F467057

General Info

Members Datasets Scaffolds Average Seq Length
591 249 1182 388

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100056590|Ga0307416_1000565902
Length 426
Sequence MILVTTGVPGPRAAEPPTRRVQYDPTDMDRLFTPRFFVMCGFTFTVFLSAFQLLPTAPFHILDLGGSTFASGLFLGFLTYSSAFSAPLTGAFADRIGHRRMLIISSVALAVFAAAYAVISDYRWVLALAIVQGVFWSGLLSASAAYMTQMLPERRRAEGIGYWGLSTMAALSVAPSVGFVIYRYGWVWLCVLAGVLNLVMLGIALSLEEQPTVTAAQGKRSGPLLEWRVLVTSLTLFLYSFGYGGITSFAAMYADASGTTPKGIYLTALAIVVLCTRPFTGHLGDRIGYKRVFVPCLVMISIGLACLAAGGTRFWMLTSALIFGLGFGTAYPNYVGYVMRGVSAERRGAAFGAILAAFDTGIGTGSTSIGWLIQRFGFRGAFAVAAGLSALALPYFLAIDRVHGDGDVKIPSSKLQIPTHPQLPSR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0
Rhizoplane 4.23
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100056590 3300032002 Bacteria 3166
2 rootL2_10258998 3300003322 Unclassified 1488
3 Ga0065712_10003828 3300005290 Unclassified 4233
4 Ga0065712_10095663 3300005290 Bacteria 2211
5 Ga0065712_10096222 3300005290 Bacteria 2191
6 Ga0065715_10000280 3300005293 Bacteria 16864
7 Ga0065715_10003592 3300005293 Bacteria 5437
8 Ga0065715_10011380 3300005293 Bacteria 3661
9 Ga0065715_10101120 3300005293 Bacteria 3234
10 Ga0065715_10133956 3300005293 Bacteria 1963
11 Ga0065715_10202480 3300005293 Bacteria 1354
12 Ga0065707_10032909 3300005295 Bacteria 1536
13 Ga0070676_10017166 3300005328 Bacteria 4004
14 Ga0070676_10049468 3300005328 Unclassified 2461
15 Ga0070683_100019710 3300005329 Bacteria 5993
16 Ga0070683_100045270 3300005329 Bacteria 4061
17 Ga0070690_100039691 3300005330 Bacteria 2975
18 Ga0070670_100012311 3300005331 Bacteria 7321
19 Ga0070670_100016672 3300005331 Bacteria 6305
20 Ga0070670_100021614 3300005331 Bacteria 5533
21 Ga0070670_100189561 3300005331 Bacteria 1786
22 Ga0070666_10029235 3300005335 Bacteria 3621
23 Ga0070680_100270418 3300005336 Unclassified 1439
24 Ga0068868_100041161 3300005338 Bacteria 3599
25 Ga0068868_100064083 3300005338 Bacteria 2917
26 Ga0070660_100282716 3300005339 Unclassified 1358
27 Ga0070689_100032289 3300005340 Bacteria 3982
28 Ga0070691_10019930 3300005341 Bacteria 3096
29 Ga0070691_10093821 3300005341 Unclassified 1483
30 Ga0070687_100093008 3300005343 Bacteria 1672
31 Ga0070661_100023631 3300005344 Unclassified 4407
32 Ga0070668_100078522 3300005347 Bacteria 2582
33 Ga0070669_100003988 3300005353 Bacteria 10672
34 Ga0070669_100013306 3300005353 Bacteria 5848
35 Ga0070669_100016313 3300005353 Bacteria 5299
36 Ga0070675_100006993 3300005354 Bacteria 8669
37 Ga0070675_100021287 3300005354 Bacteria 5181
38 Ga0070675_100061935 3300005354 Bacteria 3091
39 Ga0070671_100027575 3300005355 Bacteria 4675
40 Ga0070674_100047548 3300005356 Bacteria 2941
41 Ga0070673_100014948 3300005364 Bacteria 5433
42 Ga0070673_100045754 3300005364 Bacteria 3396
43 Ga0070688_100014671 3300005365 Bacteria 4443
44 Ga0070703_10017999 3300005406 Bacteria 2039
45 Ga0070701_10003574 3300005438 Bacteria 6176
46 Ga0070701_10005575 3300005438 Bacteria 5212
47 Ga0070701_10122814 3300005438 Unclassified 1465
48 Ga0070705_100002434 3300005440 Bacteria 9354
49 Ga0070705_100007537 3300005440 Bacteria 5359
50 Ga0070705_100037495 3300005440 Bacteria 2735
51 Ga0070705_100043741 3300005440 Bacteria 2569
52 Ga0070705_100068677 3300005440 Bacteria 2134
53 Ga0070694_100010501 3300005444 Bacteria 5715
54 Ga0070678_100033153 3300005456 Bacteria 3582
55 Ga0070662_100054806 3300005457 Bacteria 2890
56 Ga0068867_100009771 3300005459 Bacteria 6760
57 Ga0068867_100106820 3300005459 Bacteria 2145
58 Ga0068867_100124430 3300005459 Bacteria 1996
59 Ga0070685_10082244 3300005466 Bacteria 1932
60 Ga0070706_100006888 3300005467 Bacteria 10726
61 Ga0070706_100153490 3300005467 Unclassified 2150
62 Ga0070707_100010193 3300005468 Bacteria 8749
63 Ga0070707_100239477 3300005468 Unclassified 1766
64 Ga0070707_100262182 3300005468 Bacteria 1681
65 Ga0070698_100017596 3300005471 Bacteria 7532
66 Ga0070698_100021598 3300005471 Bacteria 6741
67 Ga0070698_100192290 3300005471 Bacteria 1978
68 Ga0070698_100269549 3300005471 Bacteria 1634
69 Ga0070699_100002926 3300005518 Bacteria 15182
70 Ga0070699_100034231 3300005518 Bacteria 4391
71 Ga0070699_100076691 3300005518 Bacteria 2910
72 Ga0070679_100088604 3300005530 Bacteria 3082
73 Ga0070684_100001112 3300005535 Bacteria 19287
74 Ga0070684_100012385 3300005535 Bacteria 6833
75 Ga0070697_100007015 3300005536 Bacteria 8758
76 Ga0070697_100042619 3300005536 Bacteria 3673
77 Ga0070697_100141655 3300005536 Unclassified 2022
78 Ga0068853_100189044 3300005539 Unclassified 1870
79 Ga0070672_100151604 3300005543 Bacteria 1918
80 Ga0070672_100237761 3300005543 Bacteria 1531
81 Ga0070672_100306966 3300005543 Bacteria 1346
82 Ga0070686_100053144 3300005544 Bacteria 2585
83 Ga0070695_100003787 3300005545 Bacteria 8819
84 Ga0070695_100016072 3300005545 Unclassified 4525
85 Ga0070695_100096139 3300005545 Bacteria 1987
86 Ga0070696_100016006 3300005546 Bacteria 5043
87 Ga0070696_100026212 3300005546 Bacteria 3965
88 Ga0070696_100035099 3300005546 Bacteria 3451
89 Ga0070665_100039697 3300005548 Bacteria 4733
90 Ga0070665_100287669 3300005548 Bacteria 1646
91 Ga0070704_100041104 3300005549 Bacteria 3189
92 Ga0070704_100047431 3300005549 Bacteria 3003
93 Ga0070704_100093651 3300005549 Bacteria 2245
94 Ga0070704_100127782 3300005549 Unclassified 1964
95 Ga0070704_100217786 3300005549 Bacteria 1550
96 Ga0068855_100132812 3300005563 Bacteria 2842
97 Ga0070664_100017116 3300005564 Bacteria 5950
98 Ga0070664_100017136 3300005564 Bacteria 5948
99 Ga0070664_100096540 3300005564 Unclassified 2565
100 Ga0070664_100168556 3300005564 Bacteria 1941
101 Ga0068857_100008297 3300005577 Bacteria 8975
102 Ga0068854_100029905 3300005578 Unclassified 3775
103 Ga0068854_100035249 3300005578 Bacteria 3500
104 Ga0070702_100001429 3300005615 Bacteria 9751
105 Ga0068859_100025708 3300005617 Bacteria 5904
106 Ga0068859_100062331 3300005617 Bacteria 3759
107 Ga0068864_100004735 3300005618 Bacteria 11145
108 Ga0068861_100010947 3300005719 Bacteria 6302
109 Ga0068861_100062867 3300005719 Bacteria 2852
110 Ga0068861_100216345 3300005719 Bacteria 1617
111 Ga0068863_100001105 3300005841 Bacteria 26956
112 Ga0068863_100041886 3300005841 Bacteria 4353
113 Ga0068863_100356593 3300005841 Bacteria 1425
114 Ga0068862_100011070 3300005844 Bacteria 7451
115 Ga0068862_100055284 3300005844 Bacteria 3400
116 Ga0068862_100063962 3300005844 Bacteria 3166
117 Ga0068862_100076977 3300005844 Bacteria 2888
118 Ga0070717_10053994 3300006028 Unclassified 3313
119 Ga0075365_10043802 3300006038 Bacteria 2930
120 Ga0075365_10049631 3300006038 Bacteria 2765
121 Ga0075364_10004449 3300006051 Bacteria 8065
122 Ga0070712_100176166 3300006175 Bacteria 1663
123 Ga0075362_10000944 3300006177 Bacteria 8873
124 Ga0075367_10029878 3300006178 Bacteria 3120
125 Ga0075366_10031712 3300006195 Bacteria 3111
126 Ga0075366_10049283 3300006195 Bacteria 2499
127 Ga0097621_100036570 3300006237 Bacteria 3929
128 Ga0075428_100002183 3300006844 Bacteria 21181
129 Ga0075428_100002608 3300006844 Bacteria 19614
130 Ga0075428_100005451 3300006844 Bacteria 14143
131 Ga0075428_100017832 3300006844 Bacteria 7845
132 Ga0075428_100030983 3300006844 Bacteria 5914
133 Ga0075428_100056100 3300006844 Bacteria 4316
134 Ga0075428_100383889 3300006844 Bacteria 1506
135 Ga0075430_100001127 3300006846 Bacteria 21273
136 Ga0075430_100007272 3300006846 Bacteria 9349
137 Ga0075430_100032252 3300006846 Bacteria 4448
138 Ga0075430_100214621 3300006846 Bacteria 1597
139 Ga0075431_100002687 3300006847 Bacteria 17235
140 Ga0075431_100010586 3300006847 Bacteria 9274
141 Ga0075431_100094388 3300006847 Bacteria 3087
142 Ga0075431_100229241 3300006847 Bacteria 1893
143 Ga0075431_100345631 3300006847 Bacteria 1496
144 Ga0075433_10018961 3300006852 Bacteria 5726
145 Ga0075433_10020841 3300006852 Bacteria 5487
146 Ga0075433_10027182 3300006852 Bacteria 4850
147 Ga0075433_10034302 3300006852 Bacteria 4357
148 Ga0075433_10057183 3300006852 Bacteria 3409
149 Ga0075433_10085182 3300006852 Unclassified 2790
150 Ga0075433_10089147 3300006852 Bacteria 2727
151 Ga0075433_10101997 3300006852 Bacteria 2541
152 Ga0075434_100000245 3300006871 Bacteria 38029
153 Ga0075434_100022638 3300006871 Bacteria 6118
154 Ga0075434_100405137 3300006871 Bacteria 1385
155 Ga0075429_100002165 3300006880 Bacteria 16399
156 Ga0075429_100007630 3300006880 Bacteria 9395
157 Ga0075429_100018433 3300006880 Bacteria 6047
158 Ga0075429_100036252 3300006880 Unclassified 4289
159 Ga0075429_100119998 3300006880 Bacteria 2298
160 Ga0075429_100223342 3300006880 Bacteria 1650
161 Ga0075436_100020798 3300006914 Bacteria 4502
162 Ga0075436_100051410 3300006914 Bacteria 2844
163 Ga0075436_100094948 3300006914 Bacteria 2074
164 Ga0097620_100025708 3300006931 Bacteria 5904
165 Ga0097620_100062331 3300006931 Bacteria 3759
166 Ga0075435_100002523 3300007076 Bacteria 12183
167 Ga0075435_100052142 3300007076 Unclassified 3297
168 Ga0075435_100052433 3300007076 Unclassified 3288
169 Ga0075435_100085445 3300007076 Bacteria 2597
170 Ga0105240_10038745 3300009093 Bacteria 6111
171 Ga0105240_10228655 3300009093 Bacteria 2163
172 Ga0105240_10242338 3300009093 Bacteria 2090
173 Ga0111539_10000475 3300009094 Bacteria 50635
174 Ga0111539_10017658 3300009094 Bacteria 8831
175 Ga0111539_10041967 3300009094 Bacteria 5496
176 Ga0111539_10069386 3300009094 Unclassified 4162
177 Ga0111539_10075776 3300009094 Bacteria 3962
178 Ga0111539_10442552 3300009094 Bacteria 1513
179 Ga0114129_10000362 3300009147 Bacteria 52441
180 Ga0114129_10000397 3300009147 Bacteria 50837
181 Ga0114129_10000699 3300009147 Bacteria 42232
182 Ga0114129_10000954 3300009147 Bacteria 37759
183 Ga0114129_10001265 3300009147 Bacteria 33730
184 Ga0114129_10003032 3300009147 Bacteria 23551
185 Ga0114129_10008355 3300009147 Bacteria 14756
186 Ga0114129_10021693 3300009147 Bacteria 9114
187 Ga0114129_10031908 3300009147 Bacteria 7448
188 Ga0114129_10069444 3300009147 Bacteria 4911
189 Ga0114129_10112608 3300009147 Bacteria 3752
190 Ga0114129_10135665 3300009147 Bacteria 3377
191 Ga0114129_10142832 3300009147 Unclassified 3280
192 Ga0114129_10167567 3300009147 Bacteria 2996
193 Ga0114129_10453209 3300009147 Unclassified 1682
194 Ga0114129_10549120 3300009147 Bacteria 1503
195 Ga0105243_10029781 3300009148 Bacteria 4200
196 Ga0105243_10054234 3300009148 Bacteria 3182
197 Ga0105243_10070080 3300009148 Bacteria 2830
198 Ga0105243_10208644 3300009148 Bacteria 1719
199 Ga0105242_10012111 3300009176 Bacteria 6636
200 Ga0105248_10023425 3300009177 Bacteria 6859
201 Ga0105248_10053778 3300009177 Bacteria 4517
202 Ga0105248_10065780 3300009177 Bacteria 4070
203 Ga0105248_10167940 3300009177 Unclassified 2473
204 Ga0105248_10175582 3300009177 Unclassified 2415
205 Ga0105249_10005585 3300009553 Bacteria 10875
206 Ga0105249_10018855 3300009553 Bacteria 6149
207 Ga0105249_10079594 3300009553 Bacteria 3042
208 Ga0105249_10092295 3300009553 Bacteria 2834
209 Ga0105249_10265411 3300009553 Bacteria 1708
210 Ga0105249_10297394 3300009553 Unclassified 1618
211 Ga0105249_10299612 3300009553 Bacteria 1612
212 Ga0105246_10057005 3300011119 Bacteria 2702
213 Ga0157378_10230999 3300013297 Bacteria 1763
214 Ga0163162_10054984 3300013306 Bacteria 4006
215 Ga0163163_10043276 3300014325 Unclassified 4414
216 Ga0163163_10303609 3300014325 Bacteria 1649
217 Ga0157380_10003652 3300014326 Bacteria 10582
218 Ga0157380_10013705 3300014326 Bacteria 5919
219 Ga0157380_10099156 3300014326 Bacteria 2422
220 Ga0157380_10331670 3300014326 Unclassified 1415
221 Ga0157377_10057311 3300014745 Bacteria 2215
222 Ga0157376_10036434 3300014969 Bacteria 3985
223 Ga0163161_10076322 3300017792 Bacteria 2460
224 Ga0207697_10000735 3300025315 Bacteria 18598
225 Ga0207688_10004404 3300025901 Bacteria 7665
226 Ga0207680_10038475 3300025903 Bacteria 2768
227 Ga0207645_10001949 3300025907 Bacteria 16633
228 Ga0207684_10001221 3300025910 Bacteria 28592
229 Ga0207684_10030215 3300025910 Bacteria 4614
230 Ga0207684_10246129 3300025910 Bacteria 1543
231 Ga0207695_10184806 3300025913 Bacteria 2004
232 Ga0207695_10256859 3300025913 Bacteria 1646
233 Ga0207660_10225266 3300025917 Unclassified 1473
234 Ga0207652_10148444 3300025921 Bacteria 2099
235 Ga0207646_10200525 3300025922 Unclassified 1802
236 Ga0207646_10233554 3300025922 Bacteria 1662
237 Ga0207681_10022438 3300025923 Bacteria 4026
238 Ga0207681_10071434 3300025923 Unclassified 2421
239 Ga0207681_10103360 3300025923 Bacteria 2059
240 Ga0207681_10125364 3300025923 Bacteria 1890
241 Ga0207650_10012739 3300025925 Bacteria 5808
242 Ga0207650_10050031 3300025925 Bacteria 3088
243 Ga0207650_10115932 3300025925 Bacteria 2080
244 Ga0207650_10134520 3300025925 Bacteria 1938
245 Ga0207659_10000095 3300025926 Bacteria 51635
246 Ga0207659_10041967 3300025926 Bacteria 3205
247 Ga0207659_10042883 3300025926 Bacteria 3174
248 Ga0207659_10058234 3300025926 Bacteria 2773
249 Ga0207687_10124374 3300025927 Bacteria 1934
250 Ga0207690_10249979 3300025932 Unclassified 1369
251 Ga0207706_10084011 3300025933 Bacteria 2799
252 Ga0207706_10129022 3300025933 Unclassified 2224
253 Ga0207670_10063036 3300025936 Bacteria 2535
254 Ga0207670_10094111 3300025936 Bacteria 2125
255 Ga0207670_10112458 3300025936 Bacteria 1965
256 Ga0207669_10034469 3300025937 Bacteria 2869
257 Ga0207669_10136748 3300025937 Bacteria 1694
258 Ga0207691_10002437 3300025940 Bacteria 18199
259 Ga0207691_10048762 3300025940 Bacteria 3881
260 Ga0207691_10050361 3300025940 Bacteria 3813
261 Ga0207691_10161934 3300025940 Bacteria 1962
262 Ga0207711_10065967 3300025941 Bacteria 3130
263 Ga0207711_10077155 3300025941 Bacteria 2904
264 Ga0207689_10110798 3300025942 Bacteria 2256
265 Ga0207689_10167847 3300025942 Bacteria 1808
266 Ga0207661_10014691 3300025944 Bacteria 5744
267 Ga0207661_10084475 3300025944 Unclassified 2629
268 Ga0207661_10109559 3300025944 Bacteria 2333
269 Ga0207679_10131842 3300025945 Bacteria 2006
270 Ga0207679_10294933 3300025945 Bacteria 1395
271 Ga0207651_10096783 3300025960 Bacteria 2178
272 Ga0207651_10163729 3300025960 Bacteria 1746
273 Ga0207712_10138669 3300025961 Eukaryota 1863
274 Ga0207640_10178366 3300025981 Unclassified 1590
275 Ga0207658_10293542 3300025986 Bacteria 1398
276 Ga0207677_10044378 3300026023 Bacteria 2961
277 Ga0207708_10000958 3300026075 Bacteria 21623
278 Ga0207708_10005135 3300026075 Bacteria 9658
279 Ga0207708_10219711 3300026075 Bacteria 1522
280 Ga0207641_10002161 3300026088 Bacteria 18517
281 Ga0207641_10140078 3300026088 Bacteria 2181
282 Ga0207648_10002478 3300026089 Bacteria 19816
283 Ga0207648_10115538 3300026089 Bacteria 2358
284 Ga0207676_10007776 3300026095 Bacteria 7623
285 Ga0207676_10083178 3300026095 Bacteria 2606
286 Ga0207674_10012461 3300026116 Bacteria 9501
287 Ga0207674_10019062 3300026116 Bacteria 7435
288 Ga0207675_100009586 3300026118 Bacteria 9058
289 Ga0207675_100017067 3300026118 Bacteria 6781
290 Ga0207675_100060548 3300026118 Bacteria 3535
291 Ga0207683_10046562 3300026121 Bacteria 3796
292 Ga0207683_10167621 3300026121 Unclassified 1988
293 Ga0207683_10169514 3300026121 Bacteria 1977
294 Ga0207428_10003529 3300027907 Bacteria 15138
295 Ga0207428_10022658 3300027907 Bacteria 5297
296 Ga0207428_10034018 3300027907 Bacteria 4179
297 Ga0268266_10045570 3300028379 Bacteria 3752
298 Ga0268265_10009810 3300028380 Bacteria 6463
299 Ga0268265_10055735 3300028380 Bacteria 3004
300 Ga0268265_10081325 3300028380 Bacteria 2558
301 Ga0268265_10094416 3300028380 Bacteria 2399
302 Ga0268265_10165191 3300028380 Unclassified 1886
303 Ga0307408_100014691 3300031548 Bacteria 5204
304 Ga0307408_100030402 3300031548 Bacteria 3750
305 Ga0307408_100319351 3300031548 Bacteria 1308
306 Ga0307405_10004150 3300031731 Bacteria 6814
307 Ga0307405_10088046 3300031731 Bacteria 2048
308 Ga0307413_10026798 3300031824 Bacteria 3182
309 Ga0307410_10034128 3300031852 Bacteria 3291
310 Ga0307410_10061283 3300031852 Bacteria 2574
311 Ga0307410_10103987 3300031852 Bacteria 2041
312 Ga0307406_10034118 3300031901 Bacteria 3120
313 Ga0307406_10108156 3300031901 Bacteria 1908
314 Ga0307406_10204017 3300031901 Bacteria 1458
315 Ga0307407_10023292 3300031903 Bacteria 3229
316 Ga0307407_10049961 3300031903 Bacteria 2390
317 Ga0307407_10065861 3300031903 Bacteria 2135
318 Ga0307412_10164953 3300031911 Bacteria 1651
319 Ga0307409_100012796 3300031995 Bacteria 5364
320 Ga0307409_100082641 3300031995 Bacteria 2601
321 Ga0307409_100318595 3300031995 Bacteria 1454
322 Ga0307416_100028002 3300032002 Unclassified 4183
323 Ga0307416_100088591 3300032002 Bacteria 2647
324 Ga0307416_100094081 3300032002 Bacteria 2583
325 Ga0307416_100333097 3300032002 Bacteria 1526
326 Ga0307414_10035626 3300032004 Bacteria 3314
327 Ga0307414_10184372 3300032004 Bacteria 1682
328 Ga0307411_10004853 3300032005 Bacteria 6525
329 Ga0307411_10042174 3300032005 Unclassified 2909
330 Ga0307411_10119980 3300032005 Unclassified 1900
331 Ga0307415_100117622 3300032126 Bacteria 1985
332 Ga0373930_0000660 3300034816 Bacteria 4822
333 Ga0373958_0005499 3300034819 Bacteria 1928
334 Ga0373959_0001526 3300034820 Bacteria 3688
335 Ga0373938_0000491 3300034957 Bacteria 6373
336 Ga0373928_0003325 3300035084 Bacteria 3073
337 Ga0373929_0001632 3300035085 Bacteria 4255
338 Ga0373940_0000991 3300035088 Bacteria 4847
339 Ga0373949_0005458 3300035090 Bacteria 2834
340 Ga0373951_0001033 3300035091 Bacteria 7492
341 Ga0373952_0001899 3300035092 Bacteria 3792
342 Ga0373932_0000671 3300035112 Bacteria 10379
343 Ga0373939_0001816 3300035114 Bacteria 5139
344 Ga0373941_0042779 3300035115 Bacteria 1407
345 Ga0373942_0007334 3300035207 Bacteria 2555
346 Ga0373962_0001629 3300035242 Bacteria 5331
347 Ga0373931_0000904 3300035691 Bacteria 12543
348 Ga0373933_0051171 3300035724 Unclassified 2468
349 Ga0373937_0059949 3300036401 Unclassified 3497
350 Ga0373925_0043660 3300037068 Unclassified 3328
351 Ga0436365_1653031 3300039437 Bacteria 1884
352 Ga0439439_0020461 3300041406 Bacteria 1646
353 Ga0439439_0041304 3300041406 Unclassified 1196
354 Ga0451845_0323140 3300041501 Bacteria 1721
355 Ga0439450_022628 3300042008 Archaea 1358
356 Ga0439457_036270 3300042014 Bacteria 1097
357 Ga0450920_008212 3300042122 Unclassified 1905
358 Ga0450923_004079 3300042125 Bacteria 2268
359 Ga0439446_0012261 3300042156 Unclassified 2340
360 Ga0439434_0029031 3300042435 Unclassified 1677
361 Ga0439435_0000475 3300042436 Bacteria 6364
362 Ga0439464_0042606 3300042439 Archaea 1296
363 Ga0439460_0039499 3300042461 Bacteria 1380
364 Ga0450918_001234 3300042531 Bacteria 5195
365 Ga0451577_0034348 3300042876 Bacteria 4571
366 Ga0453684_0269480 3300044712 Unclassified 1946
367 Ga0451576_0017555 3300045051 Bacteria 7864
368 Ga0495592_0008565 3300046454 Bacteria 7678
369 Ga0495603_0143812 3300046455 Archaea 1387
370 Ga0495635_0051103 3300046663 Bacteria 2849
371 Ga0495647_0010819 3300046681 Bacteria 3116
372 Ga0495613_0152930 3300046689 Unclassified 1645
373 Ga0495600_0034609 3300046809 Bacteria 3280
374 Ga0495672_0019107 3300047320 Bacteria 4530
375 Ga0496100_0099666 3300048903 Bacteria 2000
376 Ga0496102_0056905 3300048905 Bacteria 3568
377 Ga0496104_0228766 3300048907 Bacteria 1772
378 Ga0496104_0306612 3300048907 Bacteria 1500
379 Ga0496105_0097772 3300048908 Bacteria 2424
380 Ga0496106_0053544 3300048909 Bacteria 3048
381 Ga0496106_0061805 3300048909 Bacteria 2843
382 Ga0496107_0057488 3300048910 Bacteria 2812
383 Ga0496107_0132053 3300048910 Bacteria 1844
384 Ga0496107_0204334 3300048910 Bacteria 1468
385 Ga0496108_0001915 3300048911 Bacteria 16654
386 Ga0496108_0076543 3300048911 Bacteria 2828
387 Ga0496109_0001928 3300048912 Bacteria 17237
388 Ga0496109_0003251 3300048912 Bacteria 13544
389 Ga0496109_0009607 3300048912 Bacteria 8249
390 Ga0496110_0017910 3300048913 Bacteria 5931
391 Ga0496110_0108679 3300048913 Bacteria 2490
392 Ga0496111_0051350 3300048914 Bacteria 2976
393 Ga0496111_0182335 3300048914 Bacteria 1561
394 Ga0496112_0002916 3300048915 Bacteria 13928
395 Ga0496112_0067014 3300048915 Bacteria 3542
396 Ga0496112_0099769 3300048915 Bacteria 2874
397 Ga0496112_0208882 3300048915 Bacteria 1910
398 Ga0496113_0192590 3300048916 Bacteria 1618
399 Ga0496114_0113439 3300048917 Bacteria 2323
400 Ga0501031_0005370 3300049568 Bacteria 8344
401 Ga0501031_0134005 3300049568 Unclassified 1618
402 Ga0501032_0045434 3300049569 Bacteria 2970
403 Ga0501032_0058836 3300049569 Bacteria 2579
404 Ga0501033_0000470 3300049570 Bacteria 38120
405 Ga0501033_0013095 3300049570 Bacteria 6320
406 Ga0501034_0011879 3300049571 Bacteria 9009
407 Ga0501034_0087523 3300049571 Bacteria 3114
408 Ga0501034_0349754 3300049571 Bacteria 1406
409 Ga0501036_0003509 3300049572 Bacteria 12537
410 Ga0501036_0015359 3300049572 Bacteria 6393
411 Ga0501036_0074725 3300049572 Bacteria 2866
412 Ga0501036_0163602 3300049572 Unclassified 1876
413 Ga0501036_0171824 3300049572 Bacteria 1826
414 Ga0501037_0003311 3300049573 Bacteria 11705
415 Ga0501038_0002813 3300049574 Bacteria 16211
416 Ga0501038_0045979 3300049574 Bacteria 3786
417 Ga0501039_0006693 3300049575 Bacteria 8764
418 Ga0501040_0021001 3300049576 Bacteria 4355
419 Ga0501040_0048318 3300049576 Bacteria 2908
420 Ga0501040_0102904 3300049576 Bacteria 1993
421 Ga0501042_0039482 3300049578 Bacteria 3354
422 Ga0501042_0075624 3300049578 Unclassified 2410
423 Ga0501042_0096284 3300049578 Bacteria 2126
424 Ga0501043_0019849 3300049579 Bacteria 5277
425 Ga0501043_0033512 3300049579 Bacteria 4041
426 Ga0501046_0007922 3300049580 Bacteria 9300
427 Ga0501046_0047405 3300049580 Bacteria 3406
428 Ga0501046_0112674 3300049580 Unclassified 2077
429 Ga0501047_0041137 3300049581 Bacteria 4466
430 Ga0501048_0003562 3300049582 Bacteria 11849
431 Ga0501048_0012477 3300049582 Bacteria 6321
432 Ga0501048_0023981 3300049582 Bacteria 4454
433 Ga0501067_0006168 3300049583 Bacteria 6643
434 Ga0501067_0012816 3300049583 Bacteria 4643
435 Ga0501067_0023927 3300049583 Bacteria 3387
436 Ga0501067_0038534 3300049583 Bacteria 2653
437 Ga0501068_0002188 3300049584 Bacteria 10416
438 Ga0501068_0062412 3300049584 Bacteria 2266
439 Ga0501069_0003549 3300049585 Bacteria 8030
440 Ga0501069_0014805 3300049585 Bacteria 4174
441 Ga0501069_0058693 3300049585 Unclassified 2146
442 Ga0501070_0015572 3300049586 Bacteria 6393
443 Ga0501070_0046574 3300049586 Bacteria 3605
444 Ga0501071_0002703 3300049587 Bacteria 10870
445 Ga0501071_0046474 3300049587 Unclassified 3118
446 Ga0501071_0094689 3300049587 Unclassified 2197
447 Ga0501071_0230350 3300049587 Bacteria 1395
448 Ga0501072_0019181 3300049588 Bacteria 5283
449 Ga0501072_0022890 3300049588 Bacteria 4849
450 Ga0501072_0025827 3300049588 Bacteria 4577
451 Ga0501072_0077463 3300049588 Unclassified 2632
452 Ga0501072_0154472 3300049588 Bacteria 1830
453 Ga0501072_0244308 3300049588 Bacteria 1430
454 Ga0501073_0009143 3300049589 Bacteria 7310
455 Ga0501073_0010508 3300049589 Bacteria 6783
456 Ga0501073_0035442 3300049589 Bacteria 3547
457 Ga0501073_0041889 3300049589 Bacteria 3234
458 Ga0501074_0016534 3300049590 Bacteria 5355
459 Ga0501075_0009621 3300049591 Bacteria 6767
460 Ga0501075_0026913 3300049591 Bacteria 4236
461 Ga0501075_0066996 3300049591 Unclassified 2710
462 Ga0501075_0119712 3300049591 Unclassified 2003
463 Ga0501076_0043219 3300049592 Bacteria 3550
464 Ga0501076_0060627 3300049592 Unclassified 3010
465 Ga0501076_0131579 3300049592 Bacteria 2029
466 Ga0501077_0097652 3300049593 Bacteria 1862
467 Ga0501077_0101705 3300049593 Bacteria 1821
468 Ga0501077_0163883 3300049593 Archaea 1412
469 Ga0501216_017388 3300049660 Bacteria 1229
470 Ga0501225_0010580 3300049705 Bacteria 2612
471 Ga0501079_0006173 3300049741 Bacteria 8986
472 Ga0501079_0027164 3300049741 Bacteria 4387
473 Ga0501079_0049011 3300049741 Bacteria 3260
474 Ga0501079_0093030 3300049741 Bacteria 2336
475 Ga0501079_0134523 3300049741 Bacteria 1924
476 Ga0501079_0355771 3300049741 Bacteria 1147
477 Ga0501080_0035059 3300049742 Bacteria 4684
478 Ga0501080_0065114 3300049742 Unclassified 3391
479 Ga0501080_0097437 3300049742 Bacteria 2730
480 Ga0501080_0124199 3300049742 Bacteria 2391
481 Ga0501080_0233717 3300049742 Unclassified 1680
482 Ga0501081_0031735 3300049743 Bacteria 3581
483 Ga0501081_0210638 3300049743 Bacteria 1411
484 Ga0501083_0036700 3300049744 Bacteria 3341
485 Ga0501083_0061204 3300049744 Bacteria 2513
486 Ga0501083_0115489 3300049744 Bacteria 1763
487 Ga0501083_0166242 3300049744 Bacteria 1442
488 Ga0501035_0001474 3300049822 Bacteria 24086
489 Ga0501035_0167947 3300049822 Bacteria 1896
490 Ga0501044_0099611 3300049823 Bacteria 2924
491 Ga0501045_0003720 3300049824 Bacteria 10495
492 Ga0501045_0009407 3300049824 Bacteria 6835
493 Ga0501045_0022158 3300049824 Bacteria 4546
494 Ga0501045_0072828 3300049824 Bacteria 2529
495 Ga0501045_0136709 3300049824 Bacteria 1822
496 nmdc:mga00v17_147938_c1 3300050491 Unclassified 1508
497 nmdc:mga00v17_3255_c1 3300050491 Bacteria 8111
498 nmdc:mga00v17_5842_c1 3300050491 Bacteria 6498
499 nmdc:mga0yw44_14709_c1 3300050492 Bacteria 4165
500 nmdc:mga0yw44_154417_c1 3300050492 Archaea 1499
501 nmdc:mga0k408_15009_c1 3300050493 Bacteria 4280
502 nmdc:mga0k408_84150_c1 3300050493 Bacteria 1866
503 nmdc:mga07m45_8340_c2 3300050496 Unclassified 4192
504 nmdc:mga05p37_115445_c1 3300050507 Unclassified 3301
505 nmdc:mga05p37_11567_c1 3300050507 Bacteria 10514
506 nmdc:mga05p37_187156_c1 3300050507 Bacteria 2517
507 nmdc:mga05p37_187770_c1 3300050507 Bacteria 2512
508 nmdc:mga05p37_1886_c1 3300050507 Bacteria 24426
509 nmdc:mga05p37_21596_c1 3300050507 Bacteria 7799
510 nmdc:mga05p37_23840_c1 3300050507 Bacteria 7431
511 nmdc:mga05p37_266668_c1 3300050507 Bacteria 2047
512 nmdc:mga05p37_355835_c1 3300050507 Bacteria 1723
513 nmdc:mga05p37_377226_c1 3300050507 Bacteria 1663
514 nmdc:mga05p37_395103_c1 3300050507 Bacteria 1616
515 nmdc:mga05p37_415_c1 3300050507 Bacteria 46056
516 nmdc:mga05p37_45736_c1 3300050507 Bacteria 5382
517 nmdc:mga05p37_464810_c1 3300050507 Unclassified 1461
518 nmdc:mga05p37_85052_c1 3300050507 Unclassified 3897
519 nmdc:mga05p37_8794_c1 3300050507 Bacteria 11933
520 nmdc:mga05p37_91506_c1 3300050507 Bacteria 3748
521 nmdc:mga09592_1775_c1 3300050508 Bacteria 17335
522 nmdc:mga09592_72372_c1 3300050508 Bacteria 2927
523 nmdc:mga0qj67_20501_c1 3300050509 Bacteria 5062
524 nmdc:mga0qj67_2583_c1 3300050509 Bacteria 12950
525 nmdc:mga0qj67_29684_c1 3300050509 Bacteria 4248
526 nmdc:mga0qj67_41706_c1 3300050509 Unclassified 3611
527 nmdc:mga0qj67_5207_c1 3300050509 Bacteria 9496
528 nmdc:mga0qj67_8583_c1 3300050509 Bacteria 7580
529 nmdc:mga06r32_102757_c1 3300050510 Bacteria 2806
530 nmdc:mga06r32_19574_c1 3300050510 Bacteria 6215
531 nmdc:mga06r32_19725_c1 3300050510 Bacteria 6195
532 nmdc:mga06r32_202848_c1 3300050510 Unclassified 1971
533 nmdc:mga06r32_2407_c2 3300050510 Bacteria 11658
534 nmdc:mga06r32_25845_c1 3300050510 Bacteria 5466
535 nmdc:mga06r32_35530_c1 3300050510 Bacteria 4702
536 nmdc:mga06r32_40767_c1 3300050510 Unclassified 4409
537 nmdc:mga06r32_94661_c1 3300050510 Unclassified 2923
538 nmdc:mga08y16_12774_c1 3300050511 Bacteria 8837
539 nmdc:mga08y16_140910_c1 3300050511 Unclassified 2507
540 nmdc:mga08y16_22779_c1 3300050511 Bacteria 6611
541 nmdc:mga08y16_27738_c1 3300050511 Bacteria 5967
542 nmdc:mga08y16_294480_c1 3300050511 Unclassified 1673
543 nmdc:mga08y16_302440_c1 3300050511 Unclassified 1649
544 nmdc:mga08y16_4428_c1 3300050511 Bacteria 14675
545 nmdc:mga08y16_513234_c1 3300050511 Bacteria 1216
546 nmdc:mga08y16_66074_c1 3300050511 Bacteria 3774
547 nmdc:mga08y16_712_c1 3300050511 Bacteria 31560
548 nmdc:mga0n895_100168_c1 3300050512 Bacteria 2906
549 nmdc:mga0n895_181443_c1 3300050512 Unclassified 2136
550 nmdc:mga0n895_25315_c1 3300050512 Bacteria 5605
551 nmdc:mga0n895_25649_c1 3300050512 Bacteria 5573
552 nmdc:mga0n895_29555_c1 3300050512 Bacteria 5229
553 nmdc:mga0rr50_136122_c1 3300050513 Unclassified 1972
554 nmdc:mga0rr50_138815_c1 3300050513 Bacteria 1954
555 nmdc:mga0rr50_21054_c1 3300050513 Bacteria 4444
556 nmdc:mga08x19_14498_c1 3300050514 Bacteria 4780
557 nmdc:mga0a205_118319_c1 3300050515 Unclassified 2548
558 nmdc:mga0a205_13655_c1 3300050515 Bacteria 7567
559 nmdc:mga0a205_143502_c1 3300050515 Bacteria 2288
560 nmdc:mga0a205_173204_c1 3300050515 Bacteria 2054
561 nmdc:mga0a205_4337_c1 3300050515 Bacteria 12717
562 nmdc:mga0a205_48994_c1 3300050515 Bacteria 4078
563 nmdc:mga0a205_63141_c1 3300050515 Bacteria 3578
564 nmdc:mga0a205_69825_c1 3300050515 Unclassified 3392
565 nmdc:mga0a205_84097_c1 3300050515 Bacteria 2093
566 nmdc:mga0a205_98128_c1 3300050515 Bacteria 2828
567 Ga0495601_0011545 3300053077 Bacteria 5291
568 Ga0495619_0009298 3300053085 Bacteria 6205
569 Ga0500556_0028732 3300053104 Bacteria 1868
570 Ga0500628_020727 3300053129 Bacteria 1325
571 Ga0501084_0001776 3300054114 Bacteria 17163
572 Ga0501084_0039692 3300054114 Bacteria 3937
573 Ga0501084_0109747 3300054114 Archaea 2318
574 Ga0501084_0134250 3300054114 Bacteria 2083
575 Ga0501084_0284126 3300054114 Bacteria 1397
576 Ga0590071_000099 3300059421 Bacteria 24341
577 Ga0590071_000365 3300059421 Bacteria 13366
578 Ga0590071_003786 3300059421 Unclassified 3713
579 Ga0590071_007910 3300059421 Bacteria 2513
580 Ga0590074_000331 3300059423 Bacteria 6565
581 Ga0590074_002085 3300059423 Unclassified 3271
582 Ga0590075_000144 3300059424 Bacteria 18953
583 Ga0590075_001380 3300059424 Bacteria 6087
584 Ga0590077_002109 3300059426 Bacteria 4348
585 Ga0590077_002809 3300059426 Bacteria 3664
586 Ga0590077_003521 3300059426 Bacteria 3241
587 Ga0590077_004046 3300059426 Bacteria 3018
588 Ga0590077_004875 3300059426 Bacteria 2744
589 Ga0501082_0002812 3300060353 Bacteria 15187
590 Ga0501082_0044756 3300060353 Bacteria 3817
591 Ga0530510_0137246 3300061734 Bacteria 1801
592 Ga0307416_100056590
593 rootL2_10258998
594 Ga0065712_10003828
595 Ga0065712_10095663
596 Ga0065712_10096222
597 Ga0065715_10000280
598 Ga0065715_10003592
599 Ga0065715_10011380
600 Ga0065715_10101120
601 Ga0065715_10133956
602 Ga0065715_10202480
603 Ga0065707_10032909
604 Ga0070676_10017166
605 Ga0070676_10049468
606 Ga0070683_100019710
607 Ga0070683_100045270
608 Ga0070690_100039691
609 Ga0070670_100012311
610 Ga0070670_100016672
611 Ga0070670_100021614
612 Ga0070670_100189561
613 Ga0070666_10029235
614 Ga0070680_100270418
615 Ga0068868_100041161
616 Ga0068868_100064083
617 Ga0070660_100282716
618 Ga0070689_100032289
619 Ga0070691_10019930
620 Ga0070691_10093821
621 Ga0070687_100093008
622 Ga0070661_100023631
623 Ga0070668_100078522
624 Ga0070669_100003988
625 Ga0070669_100013306
626 Ga0070669_100016313
627 Ga0070675_100006993
628 Ga0070675_100021287
629 Ga0070675_100061935
630 Ga0070671_100027575
631 Ga0070674_100047548
632 Ga0070673_100014948
633 Ga0070673_100045754
634 Ga0070688_100014671
635 Ga0070703_10017999
636 Ga0070701_10003574
637 Ga0070701_10005575
638 Ga0070701_10122814
639 Ga0070705_100002434
640 Ga0070705_100007537
641 Ga0070705_100037495
642 Ga0070705_100043741
643 Ga0070705_100068677
644 Ga0070694_100010501
645 Ga0070678_100033153
646 Ga0070662_100054806
647 Ga0068867_100009771
648 Ga0068867_100106820
649 Ga0068867_100124430
650 Ga0070685_10082244
651 Ga0070706_100006888
652 Ga0070706_100153490
653 Ga0070707_100010193
654 Ga0070707_100239477
655 Ga0070707_100262182
656 Ga0070698_100017596
657 Ga0070698_100021598
658 Ga0070698_100192290
659 Ga0070698_100269549
660 Ga0070699_100002926
661 Ga0070699_100034231
662 Ga0070699_100076691
663 Ga0070679_100088604
664 Ga0070684_100001112
665 Ga0070684_100012385
666 Ga0070697_100007015
667 Ga0070697_100042619
668 Ga0070697_100141655
669 Ga0068853_100189044
670 Ga0070672_100151604
671 Ga0070672_100237761
672 Ga0070672_100306966
673 Ga0070686_100053144
674 Ga0070695_100003787
675 Ga0070695_100016072
676 Ga0070695_100096139
677 Ga0070696_100016006
678 Ga0070696_100026212
679 Ga0070696_100035099
680 Ga0070665_100039697
681 Ga0070665_100287669
682 Ga0070704_100041104
683 Ga0070704_100047431
684 Ga0070704_100093651
685 Ga0070704_100127782
686 Ga0070704_100217786
687 Ga0068855_100132812
688 Ga0070664_100017116
689 Ga0070664_100017136
690 Ga0070664_100096540
691 Ga0070664_100168556
692 Ga0068857_100008297
693 Ga0068854_100029905
694 Ga0068854_100035249
695 Ga0070702_100001429
696 Ga0068859_100025708
697 Ga0068859_100062331
698 Ga0068864_100004735
699 Ga0068861_100010947
700 Ga0068861_100062867
701 Ga0068861_100216345
702 Ga0068863_100001105
703 Ga0068863_100041886
704 Ga0068863_100356593
705 Ga0068862_100011070
706 Ga0068862_100055284
707 Ga0068862_100063962
708 Ga0068862_100076977
709 Ga0070717_10053994
710 Ga0075365_10043802
711 Ga0075365_10049631
712 Ga0075364_10004449
713 Ga0070712_100176166
714 Ga0075362_10000944
715 Ga0075367_10029878
716 Ga0075366_10031712
717 Ga0075366_10049283
718 Ga0097621_100036570
719 Ga0075428_100002183
720 Ga0075428_100002608
721 Ga0075428_100005451
722 Ga0075428_100017832
723 Ga0075428_100030983
724 Ga0075428_100056100
725 Ga0075428_100383889
726 Ga0075430_100001127
727 Ga0075430_100007272
728 Ga0075430_100032252
729 Ga0075430_100214621
730 Ga0075431_100002687
731 Ga0075431_100010586
732 Ga0075431_100094388
733 Ga0075431_100229241
734 Ga0075431_100345631
735 Ga0075433_10018961
736 Ga0075433_10020841
737 Ga0075433_10027182
738 Ga0075433_10034302
739 Ga0075433_10057183
740 Ga0075433_10085182
741 Ga0075433_10089147
742 Ga0075433_10101997
743 Ga0075434_100000245
744 Ga0075434_100022638
745 Ga0075434_100405137
746 Ga0075429_100002165
747 Ga0075429_100007630
748 Ga0075429_100018433
749 Ga0075429_100036252
750 Ga0075429_100119998
751 Ga0075429_100223342
752 Ga0075436_100020798
753 Ga0075436_100051410
754 Ga0075436_100094948
755 Ga0097620_100025708
756 Ga0097620_100062331
757 Ga0075435_100002523
758 Ga0075435_100052142
759 Ga0075435_100052433
760 Ga0075435_100085445
761 Ga0105240_10038745
762 Ga0105240_10228655
763 Ga0105240_10242338
764 Ga0111539_10000475
765 Ga0111539_10017658
766 Ga0111539_10041967
767 Ga0111539_10069386
768 Ga0111539_10075776
769 Ga0111539_10442552
770 Ga0114129_10000362
771 Ga0114129_10000397
772 Ga0114129_10000699
773 Ga0114129_10000954
774 Ga0114129_10001265
775 Ga0114129_10003032
776 Ga0114129_10008355
777 Ga0114129_10021693
778 Ga0114129_10031908
779 Ga0114129_10069444
780 Ga0114129_10112608
781 Ga0114129_10135665
782 Ga0114129_10142832
783 Ga0114129_10167567
784 Ga0114129_10453209
785 Ga0114129_10549120
786 Ga0105243_10029781
787 Ga0105243_10054234
788 Ga0105243_10070080
789 Ga0105243_10208644
790 Ga0105242_10012111
791 Ga0105248_10023425
792 Ga0105248_10053778
793 Ga0105248_10065780
794 Ga0105248_10167940
795 Ga0105248_10175582
796 Ga0105249_10005585
797 Ga0105249_10018855
798 Ga0105249_10079594
799 Ga0105249_10092295
800 Ga0105249_10265411
801 Ga0105249_10297394
802 Ga0105249_10299612
803 Ga0105246_10057005
804 Ga0157378_10230999
805 Ga0163162_10054984
806 Ga0163163_10043276
807 Ga0163163_10303609
808 Ga0157380_10003652
809 Ga0157380_10013705
810 Ga0157380_10099156
811 Ga0157380_10331670
812 Ga0157377_10057311
813 Ga0157376_10036434
814 Ga0163161_10076322
815 Ga0207697_10000735
816 Ga0207688_10004404
817 Ga0207680_10038475
818 Ga0207645_10001949
819 Ga0207684_10001221
820 Ga0207684_10030215
821 Ga0207684_10246129
822 Ga0207695_10184806
823 Ga0207695_10256859
824 Ga0207660_10225266
825 Ga0207652_10148444
826 Ga0207646_10200525
827 Ga0207646_10233554
828 Ga0207681_10022438
829 Ga0207681_10071434
830 Ga0207681_10103360
831 Ga0207681_10125364
832 Ga0207650_10012739
833 Ga0207650_10050031
834 Ga0207650_10115932
835 Ga0207650_10134520
836 Ga0207659_10000095
837 Ga0207659_10041967
838 Ga0207659_10042883
839 Ga0207659_10058234
840 Ga0207687_10124374
841 Ga0207690_10249979
842 Ga0207706_10084011
843 Ga0207706_10129022
844 Ga0207670_10063036
845 Ga0207670_10094111
846 Ga0207670_10112458
847 Ga0207669_10034469
848 Ga0207669_10136748
849 Ga0207691_10002437
850 Ga0207691_10048762
851 Ga0207691_10050361
852 Ga0207691_10161934
853 Ga0207711_10065967
854 Ga0207711_10077155
855 Ga0207689_10110798
856 Ga0207689_10167847
857 Ga0207661_10014691
858 Ga0207661_10084475
859 Ga0207661_10109559
860 Ga0207679_10131842
861 Ga0207679_10294933
862 Ga0207651_10096783
863 Ga0207651_10163729
864 Ga0207712_10138669
865 Ga0207640_10178366
866 Ga0207658_10293542
867 Ga0207677_10044378
868 Ga0207708_10000958
869 Ga0207708_10005135
870 Ga0207708_10219711
871 Ga0207641_10002161
872 Ga0207641_10140078
873 Ga0207648_10002478
874 Ga0207648_10115538
875 Ga0207676_10007776
876 Ga0207676_10083178
877 Ga0207674_10012461
878 Ga0207674_10019062
879 Ga0207675_100009586
880 Ga0207675_100017067
881 Ga0207675_100060548
882 Ga0207683_10046562
883 Ga0207683_10167621
884 Ga0207683_10169514
885 Ga0207428_10003529
886 Ga0207428_10022658
887 Ga0207428_10034018
888 Ga0268266_10045570
889 Ga0268265_10009810
890 Ga0268265_10055735
891 Ga0268265_10081325
892 Ga0268265_10094416
893 Ga0268265_10165191
894 Ga0307408_100014691
895 Ga0307408_100030402
896 Ga0307408_100319351
897 Ga0307405_10004150
898 Ga0307405_10088046
899 Ga0307413_10026798
900 Ga0307410_10034128
901 Ga0307410_10061283
902 Ga0307410_10103987
903 Ga0307406_10034118
904 Ga0307406_10108156
905 Ga0307406_10204017
906 Ga0307407_10023292
907 Ga0307407_10049961
908 Ga0307407_10065861
909 Ga0307412_10164953
910 Ga0307409_100012796
911 Ga0307409_100082641
912 Ga0307409_100318595
913 Ga0307416_100028002
914 Ga0307416_100088591
915 Ga0307416_100094081
916 Ga0307416_100333097
917 Ga0307414_10035626
918 Ga0307414_10184372
919 Ga0307411_10004853
920 Ga0307411_10042174
921 Ga0307411_10119980
922 Ga0307415_100117622
923 Ga0373930_0000660
924 Ga0373958_0005499
925 Ga0373959_0001526
926 Ga0373938_0000491
927 Ga0373928_0003325
928 Ga0373929_0001632
929 Ga0373940_0000991
930 Ga0373949_0005458
931 Ga0373951_0001033
932 Ga0373952_0001899
933 Ga0373932_0000671
934 Ga0373939_0001816
935 Ga0373941_0042779
936 Ga0373942_0007334
937 Ga0373962_0001629
938 Ga0373931_0000904
939 Ga0373933_0051171
940 Ga0373937_0059949
941 Ga0373925_0043660
942 Ga0436365_1653031
943 Ga0439439_0020461
944 Ga0439439_0041304
945 Ga0451845_0323140
946 Ga0439450_022628
947 Ga0439457_036270
948 Ga0450920_008212
949 Ga0450923_004079
950 Ga0439446_0012261
951 Ga0439434_0029031
952 Ga0439435_0000475
953 Ga0439464_0042606
954 Ga0439460_0039499
955 Ga0450918_001234
956 Ga0451577_0034348
957 Ga0453684_0269480
958 Ga0451576_0017555
959 Ga0495592_0008565
960 Ga0495603_0143812
961 Ga0495635_0051103
962 Ga0495647_0010819
963 Ga0495613_0152930
964 Ga0495600_0034609
965 Ga0495672_0019107
966 Ga0496100_0099666
967 Ga0496102_0056905
968 Ga0496104_0228766
969 Ga0496104_0306612
970 Ga0496105_0097772
971 Ga0496106_0053544
972 Ga0496106_0061805
973 Ga0496107_0057488
974 Ga0496107_0132053
975 Ga0496107_0204334
976 Ga0496108_0001915
977 Ga0496108_0076543
978 Ga0496109_0001928
979 Ga0496109_0003251
980 Ga0496109_0009607
981 Ga0496110_0017910
982 Ga0496110_0108679
983 Ga0496111_0051350
984 Ga0496111_0182335
985 Ga0496112_0002916
986 Ga0496112_0067014
987 Ga0496112_0099769
988 Ga0496112_0208882
989 Ga0496113_0192590
990 Ga0496114_0113439
991 Ga0501031_0005370
992 Ga0501031_0134005
993 Ga0501032_0045434
994 Ga0501032_0058836
995 Ga0501033_0000470
996 Ga0501033_0013095
997 Ga0501034_0011879
998 Ga0501034_0087523
999 Ga0501034_0349754
1000 Ga0501036_0003509
1001 Ga0501036_0015359
1002 Ga0501036_0074725
1003 Ga0501036_0163602
1004 Ga0501036_0171824
1005 Ga0501037_0003311
1006 Ga0501038_0002813
1007 Ga0501038_0045979
1008 Ga0501039_0006693
1009 Ga0501040_0021001
1010 Ga0501040_0048318
1011 Ga0501040_0102904
1012 Ga0501042_0039482
1013 Ga0501042_0075624
1014 Ga0501042_0096284
1015 Ga0501043_0019849
1016 Ga0501043_0033512
1017 Ga0501046_0007922
1018 Ga0501046_0047405
1019 Ga0501046_0112674
1020 Ga0501047_0041137
1021 Ga0501048_0003562
1022 Ga0501048_0012477
1023 Ga0501048_0023981
1024 Ga0501067_0006168
1025 Ga0501067_0012816
1026 Ga0501067_0023927
1027 Ga0501067_0038534
1028 Ga0501068_0002188
1029 Ga0501068_0062412
1030 Ga0501069_0003549
1031 Ga0501069_0014805
1032 Ga0501069_0058693
1033 Ga0501070_0015572
1034 Ga0501070_0046574
1035 Ga0501071_0002703
1036 Ga0501071_0046474
1037 Ga0501071_0094689
1038 Ga0501071_0230350
1039 Ga0501072_0019181
1040 Ga0501072_0022890
1041 Ga0501072_0025827
1042 Ga0501072_0077463
1043 Ga0501072_0154472
1044 Ga0501072_0244308
1045 Ga0501073_0009143
1046 Ga0501073_0010508
1047 Ga0501073_0035442
1048 Ga0501073_0041889
1049 Ga0501074_0016534
1050 Ga0501075_0009621
1051 Ga0501075_0026913
1052 Ga0501075_0066996
1053 Ga0501075_0119712
1054 Ga0501076_0043219
1055 Ga0501076_0060627
1056 Ga0501076_0131579
1057 Ga0501077_0097652
1058 Ga0501077_0101705
1059 Ga0501077_0163883
1060 Ga0501216_017388
1061 Ga0501225_0010580
1062 Ga0501079_0006173
1063 Ga0501079_0027164
1064 Ga0501079_0049011
1065 Ga0501079_0093030
1066 Ga0501079_0134523
1067 Ga0501079_0355771
1068 Ga0501080_0035059
1069 Ga0501080_0065114
1070 Ga0501080_0097437
1071 Ga0501080_0124199
1072 Ga0501080_0233717
1073 Ga0501081_0031735
1074 Ga0501081_0210638
1075 Ga0501083_0036700
1076 Ga0501083_0061204
1077 Ga0501083_0115489
1078 Ga0501083_0166242
1079 Ga0501035_0001474
1080 Ga0501035_0167947
1081 Ga0501044_0099611
1082 Ga0501045_0003720
1083 Ga0501045_0009407
1084 Ga0501045_0022158
1085 Ga0501045_0072828
1086 Ga0501045_0136709
1087 nmdc:mga00v17_147938_c1
1088 nmdc:mga00v17_3255_c1
1089 nmdc:mga00v17_5842_c1
1090 nmdc:mga0yw44_14709_c1
1091 nmdc:mga0yw44_154417_c1
1092 nmdc:mga0k408_15009_c1
1093 nmdc:mga0k408_84150_c1
1094 nmdc:mga07m45_8340_c2
1095 nmdc:mga05p37_115445_c1
1096 nmdc:mga05p37_11567_c1
1097 nmdc:mga05p37_187156_c1
1098 nmdc:mga05p37_187770_c1
1099 nmdc:mga05p37_1886_c1
1100 nmdc:mga05p37_21596_c1
1101 nmdc:mga05p37_23840_c1
1102 nmdc:mga05p37_266668_c1
1103 nmdc:mga05p37_355835_c1
1104 nmdc:mga05p37_377226_c1
1105 nmdc:mga05p37_395103_c1
1106 nmdc:mga05p37_415_c1
1107 nmdc:mga05p37_45736_c1
1108 nmdc:mga05p37_464810_c1
1109 nmdc:mga05p37_85052_c1
1110 nmdc:mga05p37_8794_c1
1111 nmdc:mga05p37_91506_c1
1112 nmdc:mga09592_1775_c1
1113 nmdc:mga09592_72372_c1
1114 nmdc:mga0qj67_20501_c1
1115 nmdc:mga0qj67_2583_c1
1116 nmdc:mga0qj67_29684_c1
1117 nmdc:mga0qj67_41706_c1
1118 nmdc:mga0qj67_5207_c1
1119 nmdc:mga0qj67_8583_c1
1120 nmdc:mga06r32_102757_c1
1121 nmdc:mga06r32_19574_c1
1122 nmdc:mga06r32_19725_c1
1123 nmdc:mga06r32_202848_c1
1124 nmdc:mga06r32_2407_c2
1125 nmdc:mga06r32_25845_c1
1126 nmdc:mga06r32_35530_c1
1127 nmdc:mga06r32_40767_c1
1128 nmdc:mga06r32_94661_c1
1129 nmdc:mga08y16_12774_c1
1130 nmdc:mga08y16_140910_c1
1131 nmdc:mga08y16_22779_c1
1132 nmdc:mga08y16_27738_c1
1133 nmdc:mga08y16_294480_c1
1134 nmdc:mga08y16_302440_c1
1135 nmdc:mga08y16_4428_c1
1136 nmdc:mga08y16_513234_c1
1137 nmdc:mga08y16_66074_c1
1138 nmdc:mga08y16_712_c1
1139 nmdc:mga0n895_100168_c1
1140 nmdc:mga0n895_181443_c1
1141 nmdc:mga0n895_25315_c1
1142 nmdc:mga0n895_25649_c1
1143 nmdc:mga0n895_29555_c1
1144 nmdc:mga0rr50_136122_c1
1145 nmdc:mga0rr50_138815_c1
1146 nmdc:mga0rr50_21054_c1
1147 nmdc:mga08x19_14498_c1
1148 nmdc:mga0a205_118319_c1
1149 nmdc:mga0a205_13655_c1
1150 nmdc:mga0a205_143502_c1
1151 nmdc:mga0a205_173204_c1
1152 nmdc:mga0a205_4337_c1
1153 nmdc:mga0a205_48994_c1
1154 nmdc:mga0a205_63141_c1
1155 nmdc:mga0a205_69825_c1
1156 nmdc:mga0a205_84097_c1
1157 nmdc:mga0a205_98128_c1
1158 Ga0495601_0011545
1159 Ga0495619_0009298
1160 Ga0500556_0028732
1161 Ga0500628_020727
1162 Ga0501084_0001776
1163 Ga0501084_0039692
1164 Ga0501084_0109747
1165 Ga0501084_0134250
1166 Ga0501084_0284126
1167 Ga0590071_000099
1168 Ga0590071_000365
1169 Ga0590071_003786
1170 Ga0590071_007910
1171 Ga0590074_000331
1172 Ga0590074_002085
1173 Ga0590075_000144
1174 Ga0590075_001380
1175 Ga0590077_002109
1176 Ga0590077_002809
1177 Ga0590077_003521
1178 Ga0590077_004046
1179 Ga0590077_004875
1180 Ga0501082_0002812
1181 Ga0501082_0044756
1182 Ga0530510_0137246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

232

419

0.87

PF07690

MFS_1

Major Facilitator Superfamily

36

274

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.8683 12 379
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.861 10 382
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8524 15 379
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.8522 12 382
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8521 12 380
ID Description Score Start End Superfamily
af_Q4D047_16_187_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9473 18 181 1.20.1250.20
af_P76269_265_456_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9272 11 184 1.20.1250.20
af_P36032_243_430_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9238 10 185 1.20.1250.20
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9202 12 186 1.20.1250.20
af_Q54GH6_264_508_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9188 11 194 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7YLS9-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9769 1 381 GO:0016020
GO:0022857
AF-A0A7W1YTG4-F1-model_v4 MFS transporter 0.9698 74 387 GO:0016020
GO:0022857
AF-A0A143PTN2-F1-model_v4 Major facilitator superfamily transporter 0.9667 17 380 GO:0016020
GO:0022857
AF-A0A2V7W5L9-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9641 6 381 GO:0016020
GO:0022857
AF-A0A7W1YTG4-F1-model_v4 MFS transporter 0.9637 74 387 GO:0016020
GO:0022857

Map