ga0373931_0089276
899 Ga0373931_0129315
900 Ga0373935_0463263
901 Ga0316582_0001134
902 Ga0316582_0030605
903 Ga0316582_0054770
904 Ga0316584_0009291
905 Ga0316584_0322583
906 Ga0316584_0356509
907 Ga0373925_0515710
908 Ga0395899_0039890
909 Ga0395900_0103530
910 Ga0395900_0178476
911 Ga0395900_0248492
912 Ga0395898_0076092
913 Ga0395898_0125238
914 Ga0395898_0139595
915 Ga0395898_0232319
916 Ga0395905_0133325
917 Ga0395905_0196901
918 Ga0395901_0094270
919 Ga0395901_0397936
920 Ga0400483_232525
921 Ga0436365_0681260
922 Ga0439436_0005148
923 Ga0439436_0027536
924 Ga0439439_0006369
925 Ga0451789_0108528
926 Ga0451791_1408399
927 Ga0451793_0984998
928 Ga0451837_1228681
929 Ga0451837_1803014
930 Ga0439442_059912
931 Ga0439445_0079212
932 Ga0439448_0021014
933 Ga0439448_0082053
934 Ga0439432_078877
935 Ga0439432_080765
936 Ga0439432_166591
937 Ga0439449_0149925
938 Ga0439454_006330
939 Ga0439455_0054191
940 Ga0439457_002533
941 Ga0450923_051579
942 Ga0450888_015097
943 Ga0450897_008724
944 Ga0450903_000140
945 Ga0439446_0041061
946 Ga0466969_0007563
947 Ga0466972_0078615
948 Ga0466965_0000459
949 Ga0466961_0028508
950 Ga0466961_0070555
951 Ga0466970_0018368
952 Ga0466970_0040593
953 Ga0466960_0262778
954 Ga0466958_0612230
955 Ga0495590_0000221
956 Ga0495641_0059561
957 Ga0495630_0406875
958 Ga0495632_0159574
959 Ga0495668_0386167
960 Ga0495635_0491760
961 Ga0495671_0211103
962 Ga0495600_0302489
963 Ga0495674_0227549
964 Ga0496100_0014340
965 Ga0496101_0155322
966 Ga0496102_0514282
967 Ga0496104_0008619
968 Ga0496104_0038895
969 Ga0496104_0095815
970 Ga0496104_0607971
971 Ga0496104_0637990
972 Ga0496105_0030278
973 Ga0496105_0098988
974 Ga0496105_0307113
975 Ga0496105_0617282
976 Ga0496106_0008349
977 Ga0496106_0011316
978 Ga0496106_0095178
979 Ga0496107_0005340
980 Ga0496108_0030840
981 Ga0496108_0117764
982 Ga0496108_0780437
983 Ga0496109_0091324
984 Ga0496109_0151308
985 Ga0496109_0562587
986 Ga0496110_0057530
987 Ga0496110_0088036
988 Ga0496110_0098917
989 Ga0496110_0167604
990 Ga0496110_0679618
991 Ga0496111_0161052
992 Ga0496111_0181187
993 Ga0496111_0222561
994 Ga0496112_0027914
995 Ga0496112_0033816
996 Ga0496112_0200866
997 Ga0496112_0231281
998 Ga0496113_0128368
999 Ga0496114_0022042
1000 Ga0496114_0080694
1001 Ga0496114_0136754
1002 Ga0496114_0828901
1003 Ga0496115_0015241
1004 Ga0496118_0143414
1005 Ga0496119_0002378
1006 Ga0496119_0011146
1007 Ga0496120_0002165
1008 Ga0496120_0099531
1009 Ga0496121_0000882
1010 Ga0496121_0023119
1011 Ga0496121_0034995
1012 Ga0496124_0191963
1013 Ga0496126_0119455
1014 Ga0501032_0043680
1015 Ga0501033_0230184
1016 Ga0501036_0026197
1017 Ga0501038_0011298
1018 Ga0501038_0142958
1019 Ga0501038_0556515
1020 Ga0501039_0020422
1021 Ga0501039_0046274
1022 Ga0501039_0423762
1023 Ga0501039_0564638
1024 Ga0501040_0002626
1025 Ga0501040_0064380
1026 Ga0501040_0463676
1027 Ga0501041_0024336
1028 Ga0501041_0308137
1029 Ga0501041_0452104
1030 Ga0501042_0002697
1031 Ga0501042_0040022
1032 Ga0501042_0387051
1033 Ga0501043_0444146
1034 Ga0501046_0011504
1035 Ga0501046_0034729
1036 Ga0501046_0482033
1037 Ga0501048_0062094
1038 Ga0501048_0213391
1039 Ga0501070_0379113
1040 Ga0501071_0015259
1041 Ga0501071_0073320
1042 Ga0501072_0004385
1043 Ga0501072_0031678
1044 Ga0501072_0069104
1045 Ga0501074_0331650
1046 Ga0501075_0013665
1047 Ga0501075_0044327
1048 Ga0501075_0221473
1049 Ga0501075_0285883
1050 Ga0501076_0312291
1051 Ga0501077_0021393
1052 Ga0501077_0093500
1053 Ga0501233_009310
1054 Ga0501243_016559
1055 Ga0501261_016864
1056 Ga0501079_0002745
1057 Ga0501079_0371725
1058 Ga0501079_0608093
1059 Ga0501081_0050820
1060 Ga0501081_0589535
1061 Ga0501083_0353626
1062 Ga0501035_0077608
1063 Ga0501045_0008716
1064 Ga0501045_0104497
1065 nmdc:mga03683_24477_c1
1066 nmdc:mga03n38_127942_c1
1067 nmdc:mga03n38_407052_c1
1068 nmdc:mga00v17_1774_c1
1069 nmdc:mga00v17_378769_c1
1070 nmdc:mga0yw44_27739_c1
1071 nmdc:mga0yw44_311720_c1
1072 nmdc:mga0yw44_4718_c1
1073 nmdc:mga0yw44_643053_c1
1074 nmdc:mga04h51_190808_c1
1075 nmdc:mga07m45_342956_c1
1076 nmdc:mga05p37_10365_c1
1077 nmdc:mga05p37_21051_c1
1078 nmdc:mga05p37_36067_c1
1079 nmdc:mga05p37_641026_c1
1080 nmdc:mga09592_13639_c1
1081 nmdc:mga09592_424874_c1
1082 nmdc:mga09592_90701_c1
1083 nmdc:mga0qj67_137345_c1
1084 nmdc:mga0qj67_525054_c1
1085 nmdc:mga0qj67_58146_c1
1086 nmdc:mga06r32_141823_c1
1087 nmdc:mga06r32_42337_c1
1088 nmdc:mga06r32_8289_c1
1089 nmdc:mga08y16_20997_c1
1090 nmdc:mga08y16_28829_c1
1091 nmdc:mga08y16_306104_c1
1092 nmdc:mga0n895_1050670_c1
1093 nmdc:mga0n895_806114_c1
1094 nmdc:mga0a205_5680_c1
1095 Ga0495619_0258494
1096 Ga0500646_0000278
1097 Ga0500641_0031960
1098 Ga0500594_0014167
1099 Ga0500577_0166709
1100 Ga0500588_0000633
1101 Ga0500588_0008890
1102 Ga0500600_0065955
1103 Ga0500616_0000368
1104 Ga0500616_0000427
1105 Ga0501084_0004683
1106 Ga0501084_0519608
1107 Ga0501082_0061579
1108 Ga0501082_0107158
1109 Ga0501082_0357949
1110 Ga0530510_0004039
1111 Ga0530510_0011539
1112 Ga0530510_0014960
1113 Ga0530510_0366077
1114 2517761845
1115 2586061841
1116 2644088977
1117 2644098478
1118 2644114664
1119 2644177266
1120 2644279491
1121 2644318822
1122 2644441375
1123 2644506306
1124 2644526300
1125 2644670975
1126 2686538208
1127 2738695714
1128 2739326145
1129 2740166704
1130 2753072496
1131 2753263919
1132 2774393208
1133 2785342046
1134 2786673654
1135 2809028221
1136 2812350807
1137 2855676054
1138 2855678701
1139 2856745539
1140 2856863710
1141 2857291001
1142 2858850549
1143 2858882878
1144 2858895047
1145 2858900053
1146 2862295139
1147 2863411012
1148 2869049951
1149 2869065200
1150 2869068785
1151 2870727018
1152 2873316692
1153 2880490462
1154 2880502056
1155 2884703955
1156 2887478977
1157 2891397918
1158 2891559695
1159 2891563330
1160 2895429442
1161 2895448690
1162 2895882412
1163 2929230593
1164 2946042894
1165 2946082060
1166 2954691511
1167 2954719755
1168 2954729789
1169 2954731993
1170 2954748694
1171 2954767807
1172 2997604328
1173 3006486305
1174 8001784528
1175 8002782971
1176 8047713870
1177 8047718333
1178 8054613075
1179 8054708498
1180 8054734094
1181 8054735634
1182 8055074105
1183 8055180140
1184 8056066438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

154

209

0.98

PF00072

Response_reg

Response regulator receiver domain

5

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 1.001 156 214
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 1 156 214
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9997 156 214
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9989 156 214
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9946 156 214
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.998 156 210 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9919 156 213 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9863 156 214 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.981 156 214 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9685 155 210 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6L7LCM3-F1-model_v4 Response regulator transcription factor 0.9985 1 104 GO:0000160
GO:0003677
AF-A0A0J8BJR0-F1-model_v4 LuxR family transcriptional regulator 0.9928 14 136 GO:0000160
GO:0003677
AF-A0A022MGP4-F1-model_v4 LuxR family transcriptional regulator 0.9895 1 138 GO:0000160
GO:0003677
AF-A0A5S4FXC1-F1-model_v4 Response regulator transcription factor 0.9853 2 215 GO:0000160
GO:0003677
GO:0006355
AF-A0A4R7VXS8-F1-model_v4 LuxR family two component transcriptional regulator 0.9845 1 215 GO:0000160
GO:0003677
GO:0006355

Map