F467070

General Info

Members Datasets Scaffolds Average Seq Length
591 295 1182 157

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0353598|Ga0466960_0353598_138_638
Length 166
Sequence MALHCPECGFVNAEGANYCSRCGAYLGAARERGAGRGXXGQSGEPATATYRIDETGELVPVDVGDVVADDGAALVIRAGGGRVGESFPLNADRMTIGRRPDSDIFLDDVTVSRDHALLVRRSGDYYLDDLGSLNGTYVNRHRIESHRLEDGDELQVGKFKLTYISR

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
200 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 9.81
Rhizosphere 86.29
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0353598 3300044901 Bacteria 838
2 JGI24743J22301_10030752 3300001991 Bacteria 1056
3 JGI24750J21931_1046746 3300002070 Bacteria 668
4 JGI24738J21930_10021397 3300002075 Bacteria 1341
5 JGI25407J50210_10002305 3300003373 Bacteria 4474
6 JGI25407J50210_10013633 3300003373 Bacteria 2090
7 JGI25407J50210_10017606 3300003373 Bacteria 1855
8 JGI25407J50210_10027269 3300003373 Bacteria 1481
9 Ga0070658_10036287 3300005327 Bacteria 3974
10 Ga0070676_10132168 3300005328 Bacteria 1579
11 Ga0070683_100023826 3300005329 Bacteria 5479
12 Ga0070690_100109613 3300005330 Bacteria 1840
13 Ga0070670_100310826 3300005331 Bacteria 1380
14 Ga0070670_100942709 3300005331 Bacteria 784
15 Ga0068869_100053865 3300005334 Bacteria 2926
16 Ga0068869_100540330 3300005334 Bacteria 978
17 Ga0070680_100775589 3300005336 Bacteria 826
18 Ga0070682_100123987 3300005337 Bacteria 1738
19 Ga0070682_100909515 3300005337 Bacteria 724
20 Ga0068868_100069534 3300005338 Bacteria 2806
21 Ga0070660_100057851 3300005339 Bacteria 3005
22 Ga0070660_100145195 3300005339 Bacteria 1905
23 Ga0070689_100203780 3300005340 Bacteria 1616
24 Ga0070689_100483587 3300005340 Bacteria 1058
25 Ga0070691_10072122 3300005341 Bacteria 1677
26 Ga0070661_100495218 3300005344 Bacteria 978
27 Ga0070692_10201472 3300005345 Bacteria 1166
28 Ga0070692_10529092 3300005345 Bacteria 769
29 Ga0070668_100121929 3300005347 Bacteria 2085
30 Ga0070668_100214558 3300005347 Bacteria 1584
31 Ga0070669_100119443 3300005353 Bacteria 2009
32 Ga0070669_100187350 3300005353 Bacteria 1622
33 Ga0070675_100229127 3300005354 Bacteria 1620
34 Ga0070671_100043650 3300005355 Bacteria 3726
35 Ga0070671_100057228 3300005355 Bacteria 3245
36 Ga0070673_100120943 3300005364 Bacteria 2184
37 Ga0070673_100196216 3300005364 Bacteria 1736
38 Ga0070688_100044433 3300005365 Bacteria 2742
39 Ga0070688_100485920 3300005365 Bacteria 929
40 Ga0070659_100027542 3300005366 Bacteria 4380
41 Ga0070659_100302968 3300005366 Bacteria 1333
42 Ga0070667_101232394 3300005367 Bacteria 700
43 Ga0070710_10286985 3300005437 Bacteria 1070
44 Ga0070701_10008866 3300005438 Bacteria 4375
45 Ga0070701_10214975 3300005438 Bacteria 1144
46 Ga0070711_100209138 3300005439 Bacteria 1510
47 Ga0070705_100247180 3300005440 Bacteria 1250
48 Ga0070705_100362612 3300005440 Bacteria 1061
49 Ga0070700_100002745 3300005441 Bacteria 9000
50 Ga0070700_100389612 3300005441 Bacteria 1044
51 Ga0070700_100397112 3300005441 Bacteria 1036
52 Ga0070694_100363945 3300005444 Bacteria 1124
53 Ga0070663_100246524 3300005455 Bacteria 1412
54 Ga0070678_100514029 3300005456 Bacteria 1058
55 Ga0070662_100039645 3300005457 Bacteria 3350
56 Ga0070662_100490526 3300005457 Bacteria 1024
57 Ga0070681_10499174 3300005458 Bacteria 1130
58 Ga0068867_100086761 3300005459 Bacteria 2368
59 Ga0070684_100077129 3300005535 Bacteria 2943
60 Ga0070684_100158797 3300005535 Bacteria 2050
61 Ga0070684_100775786 3300005535 Bacteria 895
62 Ga0068853_100824601 3300005539 Bacteria 889
63 Ga0070686_100031002 3300005544 Bacteria 3265
64 Ga0070695_101093472 3300005545 Bacteria 652
65 Ga0070665_100001080 3300005548 Bacteria 33916
66 Ga0070665_100224682 3300005548 Bacteria 1878
67 Ga0070665_101107085 3300005548 Bacteria 803
68 Ga0070704_100330912 3300005549 Bacteria 1279
69 Ga0070664_100101702 3300005564 Bacteria 2499
70 Ga0070664_100160386 3300005564 Bacteria 1990
71 Ga0070664_100237307 3300005564 Bacteria 1636
72 Ga0070664_100408476 3300005564 Bacteria 1242
73 Ga0070664_100441997 3300005564 Bacteria 1193
74 Ga0068857_100416438 3300005577 Bacteria 1252
75 Ga0068857_100549778 3300005577 Bacteria 1088
76 Ga0068856_100076698 3300005614 Bacteria 3311
77 Ga0068856_100088645 3300005614 Bacteria 3076
78 Ga0068856_100488914 3300005614 Bacteria 1252
79 Ga0068856_102352746 3300005614 Unclassified 540
80 Ga0070702_100013581 3300005615 Bacteria 4114
81 Ga0068852_100042343 3300005616 Bacteria 3855
82 Ga0068852_100124899 3300005616 Bacteria 2361
83 Ga0068864_100187470 3300005618 Bacteria 1894
84 Ga0068866_10168231 3300005718 Bacteria 1284
85 Ga0068861_100014438 3300005719 Bacteria 5545
86 Ga0068851_10038957 3300005834 Bacteria 2386
87 Ga0068863_100271398 3300005841 Bacteria 1642
88 Ga0068858_100076890 3300005842 Bacteria 3100
89 Ga0068858_100189200 3300005842 Bacteria 1945
90 Ga0068858_100544757 3300005842 Bacteria 1123
91 Ga0068860_100225667 3300005843 Bacteria 1819
92 Ga0068862_100096434 3300005844 Bacteria 2581
93 Ga0068862_100167060 3300005844 Bacteria 1967
94 Ga0081455_10014110 3300005937 Bacteria 7854
95 Ga0081455_10050127 3300005937 Bacteria 3593
96 Ga0081455_10075961 3300005937 Bacteria 2770
97 Ga0081455_10355991 3300005937 Bacteria 1031
98 Ga0081538_10000044 3300005981 Bacteria 115394
99 Ga0081538_10000087 3300005981 Bacteria 88954
100 Ga0081538_10037180 3300005981 Bacteria 3164
101 Ga0081538_10042648 3300005981 Bacteria 2860
102 Ga0081538_10102302 3300005981 Bacteria 1438
103 Ga0081538_10163032 3300005981 Bacteria 987
104 Ga0081538_10190409 3300005981 Bacteria 862
105 Ga0081540_1000159 3300005983 Bacteria 69507
106 Ga0081539_10009973 3300005985 Bacteria 7826
107 Ga0075365_10168455 3300006038 Bacteria 1528
108 Ga0070712_100042998 3300006175 Bacteria 3108
109 Ga0070712_100217703 3300006175 Bacteria 1510
110 Ga0075428_100052754 3300006844 Bacteria 4456
111 Ga0075428_100247964 3300006844 Bacteria 1920
112 Ga0075430_100008385 3300006846 Bacteria 8729
113 Ga0075430_100054022 3300006846 Bacteria 3380
114 Ga0075430_100292415 3300006846 Bacteria 1347
115 Ga0075431_100018168 3300006847 Bacteria 7154
116 Ga0075431_100063469 3300006847 Bacteria 3812
117 Ga0075431_100087320 3300006847 Bacteria 3218
118 Ga0075431_100222148 3300006847 Bacteria 1927
119 Ga0075433_10114613 3300006852 Bacteria 2391
120 Ga0075433_10685937 3300006852 Bacteria 897
121 Ga0075434_100060170 3300006871 Bacteria 3777
122 Ga0075429_100040574 3300006880 Bacteria 4053
123 Ga0075429_100368071 3300006880 Bacteria 1259
124 Ga0068865_100085772 3300006881 Bacteria 2272
125 Ga0068865_100151587 3300006881 Bacteria 1759
126 Ga0068865_100828714 3300006881 Bacteria 800
127 Ga0075436_100074479 3300006914 Bacteria 2350
128 Ga0075435_100116219 3300007076 Bacteria 2228
129 Ga0075435_100181511 3300007076 Bacteria 1779
130 Ga0105251_10121824 3300009011 Bacteria 1184
131 Ga0105240_10532304 3300009093 Bacteria 1302
132 Ga0105240_10841617 3300009093 Bacteria 991
133 Ga0105240_11636812 3300009093 Bacteria 673
134 Ga0111539_10023026 3300009094 Bacteria 7650
135 Ga0111539_10406605 3300009094 Bacteria 1585
136 Ga0111539_11605606 3300009094 Bacteria 754
137 Ga0111539_11665527 3300009094 Bacteria 740
138 Ga0105245_10008690 3300009098 Bacteria 8856
139 Ga0105247_10023111 3300009101 Bacteria 3744
140 Ga0105247_10052825 3300009101 Bacteria 2506
141 Ga0105247_10651528 3300009101 Bacteria 787
142 Ga0114129_10048622 3300009147 Bacteria 5960
143 Ga0114129_10181613 3300009147 Bacteria 2862
144 Ga0114129_11522386 3300009147 Bacteria 821
145 Ga0105243_10103212 3300009148 Bacteria 2371
146 Ga0105243_10112451 3300009148 Bacteria 2281
147 Ga0105243_10629055 3300009148 Bacteria 1037
148 Ga0105243_10686795 3300009148 Bacteria 996
149 Ga0105241_10175629 3300009174 Bacteria 1773
150 Ga0105248_10076330 3300009177 Bacteria 3767
151 Ga0105248_11122495 3300009177 Bacteria 889
152 Ga0105248_12082000 3300009177 Bacteria 645
153 Ga0105237_10138804 3300009545 Bacteria 2425
154 Ga0105237_10200199 3300009545 Bacteria 1997
155 Ga0105238_10380706 3300009551 Bacteria 1402
156 Ga0105249_10065536 3300009553 Bacteria 3342
157 Ga0105249_10075363 3300009553 Bacteria 3125
158 Ga0105249_12628525 3300009553 Bacteria 576
159 Ga0099796_10078082 3300010159 Bacteria 1209
160 Ga0105239_10025573 3300010375 Bacteria 6499
161 Ga0105239_10164595 3300010375 Bacteria 2479
162 Ga0105239_11431718 3300010375 Bacteria 798
163 Ga0105246_10020095 3300011119 Bacteria 4281
164 Ga0105246_10394544 3300011119 Bacteria 1147
165 Ga0157369_11023085 3300013105 Bacteria 845
166 Ga0157369_11482532 3300013105 Bacteria 690
167 Ga0157369_11907289 3300013105 Bacteria 603
168 Ga0157374_10046434 3300013296 Bacteria 4022
169 Ga0157374_10677088 3300013296 Bacteria 1044
170 Ga0157374_11280227 3300013296 Bacteria 755
171 Ga0157378_10150877 3300013297 Bacteria 2165
172 Ga0157378_10226185 3300013297 Bacteria 1780
173 Ga0157378_10246285 3300013297 Bacteria 1709
174 Ga0163162_10175264 3300013306 Bacteria 2270
175 Ga0157372_10032670 3300013307 Bacteria 5708
176 Ga0157372_10332743 3300013307 Bacteria 1769
177 Ga0157372_10744764 3300013307 Bacteria 1139
178 Ga0157372_11586697 3300013307 Bacteria 753
179 Ga0157375_10041001 3300013308 Bacteria 4468
180 Ga0157375_11104277 3300013308 Bacteria 928
181 Ga0163163_10319230 3300014325 Bacteria 1607
182 Ga0163163_10692910 3300014325 Bacteria 1082
183 Ga0157380_10335493 3300014326 Bacteria 1408
184 Ga0157380_10613593 3300014326 Bacteria 1079
185 Ga0157377_10000445 3300014745 Bacteria 17775
186 Ga0157377_10139185 3300014745 Bacteria 1490
187 Ga0157379_10005696 3300014968 Bacteria 10707
188 Ga0157376_10077063 3300014969 Bacteria 2851
189 Ga0157376_11300620 3300014969 Bacteria 757
190 Ga0163161_10867513 3300017792 Bacteria 763
191 Ga0163161_11313303 3300017792 Bacteria 629
192 Ga0206350_10431180 3300020080 Bacteria 902
193 Ga0206354_11282777 3300020081 Bacteria 992
194 Ga0206353_11352000 3300020082 Bacteria 1063
195 Ga0213873_10120740 3300021358 Bacteria 769
196 Ga0213874_10006303 3300021377 Bacteria 2806
197 Ga0213874_10165240 3300021377 Bacteria 780
198 Ga0213876_10022239 3300021384 Bacteria 3354
199 Ga0213876_10052775 3300021384 Bacteria 2148
200 Ga0224712_10225073 3300022467 Bacteria 860
201 Ga0224712_10231911 3300022467 Bacteria 848
202 Ga0207692_10044229 3300025898 Bacteria 2221
203 Ga0207692_10181318 3300025898 Bacteria 1227
204 Ga0207688_10002520 3300025901 Bacteria 9878
205 Ga0207688_10004157 3300025901 Bacteria 7885
206 Ga0207688_10272919 3300025901 Bacteria 1029
207 Ga0207699_10624673 3300025906 Bacteria 786
208 Ga0207699_10637558 3300025906 Bacteria 778
209 Ga0207645_10047096 3300025907 Bacteria 2754
210 Ga0207643_10074428 3300025908 Bacteria 1959
211 Ga0207705_10024905 3300025909 Bacteria 4271
212 Ga0207654_10053029 3300025911 Bacteria 2339
213 Ga0207707_10384092 3300025912 Bacteria 1207
214 Ga0207695_10383814 3300025913 Bacteria 1290
215 Ga0207671_10081637 3300025914 Bacteria 2425
216 Ga0207671_10146282 3300025914 Bacteria 1823
217 Ga0207693_10060605 3300025915 Bacteria 2965
218 Ga0207693_10225648 3300025915 Bacteria 1471
219 Ga0207663_10170313 3300025916 Bacteria 1546
220 Ga0207660_11064697 3300025917 Bacteria 659
221 Ga0207662_10058660 3300025918 Bacteria 2304
222 Ga0207662_10265044 3300025918 Bacteria 1132
223 Ga0207657_10101493 3300025919 Bacteria 2388
224 Ga0207649_10163390 3300025920 Bacteria 1545
225 Ga0207649_10348913 3300025920 Bacteria 1095
226 Ga0207681_10140485 3300025923 Bacteria 1798
227 Ga0207681_10683992 3300025923 Bacteria 852
228 Ga0207650_10229380 3300025925 Bacteria 1497
229 Ga0207650_11527326 3300025925 Bacteria 567
230 Ga0207659_10762419 3300025926 Bacteria 830
231 Ga0207659_11014490 3300025926 Bacteria 714
232 Ga0207687_10027950 3300025927 Bacteria 3787
233 Ga0207687_10339293 3300025927 Bacteria 1221
234 Ga0207664_10490640 3300025929 Bacteria 1099
235 Ga0207644_10050938 3300025931 Bacteria 2970
236 Ga0207644_10086142 3300025931 Bacteria 2332
237 Ga0207690_10056997 3300025932 Bacteria 2638
238 Ga0207690_10239195 3300025932 Bacteria 1398
239 Ga0207690_10577046 3300025932 Bacteria 916
240 Ga0207690_10804199 3300025932 Bacteria 777
241 Ga0207706_10747485 3300025933 Bacteria 833
242 Ga0207686_10213846 3300025934 Bacteria 1388
243 Ga0207686_10800826 3300025934 Bacteria 755
244 Ga0207709_10032435 3300025935 Bacteria 3058
245 Ga0207709_10238913 3300025935 Bacteria 1320
246 Ga0207709_10315894 3300025935 Bacteria 1167
247 Ga0207670_10353505 3300025936 Bacteria 1164
248 Ga0207670_10403903 3300025936 Bacteria 1093
249 Ga0207670_10813479 3300025936 Bacteria 779
250 Ga0207669_10604652 3300025937 Bacteria 892
251 Ga0207704_10036018 3300025938 Bacteria 2843
252 Ga0207704_10111441 3300025938 Bacteria 1850
253 Ga0207704_10742093 3300025938 Bacteria 816
254 Ga0207711_10194491 3300025941 Bacteria 1849
255 Ga0207711_11381955 3300025941 Bacteria 646
256 Ga0207689_10017217 3300025942 Bacteria 6117
257 Ga0207661_10031276 3300025944 Bacteria 4109
258 Ga0207661_10333134 3300025944 Bacteria 1366
259 Ga0207661_10348632 3300025944 Bacteria 1335
260 Ga0207661_10524507 3300025944 Bacteria 1084
261 Ga0207661_10731093 3300025944 Bacteria 911
262 Ga0207679_10154371 3300025945 Bacteria 1873
263 Ga0207679_10219856 3300025945 Bacteria 1598
264 Ga0207679_10330038 3300025945 Bacteria 1323
265 Ga0207651_10316715 3300025960 Bacteria 1303
266 Ga0207651_10518041 3300025960 Bacteria 1033
267 Ga0207712_10271587 3300025961 Bacteria 1380
268 Ga0207712_10502163 3300025961 Bacteria 1037
269 Ga0207668_10091855 3300025972 Bacteria 2232
270 Ga0207668_10132989 3300025972 Bacteria 1902
271 Ga0207668_11246175 3300025972 Bacteria 669
272 Ga0207640_10453590 3300025981 Bacteria 1057
273 Ga0207658_10734973 3300025986 Bacteria 893
274 Ga0207677_10075301 3300026023 Bacteria 2398
275 Ga0207677_11713848 3300026023 Bacteria 583
276 Ga0207703_10302897 3300026035 Bacteria 1458
277 Ga0207639_10413478 3300026041 Bacteria 1218
278 Ga0207639_10592643 3300026041 Bacteria 1021
279 Ga0207639_10700459 3300026041 Bacteria 940
280 Ga0207639_11016677 3300026041 Bacteria 776
281 Ga0207678_10161131 3300026067 Bacteria 1916
282 Ga0207678_10283749 3300026067 Bacteria 1421
283 Ga0207708_10004524 3300026075 Bacteria 10232
284 Ga0207708_10024674 3300026075 Bacteria 4547
285 Ga0207702_10044551 3300026078 Bacteria 3729
286 Ga0207702_10389625 3300026078 Bacteria 1341
287 Ga0207641_10382521 3300026088 Bacteria 1348
288 Ga0207648_10112410 3300026089 Bacteria 2391
289 Ga0207648_10242162 3300026089 Bacteria 1606
290 Ga0207676_10755217 3300026095 Bacteria 946
291 Ga0207674_10083317 3300026116 Bacteria 3198
292 Ga0207675_100053097 3300026118 Bacteria 3782
293 Ga0207675_100272677 3300026118 Bacteria 1642
294 Ga0207675_100328467 3300026118 Bacteria 1494
295 Ga0207683_10237801 3300026121 Bacteria 1661
296 Ga0207683_10472250 3300026121 Bacteria 1157
297 Ga0207683_10962424 3300026121 Bacteria 793
298 Ga0207698_10246718 3300026142 Bacteria 1631
299 Ga0207698_11245748 3300026142 Bacteria 758
300 Ga0207428_10041121 3300027907 Bacteria 3744
301 Ga0268266_10004961 3300028379 Bacteria 12594
302 Ga0268266_10328682 3300028379 Bacteria 1432
303 Ga0268265_10052630 3300028380 Bacteria 3080
304 Ga0268264_10540664 3300028381 Bacteria 1141
305 Ga0265318_10007004 3300028577 Bacteria 5134
306 Ga0265338_10021837 3300028800 Bacteria 6652
307 Ga0265330_10128289 3300031235 Bacteria 1080
308 Ga0265320_10001697 3300031240 Bacteria 15654
309 Ga0265329_10146000 3300031242 Bacteria 765
310 Ga0265331_10064565 3300031250 Bacteria 1723
311 Ga0265316_10077419 3300031344 Bacteria 2554
312 Ga0307408_100137671 3300031548 Bacteria 1912
313 Ga0265314_10143306 3300031711 Bacteria 1474
314 Ga0265342_10151969 3300031712 Bacteria 1285
315 Ga0307405_10174350 3300031731 Bacteria 1537
316 Ga0307405_10339813 3300031731 Bacteria 1154
317 Ga0307405_11473393 3300031731 Bacteria 597
318 Ga0307413_10022262 3300031824 Bacteria 3412
319 Ga0307410_10107122 3300031852 Bacteria 2015
320 Ga0307410_10622330 3300031852 Bacteria 903
321 Ga0307406_10057172 3300031901 Bacteria 2501
322 Ga0307406_10186787 3300031901 Bacteria 1514
323 Ga0307406_10415176 3300031901 Bacteria 1071
324 Ga0307406_10558783 3300031901 Bacteria 937
325 Ga0307406_10559384 3300031901 Bacteria 937
326 Ga0307407_10031418 3300031903 Bacteria 2875
327 Ga0307407_10079210 3300031903 Bacteria 1982
328 Ga0307407_10642742 3300031903 Bacteria 794
329 Ga0307407_10811863 3300031903 Bacteria 712
330 Ga0307407_10858950 3300031903 Bacteria 694
331 Ga0307412_10159919 3300031911 Bacteria 1672
332 Ga0307412_10543205 3300031911 Bacteria 975
333 Ga0307409_100051135 3300031995 Bacteria 3160
334 Ga0307409_100837964 3300031995 Bacteria 929
335 Ga0307409_100838820 3300031995 Bacteria 929
336 Ga0307416_100000981 3300032002 Bacteria 15094
337 Ga0307416_100499587 3300032002 Bacteria 1280
338 Ga0307416_100784260 3300032002 Bacteria 1048
339 Ga0307416_101150822 3300032002 Bacteria 881
340 Ga0307414_10731066 3300032004 Bacteria 898
341 Ga0307411_10227056 3300032005 Bacteria 1453
342 Ga0307415_100017292 3300032126 Bacteria 4321
343 Ga0307415_100341259 3300032126 Bacteria 1257
344 Ga0373945_0043134 3300035116 Bacteria 1636
345 Ga0373943_0209328 3300035170 Bacteria 1082
346 Ga0373946_0206654 3300035171 Bacteria 942
347 Ga0373942_0056201 3300035207 Bacteria 1117
348 Ga0373931_0897789 3300035691 Bacteria 595
349 Ga0373935_0220162 3300035692 Bacteria 1318
350 Ga0373947_0070201 3300035725 Bacteria 2146
351 Ga0373925_0210163 3300037068 Bacteria 1550
352 Ga0395899_0543568 3300037312 Bacteria 748
353 Ga0395900_0461385 3300037418 Bacteria 1225
354 Ga0395898_0107893 3300037466 Bacteria 2670
355 Ga0395898_0133332 3300037466 Bacteria 2379
356 Ga0395898_0222577 3300037466 Bacteria 1800
357 Ga0395898_0504390 3300037466 Bacteria 1151
358 Ga0395898_0964529 3300037466 Bacteria 789
359 Ga0395898_1304859 3300037466 Bacteria 655
360 Ga0436364_0227650 3300037853 Bacteria 574
361 Ga0436364_0266679 3300037853 Bacteria 1632
362 Ga0436364_0992010 3300037853 Bacteria 746
363 Ga0395901_0110909 3300038443 Bacteria 2881
364 Ga0395901_0185666 3300038443 Bacteria 2181
365 Ga0395901_0425617 3300038443 Bacteria 1361
366 Ga0395901_0501688 3300038443 Bacteria 1235
367 Ga0395901_0814495 3300038443 Bacteria 922
368 Ga0436365_0662175 3300039437 Bacteria 1779
369 Ga0436365_1510362 3300039437 Bacteria 4024
370 Ga0436365_1777927 3300039437 Bacteria 994
371 Ga0436363_0511768 3300039450 Bacteria 614
372 Ga0436363_0894687 3300039450 Bacteria 15587
373 Ga0436362_0724771 3300039453 Bacteria 3650
374 Ga0436362_0978896 3300039453 Bacteria 841
375 Ga0439463_091735 3300042016 Bacteria 782
376 Ga0439459_0067958 3300042438 Bacteria 819
377 Ga0466972_0081834 3300044658 Bacteria 1537
378 Ga0466965_0193799 3300044683 Bacteria 1076
379 Ga0466961_0197518 3300044693 Bacteria 1245
380 Ga0466961_0239632 3300044693 Bacteria 1115
381 Ga0466961_0460696 3300044693 Bacteria 769
382 Ga0466964_0410105 3300044706 Bacteria 710
383 Ga0466971_0248926 3300044719 Bacteria 846
384 Ga0466968_0119145 3300044735 Bacteria 1193
385 Ga0466968_0126060 3300044735 Bacteria 1162
386 Ga0466957_0018037 3300044842 Bacteria 4140
387 Ga0466960_0000118 3300044901 Bacteria 26199
388 Ga0466960_0042286 3300044901 Bacteria 2163
389 Ga0466960_0069083 3300044901 Bacteria 1754
390 Ga0466960_0106393 3300044901 Bacteria 1451
391 Ga0466960_0135764 3300044901 Bacteria 1302
392 Ga0466960_0242490 3300044901 Bacteria 998
393 Ga0466960_0260493 3300044901 Bacteria 966
394 Ga0466960_0417612 3300044901 Bacteria 775
395 Ga0466960_0492097 3300044901 Bacteria 718
396 Ga0466960_0514216 3300044901 Bacteria 703
397 Ga0466960_0651083 3300044901 Bacteria 629
398 Ga0466959_0172922 3300045049 Bacteria 1514
399 Ga0466958_0133528 3300045836 Bacteria 1560
400 Ga0466967_0019388 3300045976 Bacteria 5468
401 Ga0466967_0033655 3300045976 Bacteria 4341
402 Ga0466967_0183926 3300045976 Bacteria 1972
403 Ga0466967_0343561 3300045976 Bacteria 1444
404 Ga0466967_0938338 3300045976 Bacteria 861
405 Ga0466967_1557001 3300045976 Bacteria 658
406 Ga0466967_1606908 3300045976 Bacteria 647
407 Ga0466967_1773644 3300045976 Bacteria 614
408 Ga0495603_0106880 3300046455 Bacteria 1633
409 Ga0495650_0000331 3300046471 Bacteria 84807
410 Ga0495605_0032881 3300046474 Bacteria 2638
411 Ga0495584_0155832 3300046491 Bacteria 1161
412 Ga0495584_0166377 3300046491 Bacteria 1121
413 Ga0495596_0045081 3300046500 Bacteria 1734
414 Ga0495616_0050904 3300046513 Bacteria 2069
415 Ga0495616_0079972 3300046513 Bacteria 1566
416 Ga0495616_0192440 3300046513 Bacteria 901
417 Ga0495620_0112980 3300046515 Bacteria 1075
418 Ga0495620_0251648 3300046515 Bacteria 674
419 Ga0495620_0312344 3300046515 Bacteria 597
420 Ga0495620_0406920 3300046515 Bacteria 515
421 Ga0495643_0163706 3300046522 Bacteria 1093
422 Ga0495663_0065740 3300046525 Bacteria 1147
423 Ga0495663_0142197 3300046525 Bacteria 815
424 Ga0495663_0153055 3300046525 Bacteria 788
425 Ga0495663_0313337 3300046525 Bacteria 567
426 Ga0495642_0388791 3300046528 Bacteria 615
427 Ga0495609_0360116 3300046538 Bacteria 586
428 Ga0495597_0136772 3300046542 Bacteria 1013
429 Ga0495656_0099334 3300046615 Bacteria 1344
430 Ga0495656_0349177 3300046615 Bacteria 766
431 Ga0495656_0439477 3300046615 Bacteria 686
432 Ga0495668_0048513 3300046616 Bacteria 2356
433 Ga0495661_0546005 3300046665 Bacteria 549
434 Ga0495647_0280812 3300046681 Bacteria 747
435 Ga0495670_0084511 3300046691 Bacteria 1620
436 Ga0495674_0839571 3300047319 Bacteria 712
437 Ga0495626_0191856 3300048091 Bacteria 842
438 Ga0496100_0048204 3300048903 Bacteria 2749
439 Ga0496100_0048725 3300048903 Bacteria 2736
440 Ga0496100_0879655 3300048903 Bacteria 703
441 Ga0496101_0002140 3300048904 Bacteria 12052
442 Ga0496101_0066262 3300048904 Bacteria 2634
443 Ga0496101_0790490 3300048904 Bacteria 748
444 Ga0496102_0050760 3300048905 Bacteria 3778
445 Ga0496102_0059544 3300048905 Bacteria 3492
446 Ga0496102_0153250 3300048905 Bacteria 2166
447 Ga0496102_0688500 3300048905 Bacteria 945
448 Ga0496103_0116064 3300048906 Bacteria 1703
449 Ga0496103_0433620 3300048906 Bacteria 843
450 Ga0496103_0440170 3300048906 Bacteria 836
451 Ga0496103_0623911 3300048906 Bacteria 686
452 Ga0496104_0010872 3300048907 Bacteria 8140
453 Ga0496104_0079007 3300048907 Bacteria 3135
454 Ga0496104_1199174 3300048907 Bacteria 662
455 Ga0496104_1601216 3300048907 Bacteria 554
456 Ga0496105_0005348 3300048908 Bacteria 9731
457 Ga0496105_0084817 3300048908 Bacteria 2617
458 Ga0496105_0183169 3300048908 Bacteria 1714
459 Ga0496106_0073624 3300048909 Bacteria 2613
460 Ga0496106_0084392 3300048909 Bacteria 2444
461 Ga0496106_0151986 3300048909 Bacteria 1827
462 Ga0496106_0249297 3300048909 Bacteria 1419
463 Ga0496107_0140716 3300048910 Bacteria 1783
464 Ga0496107_0659492 3300048910 Bacteria 771
465 Ga0496108_0029351 3300048911 Bacteria 4553
466 Ga0496108_0031741 3300048911 Bacteria 4384
467 Ga0496108_0191321 3300048911 Bacteria 1773
468 Ga0496108_0704370 3300048911 Bacteria 875
469 Ga0496109_0013323 3300048912 Bacteria 7125
470 Ga0496109_0028849 3300048912 Bacteria 4967
471 Ga0496109_0210717 3300048912 Bacteria 1827
472 Ga0496109_0284766 3300048912 Bacteria 1558
473 Ga0496110_0011330 3300048913 Bacteria 7294
474 Ga0496110_0079415 3300048913 Bacteria 2921
475 Ga0496110_0451918 3300048913 Bacteria 1171
476 Ga0496110_0933337 3300048913 Bacteria 774
477 Ga0496110_0967840 3300048913 Bacteria 758
478 Ga0496111_0026005 3300048914 Bacteria 4130
479 Ga0496111_0057927 3300048914 Bacteria 2804
480 Ga0496111_0088139 3300048914 Bacteria 2272
481 Ga0496111_0139474 3300048914 Bacteria 1796
482 Ga0496112_0032551 3300048915 Bacteria 5064
483 Ga0496112_0070880 3300048915 Bacteria 3444
484 Ga0496112_0170872 3300048915 Bacteria 2139
485 Ga0496112_0220648 3300048915 Bacteria 1852
486 Ga0496112_0564491 3300048915 Bacteria 1071
487 Ga0496112_1216960 3300048915 Bacteria 670
488 Ga0496113_0007431 3300048916 Bacteria 7050
489 Ga0496113_0030888 3300048916 Bacteria 3882
490 Ga0496113_0527709 3300048916 Bacteria 947
491 Ga0496114_0054174 3300048917 Bacteria 3345
492 Ga0496114_0521019 3300048917 Bacteria 1051
493 Ga0496114_1155908 3300048917 Bacteria 659
494 Ga0496115_0338431 3300048918 Bacteria 1228
495 Ga0496115_0695320 3300048918 Bacteria 800
496 Ga0496118_0442735 3300048921 Bacteria 662
497 Ga0496119_0183612 3300048922 Bacteria 1095
498 Ga0496120_0374993 3300048923 Bacteria 634
499 Ga0496121_0003484 3300048924 Bacteria 22403
500 Ga0496121_0037087 3300048924 Bacteria 4334
501 Ga0501031_0019210 3300049568 Bacteria 4449
502 Ga0501031_0071752 3300049568 Bacteria 2255
503 Ga0501032_0020749 3300049569 Bacteria 4574
504 Ga0501033_0005225 3300049570 Bacteria 10308
505 Ga0501033_0687215 3300049570 Bacteria 697
506 Ga0501034_0004398 3300049571 Bacteria 15698
507 Ga0501034_0043956 3300049571 Bacteria 4518
508 Ga0501034_0796311 3300049571 Bacteria 838
509 Ga0501036_0040111 3300049572 Bacteria 3960
510 Ga0501036_0275022 3300049572 Bacteria 1410
511 Ga0501037_0011788 3300049573 Bacteria 6438
512 Ga0501038_0020308 3300049574 Bacteria 5974
513 Ga0501038_0844064 3300049574 Bacteria 679
514 Ga0501038_1091939 3300049574 Bacteria 583
515 Ga0501039_0007441 3300049575 Bacteria 8357
516 Ga0501039_0915375 3300049575 Bacteria 682
517 Ga0501040_0957276 3300049576 Bacteria 620
518 Ga0501041_0112308 3300049577 Bacteria 1691
519 Ga0501041_0399924 3300049577 Bacteria 870
520 Ga0501041_0916407 3300049577 Bacteria 563
521 Ga0501042_0101367 3300049578 Bacteria 2070
522 Ga0501042_0340034 3300049578 Bacteria 1085
523 Ga0501042_0839398 3300049578 Bacteria 669
524 Ga0501043_0025759 3300049579 Bacteria 4613
525 Ga0501043_0487160 3300049579 Bacteria 923
526 Ga0501046_0069569 3300049580 Bacteria 2738
527 Ga0501047_0076960 3300049581 Bacteria 3210
528 Ga0501048_0016983 3300049582 Bacteria 5363
529 Ga0501067_0015012 3300049583 Bacteria 4285
530 Ga0501069_0013458 3300049585 Bacteria 4362
531 Ga0501070_0154241 3300049586 Bacteria 1894
532 Ga0501070_0625885 3300049586 Bacteria 856
533 Ga0501071_0299576 3300049587 Bacteria 1219
534 Ga0501071_0600654 3300049587 Bacteria 846
535 Ga0501071_1413781 3300049587 Bacteria 537
536 Ga0501072_0101395 3300049588 Bacteria 2288
537 Ga0501072_0890277 3300049588 Unclassified 695
538 Ga0501072_1173498 3300049588 Bacteria 597
539 Ga0501073_0004711 3300049589 Bacteria 10246
540 Ga0501074_0012746 3300049590 Bacteria 6112
541 Ga0501076_0318115 3300049592 Bacteria 1277
542 Ga0501079_0118094 3300049741 Bacteria 2062
543 Ga0501079_0200155 3300049741 Bacteria 1560
544 Ga0501079_0217943 3300049741 Bacteria 1491
545 Ga0501080_0026577 3300049742 Bacteria 5378
546 Ga0501080_0334681 3300049742 Bacteria 1369
547 Ga0501080_0987398 3300049742 Bacteria 731
548 Ga0501083_0012633 3300049744 Bacteria 5907
549 Ga0501035_0033781 3300049822 Bacteria 4649
550 Ga0501044_0341390 3300049823 Bacteria 1418
551 Ga0501045_0085564 3300049824 Bacteria 2327
552 nmdc:mga0yw44_134652_c1 3300050492 Bacteria 1602
553 nmdc:mga0yw44_246930_c1 3300050492 Bacteria 1187
554 nmdc:mga05p37_117678_c1 3300050507 Bacteria 3265
555 nmdc:mga05p37_278417_c1 3300050507 Bacteria 1996
556 nmdc:mga05p37_635209_c1 3300050507 Bacteria 1199
557 nmdc:mga09592_1707846_c1 3300050508 Bacteria 507
558 nmdc:mga09592_19110_c1 3300050508 Bacteria 5624
559 nmdc:mga09592_727136_c1 3300050508 Bacteria 843
560 nmdc:mga0qj67_15844_c1 3300050509 Bacteria 5709
561 nmdc:mga0qj67_211889_c1 3300050509 Bacteria 1573
562 nmdc:mga0qj67_4741_c1 3300050509 Bacteria 9878
563 nmdc:mga0qj67_580153_c1 3300050509 Bacteria 898
564 nmdc:mga0qj67_792856_c1 3300050509 Bacteria 750
565 nmdc:mga06r32_28402_c1 3300050510 Bacteria 5234
566 nmdc:mga06r32_31863_c1 3300050510 Bacteria 4954
567 nmdc:mga06r32_553385_c1 3300050510 Bacteria 1124
568 nmdc:mga06r32_56301_c1 3300050510 Bacteria 3774
569 nmdc:mga06r32_78012_c1 3300050510 Bacteria 3219
570 nmdc:mga06r32_784605_c1 3300050510 Bacteria 914
571 nmdc:mga08y16_338925_c1 3300050511 Bacteria 1546
572 nmdc:mga08y16_45474_c1 3300050511 Bacteria 4600
573 nmdc:mga0n895_22258_c1 3300050512 Bacteria 5943
574 nmdc:mga0n895_774311_c1 3300050512 Bacteria 951
575 nmdc:mga0rr50_61718_c1 3300050513 Bacteria 2825
576 nmdc:mga0a205_19929_c1 3300050515 Bacteria 6327
577 nmdc:mga0a205_97755_c1 3300050515 Bacteria 2834
578 Ga0495655_0028343 3300053083 Bacteria 1337
579 Ga0495655_0115540 3300053083 Bacteria 811
580 Ga0495655_0278434 3300053083 Bacteria 569
581 Ga0500616_0002393 3300053153 Bacteria 15658
582 Ga0500616_0004025 3300053153 Bacteria 10701
583 Ga0500599_004846 3300053736 Bacteria 1675
584 Ga0501084_0256106 3300054114 Bacteria 1477
585 Ga0501084_0704102 3300054114 Bacteria 852
586 Ga0587106_124879 3300059605 Bacteria 550
587 Ga0501082_0023450 3300060353 Bacteria 5324
588 Ga0501082_0281326 3300060353 Bacteria 1448
589 Ga0501082_0308784 3300060353 Bacteria 1377
590 Ga0466962_0493689 3300061719 Bacteria 619
591 Ga0530510_0575774 3300061734 Bacteria 856
592 Ga0466960_0353598
593 JGI24743J22301_10030752
594 JGI24750J21931_1046746
595 JGI24738J21930_10021397
596 JGI25407J50210_10002305
597 JGI25407J50210_10013633
598 JGI25407J50210_10017606
599 JGI25407J50210_10027269
600 Ga0070658_10036287
601 Ga0070676_10132168
602 Ga0070683_100023826
603 Ga0070690_100109613
604 Ga0070670_100310826
605 Ga0070670_100942709
606 Ga0068869_100053865
607 Ga0068869_100540330
608 Ga0070680_100775589
609 Ga0070682_100123987
610 Ga0070682_100909515
611 Ga0068868_100069534
612 Ga0070660_100057851
613 Ga0070660_100145195
614 Ga0070689_100203780
615 Ga0070689_100483587
616 Ga0070691_10072122
617 Ga0070661_100495218
618 Ga0070692_10201472
619 Ga0070692_10529092
620 Ga0070668_100121929
621 Ga0070668_100214558
622 Ga0070669_100119443
623 Ga0070669_100187350
624 Ga0070675_100229127
625 Ga0070671_100043650
626 Ga0070671_100057228
627 Ga0070673_100120943
628 Ga0070673_100196216
629 Ga0070688_100044433
630 Ga0070688_100485920
631 Ga0070659_100027542
632 Ga0070659_100302968
633 Ga0070667_101232394
634 Ga0070710_10286985
635 Ga0070701_10008866
636 Ga0070701_10214975
637 Ga0070711_100209138
638 Ga0070705_100247180
639 Ga0070705_100362612
640 Ga0070700_100002745
641 Ga0070700_100389612
642 Ga0070700_100397112
643 Ga0070694_100363945
644 Ga0070663_100246524
645 Ga0070678_100514029
646 Ga0070662_100039645
647 Ga0070662_100490526
648 Ga0070681_10499174
649 Ga0068867_100086761
650 Ga0070684_100077129
651 Ga0070684_100158797
652 Ga0070684_100775786
653 Ga0068853_100824601
654 Ga0070686_100031002
655 Ga0070695_101093472
656 Ga0070665_100001080
657 Ga0070665_100224682
658 Ga0070665_101107085
659 Ga0070704_100330912
660 Ga0070664_100101702
661 Ga0070664_100160386
662 Ga0070664_100237307
663 Ga0070664_100408476
664 Ga0070664_100441997
665 Ga0068857_100416438
666 Ga0068857_100549778
667 Ga0068856_100076698
668 Ga0068856_100088645
669 Ga0068856_100488914
670 Ga0068856_102352746
671 Ga0070702_100013581
672 Ga0068852_100042343
673 Ga0068852_100124899
674 Ga0068864_100187470
675 Ga0068866_10168231
676 Ga0068861_100014438
677 Ga0068851_10038957
678 Ga0068863_100271398
679 Ga0068858_100076890
680 Ga0068858_100189200
681 Ga0068858_100544757
682 Ga0068860_100225667
683 Ga0068862_100096434
684 Ga0068862_100167060
685 Ga0081455_10014110
686 Ga0081455_10050127
687 Ga0081455_10075961
688 Ga0081455_10355991
689 Ga0081538_10000044
690 Ga0081538_10000087
691 Ga0081538_10037180
692 Ga0081538_10042648
693 Ga0081538_10102302
694 Ga0081538_10163032
695 Ga0081538_10190409
696 Ga0081540_1000159
697 Ga0081539_10009973
698 Ga0075365_10168455
699 Ga0070712_100042998
700 Ga0070712_100217703
701 Ga0075428_100052754
702 Ga0075428_100247964
703 Ga0075430_100008385
704 Ga0075430_100054022
705 Ga0075430_100292415
706 Ga0075431_100018168
707 Ga0075431_100063469
708 Ga0075431_100087320
709 Ga0075431_100222148
710 Ga0075433_10114613
711 Ga0075433_10685937
712 Ga0075434_100060170
713 Ga0075429_100040574
714 Ga0075429_100368071
715 Ga0068865_100085772
716 Ga0068865_100151587
717 Ga0068865_100828714
718 Ga0075436_100074479
719 Ga0075435_100116219
720 Ga0075435_100181511
721 Ga0105251_10121824
722 Ga0105240_10532304
723 Ga0105240_10841617
724 Ga0105240_11636812
725 Ga0111539_10023026
726 Ga0111539_10406605
727 Ga0111539_11605606
728 Ga0111539_11665527
729 Ga0105245_10008690
730 Ga0105247_10023111
731 Ga0105247_10052825
732 Ga0105247_10651528
733 Ga0114129_10048622
734 Ga0114129_10181613
735 Ga0114129_11522386
736 Ga0105243_10103212
737 Ga0105243_10112451
738 Ga0105243_10629055
739 Ga0105243_10686795
740 Ga0105241_10175629
741 Ga0105248_10076330
742 Ga0105248_11122495
743 Ga0105248_12082000
744 Ga0105237_10138804
745 Ga0105237_10200199
746 Ga0105238_10380706
747 Ga0105249_10065536
748 Ga0105249_10075363
749 Ga0105249_12628525
750 Ga0099796_10078082
751 Ga0105239_10025573
752 Ga0105239_10164595
753 Ga0105239_11431718
754 Ga0105246_10020095
755 Ga0105246_10394544
756 Ga0157369_11023085
757 Ga0157369_11482532
758 Ga0157369_11907289
759 Ga0157374_10046434
760 Ga0157374_10677088
761 Ga0157374_11280227
762 Ga0157378_10150877
763 Ga0157378_10226185
764 Ga0157378_10246285
765 Ga0163162_10175264
766 Ga0157372_10032670
767 Ga0157372_10332743
768 Ga0157372_10744764
769 Ga0157372_11586697
770 Ga0157375_10041001
771 Ga0157375_11104277
772 Ga0163163_10319230
773 Ga0163163_10692910
774 Ga0157380_10335493
775 Ga0157380_10613593
776 Ga0157377_10000445
777 Ga0157377_10139185
778 Ga0157379_10005696
779 Ga0157376_10077063
780 Ga0157376_11300620
781 Ga0163161_10867513
782 Ga0163161_11313303
783 Ga0206350_10431180
784 Ga0206354_11282777
785 Ga0206353_11352000
786 Ga0213873_10120740
787 Ga0213874_10006303
788 Ga0213874_10165240
789 Ga0213876_10022239
790 Ga0213876_10052775
791 Ga0224712_10225073
792 Ga0224712_10231911
793 Ga0207692_10044229
794 Ga0207692_10181318
795 Ga0207688_10002520
796 Ga0207688_10004157
797 Ga0207688_10272919
798 Ga0207699_10624673
799 Ga0207699_10637558
800 Ga0207645_10047096
801 Ga0207643_10074428
802 Ga0207705_10024905
803 Ga0207654_10053029
804 Ga0207707_10384092
805 Ga0207695_10383814
806 Ga0207671_10081637
807 Ga0207671_10146282
808 Ga0207693_10060605
809 Ga0207693_10225648
810 Ga0207663_10170313
811 Ga0207660_11064697
812 Ga0207662_10058660
813 Ga0207662_10265044
814 Ga0207657_10101493
815 Ga0207649_10163390
816 Ga0207649_10348913
817 Ga0207681_10140485
818 Ga0207681_10683992
819 Ga0207650_10229380
820 Ga0207650_11527326
821 Ga0207659_10762419
822 Ga0207659_11014490
823 Ga0207687_10027950
824 Ga0207687_10339293
825 Ga0207664_10490640
826 Ga0207644_10050938
827 Ga0207644_10086142
828 Ga0207690_10056997
829 Ga0207690_10239195
830 Ga0207690_10577046
831 Ga0207690_10804199
832 Ga0207706_10747485
833 Ga0207686_10213846
834 Ga0207686_10800826
835 Ga0207709_10032435
836 Ga0207709_10238913
837 Ga0207709_10315894
838 Ga0207670_10353505
839 Ga0207670_10403903
840 Ga0207670_10813479
841 Ga0207669_10604652
842 Ga0207704_10036018
843 Ga0207704_10111441
844 Ga0207704_10742093
845 Ga0207711_10194491
846 Ga0207711_11381955
847 Ga0207689_10017217
848 Ga0207661_10031276
849 Ga0207661_10333134
850 Ga0207661_10348632
851 Ga0207661_10524507
852 Ga0207661_10731093
853 Ga0207679_10154371
854 Ga0207679_10219856
855 Ga0207679_10330038
856 Ga0207651_10316715
857 Ga0207651_10518041
858 Ga0207712_10271587
859 Ga0207712_10502163
860 Ga0207668_10091855
861 Ga0207668_10132989
862 Ga0207668_11246175
863 Ga0207640_10453590
864 Ga0207658_10734973
865 Ga0207677_10075301
866 Ga0207677_11713848
867 Ga0207703_10302897
868 Ga0207639_10413478
869 Ga0207639_10592643
870 Ga0207639_10700459
871 Ga0207639_11016677
872 Ga0207678_10161131
873 Ga0207678_10283749
874 Ga0207708_10004524
875 Ga0207708_10024674
876 Ga0207702_10044551
877 Ga0207702_10389625
878 Ga0207641_10382521
879 Ga0207648_10112410
880 Ga0207648_10242162
881 Ga0207676_10755217
882 Ga0207674_10083317
883 Ga0207675_100053097
884 Ga0207675_100272677
885 Ga0207675_100328467
886 Ga0207683_10237801
887 Ga0207683_10472250
888 Ga0207683_10962424
889 Ga0207698_10246718
890 Ga0207698_11245748
891 Ga0207428_10041121
892 Ga0268266_10004961
893 Ga0268266_10328682
894 Ga0268265_10052630
895 Ga0268264_10540664
896 Ga0265318_10007004
897 Ga0265338_10021837
898 Ga0265330_10128289
899 Ga0265320_10001697
900 Ga0265329_10146000
901 Ga0265331_10064565
902 Ga0265316_10077419
903 Ga0307408_100137671
904 Ga0265314_10143306
905 Ga0265342_10151969
906 Ga0307405_10174350
907 Ga0307405_10339813
908 Ga0307405_11473393
909 Ga0307413_10022262
910 Ga0307410_10107122
911 Ga0307410_10622330
912 Ga0307406_10057172
913 Ga0307406_10186787
914 Ga0307406_10415176
915 Ga0307406_10558783
916 Ga0307406_10559384
917 Ga0307407_10031418
918 Ga0307407_10079210
919 Ga0307407_10642742
920 Ga0307407_10811863
921 Ga0307407_10858950
922 Ga0307412_10159919
923 Ga0307412_10543205
924 Ga0307409_100051135
925 Ga0307409_100837964
926 Ga0307409_100838820
927 Ga0307416_100000981
928 Ga0307416_100499587
929 Ga0307416_100784260
930 Ga0307416_101150822
931 Ga0307414_10731066
932 Ga0307411_10227056
933 Ga0307415_100017292
934 Ga0307415_100341259
935 Ga0373945_0043134
936 Ga0373943_0209328
937 Ga0373946_0206654
938 Ga0373942_0056201
939 Ga0373931_0897789
940 Ga0373935_0220162
941 Ga0373947_0070201
942 Ga0373925_0210163
943 Ga0395899_0543568
944 Ga0395900_0461385
945 Ga0395898_0107893
946 Ga0395898_0133332
947 Ga0395898_0222577
948 Ga0395898_0504390
949 Ga0395898_0964529
950 Ga0395898_1304859
951 Ga0436364_0227650
952 Ga0436364_0266679
953 Ga0436364_0992010
954 Ga0395901_0110909
955 Ga0395901_0185666
956 Ga0395901_0425617
957 Ga0395901_0501688
958 Ga0395901_0814495
959 Ga0436365_0662175
960 Ga0436365_1510362
961 Ga0436365_1777927
962 Ga0436363_0511768
963 Ga0436363_0894687
964 Ga0436362_0724771
965 Ga0436362_0978896
966 Ga0439463_091735
967 Ga0439459_0067958
968 Ga0466972_0081834
969 Ga0466965_0193799
970 Ga0466961_0197518
971 Ga0466961_0239632
972 Ga0466961_0460696
973 Ga0466964_0410105
974 Ga0466971_0248926
975 Ga0466968_0119145
976 Ga0466968_0126060
977 Ga0466957_0018037
978 Ga0466960_0000118
979 Ga0466960_0042286
980 Ga0466960_0069083
981 Ga0466960_0106393
982 Ga0466960_0135764
983 Ga0466960_0242490
984 Ga0466960_0260493
985 Ga0466960_0417612
986 Ga0466960_0492097
987 Ga0466960_0514216
988 Ga0466960_0651083
989 Ga0466959_0172922
990 Ga0466958_0133528
991 Ga0466967_0019388
992 Ga0466967_0033655
993 Ga0466967_0183926
994 Ga0466967_0343561
995 Ga0466967_0938338
996 Ga0466967_1557001
997 Ga0466967_1606908
998 Ga0466967_1773644
999 Ga0495603_0106880
1000 Ga0495650_0000331
1001 Ga0495605_0032881
1002 Ga0495584_0155832
1003 Ga0495584_0166377
1004 Ga0495596_0045081
1005 Ga0495616_0050904
1006 Ga0495616_0079972
1007 Ga0495616_0192440
1008 Ga0495620_0112980
1009 Ga0495620_0251648
1010 Ga0495620_0312344
1011 Ga0495620_0406920
1012 Ga0495643_0163706
1013 Ga0495663_0065740
1014 Ga0495663_0142197
1015 Ga0495663_0153055
1016 Ga0495663_0313337
1017 Ga0495642_0388791
1018 Ga0495609_0360116
1019 Ga0495597_0136772
1020 Ga0495656_0099334
1021 Ga0495656_0349177
1022 Ga0495656_0439477
1023 Ga0495668_0048513
1024 Ga0495661_0546005
1025 Ga0495647_0280812
1026 Ga0495670_0084511
1027 Ga0495674_0839571
1028 Ga0495626_0191856
1029 Ga0496100_0048204
1030 Ga0496100_0048725
1031 Ga0496100_0879655
1032 Ga0496101_0002140
1033 Ga0496101_0066262
1034 Ga0496101_0790490
1035 Ga0496102_0050760
1036 Ga0496102_0059544
1037 Ga0496102_0153250
1038 Ga0496102_0688500
1039 Ga0496103_0116064
1040 Ga0496103_0433620
1041 Ga0496103_0440170
1042 Ga0496103_0623911
1043 Ga0496104_0010872
1044 Ga0496104_0079007
1045 Ga0496104_1199174
1046 Ga0496104_1601216
1047 Ga0496105_0005348
1048 Ga0496105_0084817
1049 Ga0496105_0183169
1050 Ga0496106_0073624
1051 Ga0496106_0084392
1052 Ga0496106_0151986
1053 Ga0496106_0249297
1054 Ga0496107_0140716
1055 Ga0496107_0659492
1056 Ga0496108_0029351
1057 Ga0496108_0031741
1058 Ga0496108_0191321
1059 Ga0496108_0704370
1060 Ga0496109_0013323
1061 Ga0496109_0028849
1062 Ga0496109_0210717
1063 Ga0496109_0284766
1064 Ga0496110_0011330
1065 Ga0496110_0079415
1066 Ga0496110_0451918
1067 Ga0496110_0933337
1068 Ga0496110_0967840
1069 Ga0496111_0026005
1070 Ga0496111_0057927
1071 Ga0496111_0088139
1072 Ga0496111_0139474
1073 Ga0496112_0032551
1074 Ga0496112_0070880
1075 Ga0496112_0170872
1076 Ga0496112_0220648
1077 Ga0496112_0564491
1078 Ga0496112_1216960
1079 Ga0496113_0007431
1080 Ga0496113_0030888
1081 Ga0496113_0527709
1082 Ga0496114_0054174
1083 Ga0496114_0521019
1084 Ga0496114_1155908
1085 Ga0496115_0338431
1086 Ga0496115_0695320
1087 Ga0496118_0442735
1088 Ga0496119_0183612
1089 Ga0496120_0374993
1090 Ga0496121_0003484
1091 Ga0496121_0037087
1092 Ga0501031_0019210
1093 Ga0501031_0071752
1094 Ga0501032_0020749
1095 Ga0501033_0005225
1096 Ga0501033_0687215
1097 Ga0501034_0004398
1098 Ga0501034_0043956
1099 Ga0501034_0796311
1100 Ga0501036_0040111
1101 Ga0501036_0275022
1102 Ga0501037_0011788
1103 Ga0501038_0020308
1104 Ga0501038_0844064
1105 Ga0501038_1091939
1106 Ga0501039_0007441
1107 Ga0501039_0915375
1108 Ga0501040_0957276
1109 Ga0501041_0112308
1110 Ga0501041_0399924
1111 Ga0501041_0916407
1112 Ga0501042_0101367
1113 Ga0501042_0340034
1114 Ga0501042_0839398
1115 Ga0501043_0025759
1116 Ga0501043_0487160
1117 Ga0501046_0069569
1118 Ga0501047_0076960
1119 Ga0501048_0016983
1120 Ga0501067_0015012
1121 Ga0501069_0013458
1122 Ga0501070_0154241
1123 Ga0501070_0625885
1124 Ga0501071_0299576
1125 Ga0501071_0600654
1126 Ga0501071_1413781
1127 Ga0501072_0101395
1128 Ga0501072_0890277
1129 Ga0501072_1173498
1130 Ga0501073_0004711
1131 Ga0501074_0012746
1132 Ga0501076_0318115
1133 Ga0501079_0118094
1134 Ga0501079_0200155
1135 Ga0501079_0217943
1136 Ga0501080_0026577
1137 Ga0501080_0334681
1138 Ga0501080_0987398
1139 Ga0501083_0012633
1140 Ga0501035_0033781
1141 Ga0501044_0341390
1142 Ga0501045_0085564
1143 nmdc:mga0yw44_134652_c1
1144 nmdc:mga0yw44_246930_c1
1145 nmdc:mga05p37_117678_c1
1146 nmdc:mga05p37_278417_c1
1147 nmdc:mga05p37_635209_c1
1148 nmdc:mga09592_1707846_c1
1149 nmdc:mga09592_19110_c1
1150 nmdc:mga09592_727136_c1
1151 nmdc:mga0qj67_15844_c1
1152 nmdc:mga0qj67_211889_c1
1153 nmdc:mga0qj67_4741_c1
1154 nmdc:mga0qj67_580153_c1
1155 nmdc:mga0qj67_792856_c1
1156 nmdc:mga06r32_28402_c1
1157 nmdc:mga06r32_31863_c1
1158 nmdc:mga06r32_553385_c1
1159 nmdc:mga06r32_56301_c1
1160 nmdc:mga06r32_78012_c1
1161 nmdc:mga06r32_784605_c1
1162 nmdc:mga08y16_338925_c1
1163 nmdc:mga08y16_45474_c1
1164 nmdc:mga0n895_22258_c1
1165 nmdc:mga0n895_774311_c1
1166 nmdc:mga0rr50_61718_c1
1167 nmdc:mga0a205_19929_c1
1168 nmdc:mga0a205_97755_c1
1169 Ga0495655_0028343
1170 Ga0495655_0115540
1171 Ga0495655_0278434
1172 Ga0500616_0002393
1173 Ga0500616_0004025
1174 Ga0500599_004846
1175 Ga0501084_0256106
1176 Ga0501084_0704102
1177 Ga0587106_124879
1178 Ga0501082_0023450
1179 Ga0501082_0281326
1180 Ga0501082_0308784
1181 Ga0466962_0493689
1182 Ga0530510_0575774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

94

157

0.98

PF13240

zinc_ribbon_2

zinc-ribbon domain

4

26

0.94

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

78

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9868 69 159
7rj3-assembly3.cif.gz_C crystal structure of the forkhead associated (fha) domain of the glycogen accumulation regulator (gara) from mycobacterium tuberculosis 0.9841 66 161
6i2p-assembly1.cif.gz_D crystal structure of the mycobacterium tuberculosis pknb kinase domain (l33e mutant) in complex with its substrate gara 0.983 66 161
8p5x-assembly1.cif.gz_G single particle cryo-em structure of the complex between corynebacterium glutamicum homohexameric 2-oxoglutarate dehydrogenase odha and the fha-protein inhibitor odhi 0.9796 66 161
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9731 66 159
ID Description Score Start End Superfamily
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9888 68 159 2.60.200.20
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9575 68 159 2.60.200.20
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.948 67 159 2.60.200.20
3poaA00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9433 66 161 2.60.200.20
af_A6PWD2_8_99_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9338 84 152 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A352W295-F1-model_v4 FHA domain-containing protein 0.9919 67 159
AF-A0A3M1F670-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9895 67 161 GO:0000155
AF-A0A2E3XV40-F1-model_v4 FHA domain-containing protein 0.985 66 159 GO:0016020
AF-A0A2E2EBZ1-F1-model_v4 FHA domain-containing protein 0.9842 66 159
AF-A0A7C5K5H5-F1-model_v4 FHA domain-containing protein 0.9823 67 161 GO:0016020

Map