F467042

General Info

Members Datasets Scaffolds Average Seq Length
591 295 1182 189

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10305187|Ga0075369_103051871
Length 222
Sequence VASVVSRESYFDVGLEVLSDLGYGGLKLAEVCNRLGVTTGSFYHYFPGWPAYTKELVAHWMQRQTVQIIERVRAEKDPRRRIDTLIAEGLSLPHGAEAAIRVWSSVDAEVYSIQAAVDQQRFDIMYESAFEILHNKRQAQIFAAWGVYVLVGYEQAALPRDAAALEWIAGQLTDALDSGRFRGQSRYSPSGTDANRPESSASVSWPAIHSSAAASRGRAACS

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
288 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
289 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
290 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
291 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
292 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
293 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
294 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
295 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.95
Nodule 0.17
Rhizoplane 10.66
Rhizosphere 67.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10305187 3300006186 Bacteria 743
2 JGI24746J21847_1022118 3300001977 Bacteria 887
3 JGI24739J22299_10105610 3300001989 Bacteria 847
4 JGI24743J22301_10012771 3300001991 Bacteria 1533
5 JGI24750J21931_1004949 3300002070 Bacteria 1628
6 JGI24748J21848_1015122 3300002074 Bacteria 917
7 JGI24744J21845_10000117 3300002077 Bacteria 10952
8 JGI24744J21845_10003482 3300002077 Bacteria 3240
9 JGI24742J22300_10010344 3300002244 Bacteria 1544
10 Ga0055540_1002957 3300003792 Bacteria 8533
11 Ga0055540_1003505 3300003792 Bacteria 7554
12 Ga0055540_1009815 3300003792 Bacteria 3253
13 Ga0055540_1014387 3300003792 Bacteria 2357
14 Ga0070676_10003196 3300005328 Bacteria 8497
15 Ga0070676_10108981 3300005328 Bacteria 1722
16 Ga0070670_100432257 3300005331 Bacteria 1165
17 Ga0070677_10207668 3300005333 Bacteria 949
18 Ga0068869_100043225 3300005334 Bacteria 3235
19 Ga0070666_10015178 3300005335 Bacteria 4912
20 Ga0070666_10042872 3300005335 Bacteria 3028
21 Ga0070666_10579102 3300005335 Bacteria 818
22 Ga0070682_100012323 3300005337 Bacteria 4900
23 Ga0070682_100057314 3300005337 Bacteria 2454
24 Ga0070682_100464659 3300005337 Bacteria 972
25 Ga0068868_100000838 3300005338 Bacteria 20848
26 Ga0068868_100330966 3300005338 Bacteria 1300
27 Ga0070660_100149720 3300005339 Bacteria 1876
28 Ga0070689_100134223 3300005340 Bacteria 1987
29 Ga0070689_100949084 3300005340 Bacteria 763
30 Ga0070691_10003439 3300005341 Bacteria 7117
31 Ga0070691_10155582 3300005341 Bacteria 1175
32 Ga0070692_10096725 3300005345 Bacteria 1613
33 Ga0070692_10148252 3300005345 Bacteria 1334
34 Ga0070668_100004294 3300005347 Bacteria 10575
35 Ga0070668_100015870 3300005347 Bacteria 5635
36 Ga0070668_100073304 3300005347 Bacteria 2669
37 Ga0070669_100102936 3300005353 Bacteria 2157
38 Ga0070675_100390779 3300005354 Bacteria 1239
39 Ga0070671_100007600 3300005355 Bacteria 8669
40 Ga0070671_100016640 3300005355 Bacteria 5944
41 Ga0070671_100098735 3300005355 Bacteria 2449
42 Ga0070674_100003440 3300005356 Bacteria 8888
43 Ga0070674_100218869 3300005356 Bacteria 1480
44 Ga0070674_100242347 3300005356 Bacteria 1412
45 Ga0070673_100279148 3300005364 Bacteria 1465
46 Ga0070688_100008914 3300005365 Bacteria 5463
47 Ga0070659_100014915 3300005366 Bacteria 5813
48 Ga0070659_100070954 3300005366 Bacteria 2768
49 Ga0070667_100001385 3300005367 Bacteria 21707
50 Ga0070667_100029870 3300005367 Bacteria 4544
51 Ga0070667_100060640 3300005367 Bacteria 3201
52 Ga0070667_100573337 3300005367 Bacteria 1038
53 Ga0070667_101415146 3300005367 Bacteria 652
54 Ga0070703_10025438 3300005406 Bacteria 1756
55 Ga0070709_10010246 3300005434 Bacteria 5183
56 Ga0070709_10035123 3300005434 Bacteria 3045
57 Ga0070710_10002621 3300005437 Bacteria 8545
58 Ga0070710_10003897 3300005437 Bacteria 7065
59 Ga0070701_10005597 3300005438 Bacteria 5206
60 Ga0070711_100007511 3300005439 Bacteria 6636
61 Ga0070711_100012480 3300005439 Bacteria 5310
62 Ga0070711_100312872 3300005439 Bacteria 1252
63 Ga0070711_100434664 3300005439 Bacteria 1072
64 Ga0070705_100006186 3300005440 Bacteria 5861
65 Ga0070700_100034377 3300005441 Bacteria 3061
66 Ga0070694_100006641 3300005444 Bacteria 7027
67 Ga0070663_100017372 3300005455 Bacteria 4694
68 Ga0070663_100209608 3300005455 Bacteria 1525
69 Ga0070663_100358997 3300005455 Bacteria 1181
70 Ga0070678_100000561 3300005456 Bacteria 18160
71 Ga0070662_100010975 3300005457 Bacteria 5970
72 Ga0070662_100125344 3300005457 Bacteria 1973
73 Ga0068867_100013519 3300005459 Bacteria 5781
74 Ga0068867_100024265 3300005459 Bacteria 4345
75 Ga0068867_100259899 3300005459 Bacteria 1415
76 Ga0070685_10116711 3300005466 Bacteria 1652
77 Ga0070685_10282597 3300005466 Bacteria 1112
78 Ga0070706_100918735 3300005467 Bacteria 808
79 Ga0070697_101363955 3300005536 Bacteria 633
80 Ga0068853_100007337 3300005539 Bacteria 8822
81 Ga0068853_100015807 3300005539 Bacteria 6197
82 Ga0068853_100023238 3300005539 Bacteria 5187
83 Ga0068853_100055379 3300005539 Bacteria 3418
84 Ga0068853_100204729 3300005539 Bacteria 1797
85 Ga0070672_100019766 3300005543 Bacteria 4897
86 Ga0070672_100151145 3300005543 Bacteria 1921
87 Ga0070686_100088604 3300005544 Bacteria 2066
88 Ga0070686_100290914 3300005544 Bacteria 1208
89 Ga0070686_101081279 3300005544 Bacteria 661
90 Ga0070695_100009404 3300005545 Bacteria 5819
91 Ga0070696_100007593 3300005546 Bacteria 7248
92 Ga0070696_100193311 3300005546 Bacteria 1515
93 Ga0070693_100006712 3300005547 Bacteria 5588
94 Ga0070693_100009268 3300005547 Bacteria 4890
95 Ga0070693_100077478 3300005547 Bacteria 1973
96 Ga0070665_100005940 3300005548 Bacteria 12499
97 Ga0070665_100018307 3300005548 Bacteria 7021
98 Ga0070665_100103344 3300005548 Bacteria 2852
99 Ga0070704_100000549 3300005549 Bacteria 17986
100 Ga0070704_100001958 3300005549 Bacteria 11402
101 Ga0070704_100880814 3300005549 Bacteria 804
102 Ga0068855_100071177 3300005563 Bacteria 4045
103 Ga0068855_100319298 3300005563 Bacteria 1717
104 Ga0068855_100793672 3300005563 Bacteria 1007
105 Ga0068854_100014073 3300005578 Bacteria 5266
106 Ga0068854_100026914 3300005578 Bacteria 3957
107 Ga0070702_100000525 3300005615 Bacteria 13796
108 Ga0070702_100152135 3300005615 Bacteria 1486
109 Ga0068852_100095943 3300005616 Bacteria 2664
110 Ga0068852_100323620 3300005616 Bacteria 1498
111 Ga0068852_100561993 3300005616 Bacteria 1142
112 Ga0068859_100064052 3300005617 Bacteria 3708
113 Ga0068859_100261125 3300005617 Bacteria 1823
114 Ga0068864_100579579 3300005618 Bacteria 1087
115 Ga0068866_10019610 3300005718 Bacteria 3083
116 Ga0068861_100010503 3300005719 Bacteria 6426
117 Ga0068861_100135052 3300005719 Bacteria 2006
118 Ga0068851_10144557 3300005834 Bacteria 1296
119 Ga0068851_10220518 3300005834 Bacteria 1065
120 Ga0068870_10180474 3300005840 Bacteria 1267
121 Ga0068863_100006449 3300005841 Bacteria 11508
122 Ga0068863_100045381 3300005841 Bacteria 4171
123 Ga0068858_100001861 3300005842 Bacteria 21521
124 Ga0068858_100230900 3300005842 Bacteria 1754
125 Ga0068858_100480711 3300005842 Bacteria 1199
126 Ga0068860_100008239 3300005843 Bacteria 10374
127 Ga0068860_100325445 3300005843 Bacteria 1509
128 Ga0068860_100536601 3300005843 Bacteria 1171
129 Ga0068862_100002869 3300005844 Bacteria 15109
130 Ga0081455_10106805 3300005937 Bacteria 2233
131 Ga0081455_10112681 3300005937 Bacteria 2158
132 Ga0081538_10143400 3300005981 Bacteria 1096
133 Ga0075365_10040905 3300006038 Bacteria 3025
134 Ga0075365_10218241 3300006038 Bacteria 1338
135 Ga0075368_10136709 3300006042 Bacteria 1020
136 Ga0075363_100001735 3300006048 Bacteria 8480
137 Ga0075363_100007271 3300006048 Bacteria 5078
138 Ga0075363_100010655 3300006048 Bacteria 4376
139 Ga0075363_100054961 3300006048 Bacteria 2131
140 Ga0075363_100060056 3300006048 Bacteria 2046
141 Ga0075363_100124932 3300006048 Bacteria 1439
142 Ga0075363_100193985 3300006048 Bacteria 1159
143 Ga0075363_100205722 3300006048 Bacteria 1125
144 Ga0075363_100234286 3300006048 Bacteria 1054
145 Ga0075364_10004643 3300006051 Bacteria 7922
146 Ga0075364_10005467 3300006051 Bacteria 7386
147 Ga0075364_10006051 3300006051 Bacteria 7083
148 Ga0075364_10030880 3300006051 Bacteria 3441
149 Ga0075364_10075965 3300006051 Bacteria 2217
150 Ga0075364_10134665 3300006051 Bacteria 1660
151 Ga0075364_10468137 3300006051 Bacteria 861
152 Ga0075364_10480963 3300006051 Bacteria 849
153 Ga0070715_10007012 3300006163 Bacteria 3858
154 Ga0070716_100002482 3300006173 Bacteria 8520
155 Ga0070716_100005130 3300006173 Bacteria 6330
156 Ga0070716_100107510 3300006173 Bacteria 1722
157 Ga0070716_100940887 3300006173 Bacteria 679
158 Ga0070712_100003058 3300006175 Bacteria 10345
159 Ga0070712_100004598 3300006175 Bacteria 8522
160 Ga0075362_10034577 3300006177 Bacteria 2204
161 Ga0075362_10040789 3300006177 Bacteria 2045
162 Ga0075362_10088444 3300006177 Bacteria 1435
163 Ga0075362_10096525 3300006177 Bacteria 1377
164 Ga0075367_10031970 3300006178 Bacteria 3025
165 Ga0075367_10046957 3300006178 Bacteria 2539
166 Ga0075367_10194716 3300006178 Bacteria 1265
167 Ga0075367_10261345 3300006178 Bacteria 1087
168 Ga0075369_10006081 3300006186 Bacteria 4550
169 Ga0075369_10007439 3300006186 Bacteria 4169
170 Ga0075369_10023106 3300006186 Bacteria 2568
171 Ga0075369_10064262 3300006186 Bacteria 1607
172 Ga0075369_10067295 3300006186 Bacteria 1572
173 Ga0075369_10081938 3300006186 Bacteria 1432
174 Ga0075369_10083345 3300006186 Bacteria 1420
175 Ga0075369_10124519 3300006186 Bacteria 1168
176 Ga0075369_10235963 3300006186 Bacteria 848
177 Ga0097621_100044438 3300006237 Bacteria 3584
178 Ga0097621_100052009 3300006237 Bacteria 3336
179 Ga0075370_10001991 3300006353 Bacteria 9259
180 Ga0075370_10015673 3300006353 Bacteria 4063
181 Ga0075370_10039262 3300006353 Bacteria 2666
182 Ga0075370_10153437 3300006353 Bacteria 1350
183 Ga0075370_10154594 3300006353 Bacteria 1345
184 Ga0075370_10343706 3300006353 Bacteria 891
185 Ga0075370_10407722 3300006353 Bacteria 816
186 Ga0075428_100001546 3300006844 Bacteria 24627
187 Ga0075430_100060920 3300006846 Bacteria 3172
188 Ga0075431_100200975 3300006847 Bacteria 2039
189 Ga0075434_101339366 3300006871 Bacteria 726
190 Ga0068865_100003473 3300006881 Bacteria 9441
191 Ga0097620_100064055 3300006931 Bacteria 3708
192 Ga0097620_100261120 3300006931 Bacteria 1823
193 Ga0099795_10150497 3300007788 Bacteria 953
194 Ga0105250_10021530 3300009092 Bacteria 2601
195 Ga0105250_10166408 3300009092 Bacteria 922
196 Ga0111539_10219484 3300009094 Bacteria 2215
197 Ga0105245_10079147 3300009098 Bacteria 3001
198 Ga0105247_10001915 3300009101 Bacteria 14522
199 Ga0105247_10053908 3300009101 Bacteria 2482
200 Ga0114129_10010984 3300009147 Bacteria 12901
201 Ga0114129_12519249 3300009147 Bacteria 615
202 Ga0105243_10012219 3300009148 Bacteria 6492
203 Ga0105243_10236122 3300009148 Bacteria 1624
204 Ga0105241_10129659 3300009174 Bacteria 2040
205 Ga0105241_10248112 3300009174 Bacteria 1508
206 Ga0105242_10002136 3300009176 Bacteria 15601
207 Ga0105242_10044778 3300009176 Bacteria 3585
208 Ga0105248_10003952 3300009177 Bacteria 16388
209 Ga0105248_10238264 3300009177 Bacteria 2048
210 Ga0105248_10267778 3300009177 Bacteria 1924
211 Ga0105237_10000958 3300009545 Bacteria 38812
212 Ga0105237_10068351 3300009545 Bacteria 3546
213 Ga0105237_10241750 3300009545 Bacteria 1806
214 Ga0105238_10039942 3300009551 Bacteria 4756
215 Ga0105238_10095528 3300009551 Bacteria 2959
216 Ga0105249_10005426 3300009553 Bacteria 11009
217 Ga0105249_10012080 3300009553 Bacteria 7604
218 Ga0105249_10060114 3300009553 Bacteria 3486
219 Ga0099796_10212330 3300010159 Bacteria 790
220 Ga0105239_10006535 3300010375 Bacteria 13508
221 Ga0105239_10152390 3300010375 Bacteria 2580
222 Ga0105239_10257893 3300010375 Bacteria 1959
223 Ga0105239_11295091 3300010375 Bacteria 841
224 Ga0105239_11480912 3300010375 Bacteria 784
225 Ga0105246_10030855 3300011119 Bacteria 3543
226 Ga0105246_10102440 3300011119 Bacteria 2087
227 Ga0105246_10136410 3300011119 Bacteria 1839
228 Ga0105246_10397732 3300011119 Bacteria 1143
229 Ga0157373_10399147 3300013100 Bacteria 985
230 Ga0157371_10302086 3300013102 Bacteria 1159
231 Ga0157369_10468804 3300013105 Bacteria 1304
232 Ga0157374_10133040 3300013296 Bacteria 2408
233 Ga0157378_10005468 3300013297 Bacteria 11129
234 Ga0157378_10244088 3300013297 Bacteria 1717
235 Ga0163162_10009534 3300013306 Bacteria 9444
236 Ga0163162_10017305 3300013306 Bacteria 7053
237 Ga0163162_11658870 3300013306 Bacteria 730
238 Ga0157372_10010064 3300013307 Bacteria 10053
239 Ga0157372_10282149 3300013307 Bacteria 1931
240 Ga0157375_10004508 3300013308 Bacteria 12110
241 Ga0157375_10242470 3300013308 Bacteria 1962
242 Ga0157375_10281177 3300013308 Bacteria 1827
243 Ga0157375_10563722 3300013308 Bacteria 1300
244 Ga0163163_10003208 3300014325 Bacteria 13854
245 Ga0163163_10231521 3300014325 Bacteria 1897
246 Ga0157380_10002673 3300014326 Bacteria 12093
247 Ga0157377_10223127 3300014745 Bacteria 1208
248 Ga0157379_10028160 3300014968 Bacteria 5001
249 Ga0157379_10286238 3300014968 Bacteria 1500
250 Ga0157376_10080270 3300014969 Bacteria 2798
251 Ga0157376_10308604 3300014969 Bacteria 1500
252 Ga0163161_10007759 3300017792 Bacteria 7424
253 Ga0163161_10234524 3300017792 Bacteria 1425
254 Ga0209051_1001007 3300025303 Bacteria 27069
255 Ga0209051_1003186 3300025303 Bacteria 10956
256 Ga0209051_1025465 3300025303 Bacteria 2406
257 Ga0209051_1028059 3300025303 Bacteria 2230
258 Ga0209051_1052345 3300025303 Bacteria 1350
259 Ga0207696_1128842 3300025711 Bacteria 680
260 Ga0207653_10181071 3300025885 Bacteria 788
261 Ga0207682_10184404 3300025893 Bacteria 954
262 Ga0207642_10004632 3300025899 Bacteria 4443
263 Ga0207642_10104679 3300025899 Bacteria 1428
264 Ga0207710_10005003 3300025900 Bacteria 5741
265 Ga0207710_10154653 3300025900 Bacteria 1114
266 Ga0207710_10481830 3300025900 Bacteria 643
267 Ga0207688_10004319 3300025901 Bacteria 7756
268 Ga0207688_10012121 3300025901 Bacteria 4691
269 Ga0207680_10009203 3300025903 Bacteria 4885
270 Ga0207680_10033803 3300025903 Bacteria 2920
271 Ga0207647_10040672 3300025904 Bacteria 2926
272 Ga0207647_10089131 3300025904 Bacteria 1841
273 Ga0207685_10029997 3300025905 Bacteria 1932
274 Ga0207699_10007149 3300025906 Bacteria 5445
275 Ga0207699_10045075 3300025906 Bacteria 2572
276 Ga0207645_10002540 3300025907 Bacteria 14284
277 Ga0207645_10045810 3300025907 Bacteria 2795
278 Ga0207654_10568321 3300025911 Bacteria 807
279 Ga0207671_10100113 3300025914 Bacteria 2194
280 Ga0207671_10133658 3300025914 Bacteria 1906
281 Ga0207693_10006648 3300025915 Bacteria 9553
282 Ga0207693_10012261 3300025915 Bacteria 6928
283 Ga0207663_10008044 3300025916 Bacteria 5494
284 Ga0207663_10016453 3300025916 Bacteria 4102
285 Ga0207663_10045988 3300025916 Bacteria 2687
286 Ga0207662_10037227 3300025918 Bacteria 2847
287 Ga0207657_10042166 3300025919 Bacteria 4028
288 Ga0207657_10120840 3300025919 Bacteria 2155
289 Ga0207681_10093711 3300025923 Bacteria 2150
290 Ga0207694_10066249 3300025924 Bacteria 2817
291 Ga0207650_10365755 3300025925 Bacteria 1189
292 Ga0207659_10023795 3300025926 Bacteria 4094
293 Ga0207687_10003532 3300025927 Bacteria 10519
294 Ga0207687_10258773 3300025927 Bacteria 1387
295 Ga0207700_10151683 3300025928 Bacteria 1916
296 Ga0207700_10555148 3300025928 Bacteria 1020
297 Ga0207644_10007329 3300025931 Bacteria 7181
298 Ga0207644_10190954 3300025931 Bacteria 1610
299 Ga0207690_10048568 3300025932 Bacteria 2823
300 Ga0207706_10016848 3300025933 Bacteria 6595
301 Ga0207706_10020128 3300025933 Bacteria 5996
302 Ga0207686_10015636 3300025934 Bacteria 4245
303 Ga0207686_10068100 3300025934 Bacteria 2279
304 Ga0207709_10025056 3300025935 Bacteria 3413
305 Ga0207709_10159258 3300025935 Bacteria 1572
306 Ga0207670_10037196 3300025936 Bacteria 3171
307 Ga0207669_10005636 3300025937 Bacteria 5642
308 Ga0207704_10006498 3300025938 Bacteria 5456
309 Ga0207665_10001864 3300025939 Bacteria 14206
310 Ga0207665_10010250 3300025939 Bacteria 6156
311 Ga0207665_10175075 3300025939 Bacteria 1551
312 Ga0207691_10036287 3300025940 Bacteria 4567
313 Ga0207691_10056144 3300025940 Bacteria 3588
314 Ga0207711_10065152 3300025941 Bacteria 3149
315 Ga0207711_10124494 3300025941 Bacteria 2305
316 Ga0207711_10623228 3300025941 Bacteria 1006
317 Ga0207689_10011888 3300025942 Bacteria 7458
318 Ga0207667_10090430 3300025949 Bacteria 3163
319 Ga0207667_10106855 3300025949 Bacteria 2887
320 Ga0207667_10517701 3300025949 Bacteria 1209
321 Ga0207651_10140806 3300025960 Bacteria 1863
322 Ga0207712_10003279 3300025961 Bacteria 10271
323 Ga0207712_10090764 3300025961 Bacteria 2249
324 Ga0207712_10188942 3300025961 Bacteria 1625
325 Ga0207668_10007474 3300025972 Bacteria 6499
326 Ga0207668_10007489 3300025972 Bacteria 6493
327 Ga0207668_10048461 3300025972 Bacteria 2916
328 Ga0207668_10172361 3300025972 Bacteria 1698
329 Ga0207640_10101794 3300025981 Bacteria 2016
330 Ga0207658_10004887 3300025986 Bacteria 9248
331 Ga0207658_10023595 3300025986 Bacteria 4296
332 Ga0207658_10053073 3300025986 Bacteria 2993
333 Ga0207658_10814233 3300025986 Bacteria 848
334 Ga0207658_11078473 3300025986 Bacteria 733
335 Ga0207677_10004304 3300026023 Bacteria 7624
336 Ga0207677_10139786 3300026023 Bacteria 1852
337 Ga0207677_10534001 3300026023 Bacteria 1019
338 Ga0207703_10006135 3300026035 Bacteria 9619
339 Ga0207703_10124825 3300026035 Bacteria 2215
340 Ga0207703_10416761 3300026035 Bacteria 1249
341 Ga0207639_10006289 3300026041 Bacteria 8065
342 Ga0207639_10011972 3300026041 Bacteria 6035
343 Ga0207639_10579040 3300026041 Bacteria 1033
344 Ga0207678_10006285 3300026067 Bacteria 10550
345 Ga0207678_10008768 3300026067 Bacteria 8900
346 Ga0207678_10145120 3300026067 Bacteria 2026
347 Ga0207678_10150740 3300026067 Bacteria 1985
348 Ga0207708_10055054 3300026075 Bacteria 3033
349 Ga0207702_10833443 3300026078 Bacteria 912
350 Ga0207641_10013464 3300026088 Bacteria 6707
351 Ga0207648_10001653 3300026089 Bacteria 24447
352 Ga0207648_10015709 3300026089 Bacteria 6948
353 Ga0207676_10090756 3300026095 Bacteria 2508
354 Ga0207675_100005991 3300026118 Bacteria 11573
355 Ga0207675_100100889 3300026118 Bacteria 2719
356 Ga0207683_10002318 3300026121 Bacteria 16693
357 Ga0207683_10012137 3300026121 Bacteria 7356
358 Ga0207698_10508912 3300026142 Bacteria 1173
359 Ga0207698_10610012 3300026142 Bacteria 1077
360 Ga0268266_10003956 3300028379 Bacteria 14381
361 Ga0268266_10037153 3300028379 Bacteria 4149
362 Ga0268266_10042462 3300028379 Bacteria 3884
363 Ga0268265_10013979 3300028380 Bacteria 5466
364 Ga0268265_10114299 3300028380 Bacteria 2210
365 Ga0268265_10605965 3300028380 Bacteria 1047
366 Ga0268264_10015971 3300028381 Bacteria 6151
367 Ga0268264_10089050 3300028381 Bacteria 2657
368 Ga0268264_10568923 3300028381 Bacteria 1114
369 Ga0307413_10006915 3300031824 Bacteria 5222
370 Ga0307413_10026166 3300031824 Bacteria 3212
371 Ga0307410_10034343 3300031852 Bacteria 3284
372 Ga0307412_10244171 3300031911 Bacteria 1391
373 Ga0307409_100013803 3300031995 Bacteria 5221
374 Ga0307416_100278051 3300032002 Bacteria 1649
375 Ga0307414_10128486 3300032004 Bacteria 1963
376 Ga0307415_100026312 3300032126 Bacteria 3667
377 Ga0373938_0030111 3300034957 Bacteria 1156
378 Ga0373951_0035670 3300035091 Bacteria 1185
379 Ga0373939_0094006 3300035114 Bacteria 1018
380 Ga0373961_0090244 3300035241 Bacteria 978
381 Ga0373931_0006077 3300035691 Bacteria 5626
382 Ga0373931_0010333 3300035691 Bacteria 4486
383 Ga0373931_0060135 3300035691 Bacteria 2045
384 Ga0395901_0921848 3300038443 Bacteria 854
385 Ga0439461_0003411 3300041410 Bacteria 2616
386 Ga0439466_0013035 3300041411 Bacteria 3049
387 Ga0439465_0064849 3300041413 Bacteria 1215
388 Ga0451797_1262391 3300041453 Bacteria 1189
389 Ga0451795_1034295 3300041456 Bacteria 973
390 Ga0451802_1524428 3300041460 Bacteria 1658
391 Ga0451841_0753409 3300041498 Bacteria 1011
392 Ga0451853_1615242 3300041512 Bacteria 1322
393 Ga0439442_032735 3300042002 Bacteria 1086
394 Ga0439434_0075879 3300042435 Bacteria 1062
395 Ga0439459_0014674 3300042438 Bacteria 1427
396 Ga0466969_0050808 3300044656 Bacteria 2043
397 Ga0466972_0100332 3300044658 Bacteria 1370
398 Ga0466965_0019540 3300044683 Bacteria 3253
399 Ga0466965_0090724 3300044683 Bacteria 1554
400 Ga0466966_0440149 3300044684 Bacteria 783
401 Ga0466961_0101778 3300044693 Bacteria 1809
402 Ga0466964_0113836 3300044706 Bacteria 1210
403 Ga0466964_0154853 3300044706 Bacteria 1066
404 Ga0466971_0021555 3300044719 Bacteria 2867
405 Ga0466968_0060645 3300044735 Bacteria 1631
406 Ga0466968_0190563 3300044735 Bacteria 957
407 Ga0466970_0015820 3300044765 Bacteria 3883
408 Ga0466970_0046631 3300044765 Bacteria 2308
409 Ga0466957_0129123 3300044842 Bacteria 1617
410 Ga0466960_0074951 3300044901 Bacteria 1692
411 Ga0466958_0171573 3300045836 Bacteria 1373
412 Ga0466967_0233937 3300045976 Bacteria 1750
413 Ga0466967_1407224 3300045976 Bacteria 695
414 Ga0495629_0002370 3300046459 Bacteria 14491
415 Ga0495638_0023180 3300046460 Bacteria 4064
416 Ga0495641_0030908 3300046461 Bacteria 2563
417 Ga0495582_0175618 3300046473 Bacteria 1220
418 Ga0495662_0187127 3300046476 Bacteria 1021
419 Ga0495583_0046736 3300046506 Bacteria 1995
420 Ga0495648_0000833 3300046524 Bacteria 32602
421 Ga0495665_0059312 3300046531 Bacteria 2020
422 Ga0495668_0122391 3300046616 Bacteria 1423
423 Ga0495635_0044470 3300046663 Bacteria 3064
424 Ga0495613_0200829 3300046689 Bacteria 1406
425 Ga0495671_0123458 3300046692 Bacteria 1263
426 Ga0495581_0036401 3300047315 Bacteria 2848
427 Ga0495672_0001133 3300047320 Bacteria 27015
428 Ga0495672_0069828 3300047320 Bacteria 1993
429 Ga0495672_0142726 3300047320 Bacteria 1249
430 Ga0495672_0223188 3300047320 Bacteria 929
431 Ga0495673_0000856 3300047469 Bacteria 28247
432 Ga0495686_0031364 3300047472 Bacteria 3447
433 Ga0495593_0183955 3300047673 Bacteria 1052
434 Ga0496100_0001600 3300048903 Bacteria 11177
435 Ga0496100_0002606 3300048903 Bacteria 9194
436 Ga0496100_0071887 3300048903 Bacteria 2311
437 Ga0496100_0208844 3300048903 Bacteria 1427
438 Ga0496101_0000026 3300048904 Bacteria 199963
439 Ga0496101_0001903 3300048904 Bacteria 12607
440 Ga0496101_0072659 3300048904 Bacteria 2525
441 Ga0496101_0115676 3300048904 Bacteria 2023
442 Ga0496102_0000031 3300048905 Bacteria 217389
443 Ga0496102_0025359 3300048905 Bacteria 5277
444 Ga0496102_0040480 3300048905 Bacteria 4215
445 Ga0496102_0040662 3300048905 Bacteria 4207
446 Ga0496102_0065699 3300048905 Bacteria 3325
447 Ga0496102_0360210 3300048905 Bacteria 1369
448 Ga0496102_0512803 3300048905 Bacteria 1122
449 Ga0496103_0000025 3300048906 Bacteria 221144
450 Ga0496103_0003393 3300048906 Bacteria 9736
451 Ga0496103_0046176 3300048906 Bacteria 2688
452 Ga0496103_0143106 3300048906 Bacteria 1530
453 Ga0496104_0023245 3300048907 Bacteria 5699
454 Ga0496104_0031288 3300048907 Bacteria 4948
455 Ga0496104_0578687 3300048907 Bacteria 1033
456 Ga0496105_0031323 3300048908 Bacteria 4360
457 Ga0496105_0104101 3300048908 Bacteria 2344
458 Ga0496105_0292441 3300048908 Bacteria 1311
459 Ga0496105_0513464 3300048908 Bacteria 939
460 Ga0496106_0002117 3300048909 Bacteria 14844
461 Ga0496106_0015384 3300048909 Bacteria 5663
462 Ga0496106_0026976 3300048909 Bacteria 4277
463 Ga0496106_0030481 3300048909 Bacteria 4021
464 Ga0496106_0061836 3300048909 Bacteria 2842
465 Ga0496107_0005649 3300048910 Bacteria 8566
466 Ga0496107_0015586 3300048910 Bacteria 5328
467 Ga0496107_0058983 3300048910 Bacteria 2776
468 Ga0496108_0000461 3300048911 Bacteria 32585
469 Ga0496108_0018805 3300048911 Bacteria 5663
470 Ga0496108_0073697 3300048911 Bacteria 2882
471 Ga0496109_0003812 3300048912 Bacteria 12587
472 Ga0496109_0057436 3300048912 Bacteria 3552
473 Ga0496109_0313313 3300048912 Bacteria 1480
474 Ga0496109_0663321 3300048912 Bacteria 980
475 Ga0496110_0010372 3300048913 Bacteria 7574
476 Ga0496110_0028121 3300048913 Bacteria 4826
477 Ga0496110_0528703 3300048913 Bacteria 1073
478 Ga0496110_0962255 3300048913 Bacteria 761
479 Ga0496111_0022071 3300048914 Bacteria 4453
480 Ga0496111_0042531 3300048914 Bacteria 3263
481 Ga0496112_0005963 3300048915 Bacteria 10630
482 Ga0496112_0032564 3300048915 Bacteria 5063
483 Ga0496112_0142242 3300048915 Bacteria 2368
484 Ga0496112_0257248 3300048915 Bacteria 1696
485 Ga0496112_0263881 3300048915 Bacteria 1671
486 Ga0496113_0014721 3300048916 Bacteria 5349
487 Ga0496113_0220898 3300048916 Bacteria 1510
488 Ga0496114_0009724 3300048917 Bacteria 7639
489 Ga0496114_0010941 3300048917 Bacteria 7233
490 Ga0496114_0248735 3300048917 Bacteria 1564
491 Ga0496114_0347818 3300048917 Bacteria 1311
492 Ga0496115_0005688 3300048918 Bacteria 9074
493 Ga0496115_0061992 3300048918 Bacteria 3016
494 Ga0496116_0000084 3300048919 Bacteria 219579
495 Ga0496117_0000018 3300048920 Bacteria 479613
496 Ga0496118_0000013 3300048921 Bacteria 574008
497 Ga0496119_0168172 3300048922 Bacteria 1160
498 Ga0496121_0000056 3300048924 Bacteria 296250
499 Ga0496125_0153796 3300048928 Bacteria 1575
500 Ga0496126_0000089 3300048929 Bacteria 211348
501 Ga0496126_0037085 3300048929 Bacteria 4552
502 Ga0496126_0171545 3300048929 Bacteria 1848
503 Ga0501034_0034597 3300049571 Bacteria 5122
504 Ga0501036_0126641 3300049572 Bacteria 2157
505 Ga0501037_0001241 3300049573 Bacteria 18799
506 Ga0501038_0179408 3300049574 Bacteria 1709
507 Ga0501043_0008956 3300049579 Bacteria 7876
508 Ga0501067_0131886 3300049583 Bacteria 1391
509 Ga0501068_0226999 3300049584 Bacteria 1187
510 Ga0501069_0059625 3300049585 Bacteria 2130
511 Ga0501070_0073913 3300049586 Bacteria 2821
512 Ga0501070_0136230 3300049586 Bacteria 2027
513 Ga0501072_0487517 3300049588 Bacteria 975
514 Ga0501073_0230959 3300049589 Bacteria 1278
515 Ga0501073_0237330 3300049589 Bacteria 1259
516 Ga0501080_0049815 3300049742 Bacteria 3899
517 Ga0501044_0099649 3300049823 Bacteria 2924
518 Ga0501044_0192079 3300049823 Bacteria 2004
519 nmdc:mga03683_21407_c1 3300050489 Bacteria 2492
520 nmdc:mga03683_34598_c1 3300050489 Bacteria 2045
521 nmdc:mga03683_48673_c1 3300050489 Bacteria 1070
522 nmdc:mga03683_91336_c1 3300050489 Bacteria 1328
523 nmdc:mga03n38_128601_c1 3300050490 Bacteria 1253
524 nmdc:mga03n38_132192_c1 3300050490 Bacteria 1238
525 nmdc:mga03n38_17409_c1 3300050490 Bacteria 2814
526 nmdc:mga03n38_178335_c1 3300050490 Bacteria 1087
527 nmdc:mga03n38_25921_c1 3300050490 Bacteria 2415
528 nmdc:mga03n38_306951_c1 3300050490 Bacteria 853
529 nmdc:mga03n38_364468_c1 3300050490 Bacteria 789
530 nmdc:mga03n38_38230_c1 3300050490 Bacteria 2075
531 nmdc:mga00v17_128040_c1 3300050491 Bacteria 1621
532 nmdc:mga00v17_166816_c1 3300050491 Bacteria 1419
533 nmdc:mga00v17_225112_c1 3300050491 Bacteria 1215
534 nmdc:mga00v17_22682_c1 3300050491 Bacteria 3625
535 nmdc:mga00v17_244392_c1 3300050491 Bacteria 1164
536 nmdc:mga00v17_4012_c1 3300050491 Bacteria 7602
537 nmdc:mga00v17_425719_c1 3300050491 Bacteria 862
538 nmdc:mga00v17_45566_c1 3300050491 Bacteria 2650
539 nmdc:mga00v17_688003_c1 3300050491 Bacteria 656
540 nmdc:mga00v17_78182_c1 3300050491 Bacteria 2061
541 nmdc:mga0yw44_238015_c1 3300050492 Bacteria 1209
542 nmdc:mga0yw44_240255_c1 3300050492 Bacteria 1204
543 nmdc:mga0yw44_25675_c1 3300050492 Bacteria 3354
544 nmdc:mga06z11_18630_c1 3300050494 Bacteria 3175
545 nmdc:mga06z11_80305_c1 3300050494 Bacteria 1748
546 nmdc:mga07m45_139656_c1 3300050496 Bacteria 1403
547 nmdc:mga07m45_204176_c1 3300050496 Bacteria 1150
548 nmdc:mga07m45_28336_c1 3300050496 Bacteria 3091
549 nmdc:mga07m45_298440_c1 3300050496 Bacteria 937
550 nmdc:mga07m45_33489_c1 3300050496 Bacteria 2185
551 nmdc:mga07m45_4254_c1 3300050496 Bacteria 7007
552 nmdc:mga07m45_454784_c1 3300050496 Bacteria 742
553 nmdc:mga0qj67_1083_c1 3300050509 Bacteria 18865
554 nmdc:mga06r32_36007_c1 3300050510 Bacteria 4673
555 nmdc:mga08y16_183086_c1 3300050511 Bacteria 2174
556 nmdc:mga0n895_1309498_c1 3300050512 Bacteria 695
557 nmdc:mga0sz30_101236_c1 3300050516 Bacteria 1258
558 nmdc:mga0sz30_101320_c1 3300050516 Bacteria 1258
559 nmdc:mga0sz30_208162_c1 3300050516 Bacteria 869
560 nmdc:mga0sz30_36411_c1 3300050516 Bacteria 2057
561 nmdc:mga0sz30_42790_c1 3300050516 Bacteria 1906
562 nmdc:mga0sz30_5346_c2 3300050516 Bacteria 4194
563 nmdc:mga0sz30_55762_c1 3300050516 Bacteria 1682
564 nmdc:mga0sz30_61167_c1 3300050516 Bacteria 1609
565 nmdc:mga0sz30_76265_c1 3300050516 Bacteria 1447
566 nmdc:mga0sz30_85021_c1 3300050516 Bacteria 1372
567 Ga0500610_0073145 3300053079 Bacteria 1787
568 Ga0500635_0053676 3300053080 Bacteria 1387
569 Ga0495655_0128964 3300053083 Bacteria 777
570 Ga0500643_001808 3300053087 Bacteria 11698
571 Ga0500643_005035 3300053087 Bacteria 5786
572 Ga0500650_0153758 3300053098 Bacteria 1063
573 Ga0500642_0023735 3300053130 Bacteria 2467
574 Ga0500652_000117 3300053131 Bacteria 30916
575 Ga0500652_037646 3300053131 Bacteria 1931
576 Ga0500658_0327549 3300053134 Bacteria 704
577 Ga0500559_0016808 3300053136 Bacteria 3090
578 Ga0500616_0003714 3300053153 Bacteria 11399
579 Ga0500627_0021090 3300053158 Bacteria 2624
580 Ga0500645_000039 3300053730 Bacteria 111509
581 Ga0500645_003398 3300053730 Bacteria 6494
582 Ga0466962_0008820 3300061719 Bacteria 4832
583 2644488117 2643221687 Bacteria 6500351
584 2738708012 2738541274 Bacteria 6909446
585 2739334261 2738543028 Bacteria 6917070
586 2842135666 2842134933 Bacteria 5847019
587 2902792309 2902792274 Bacteria 7270173
588 2902802455 2902799365 Bacteria 5419524
589 2902841202 2902837492 Bacteria 6697721
590 2929212434 2929212328 Bacteria 7708288
591 2939583520 2939582691 Bacteria 7088898
592 Ga0075369_10305187
593 JGI24746J21847_1022118
594 JGI24739J22299_10105610
595 JGI24743J22301_10012771
596 JGI24750J21931_1004949
597 JGI24748J21848_1015122
598 JGI24744J21845_10000117
599 JGI24744J21845_10003482
600 JGI24742J22300_10010344
601 Ga0055540_1002957
602 Ga0055540_1003505
603 Ga0055540_1009815
604 Ga0055540_1014387
605 Ga0070676_10003196
606 Ga0070676_10108981
607 Ga0070670_100432257
608 Ga0070677_10207668
609 Ga0068869_100043225
610 Ga0070666_10015178
611 Ga0070666_10042872
612 Ga0070666_10579102
613 Ga0070682_100012323
614 Ga0070682_100057314
615 Ga0070682_100464659
616 Ga0068868_100000838
617 Ga0068868_100330966
618 Ga0070660_100149720
619 Ga0070689_100134223
620 Ga0070689_100949084
621 Ga0070691_10003439
622 Ga0070691_10155582
623 Ga0070692_10096725
624 Ga0070692_10148252
625 Ga0070668_100004294
626 Ga0070668_100015870
627 Ga0070668_100073304
628 Ga0070669_100102936
629 Ga0070675_100390779
630 Ga0070671_100007600
631 Ga0070671_100016640
632 Ga0070671_100098735
633 Ga0070674_100003440
634 Ga0070674_100218869
635 Ga0070674_100242347
636 Ga0070673_100279148
637 Ga0070688_100008914
638 Ga0070659_100014915
639 Ga0070659_100070954
640 Ga0070667_100001385
641 Ga0070667_100029870
642 Ga0070667_100060640
643 Ga0070667_100573337
644 Ga0070667_101415146
645 Ga0070703_10025438
646 Ga0070709_10010246
647 Ga0070709_10035123
648 Ga0070710_10002621
649 Ga0070710_10003897
650 Ga0070701_10005597
651 Ga0070711_100007511
652 Ga0070711_100012480
653 Ga0070711_100312872
654 Ga0070711_100434664
655 Ga0070705_100006186
656 Ga0070700_100034377
657 Ga0070694_100006641
658 Ga0070663_100017372
659 Ga0070663_100209608
660 Ga0070663_100358997
661 Ga0070678_100000561
662 Ga0070662_100010975
663 Ga0070662_100125344
664 Ga0068867_100013519
665 Ga0068867_100024265
666 Ga0068867_100259899
667 Ga0070685_10116711
668 Ga0070685_10282597
669 Ga0070706_100918735
670 Ga0070697_101363955
671 Ga0068853_100007337
672 Ga0068853_100015807
673 Ga0068853_100023238
674 Ga0068853_100055379
675 Ga0068853_100204729
676 Ga0070672_100019766
677 Ga0070672_100151145
678 Ga0070686_100088604
679 Ga0070686_100290914
680 Ga0070686_101081279
681 Ga0070695_100009404
682 Ga0070696_100007593
683 Ga0070696_100193311
684 Ga0070693_100006712
685 Ga0070693_100009268
686 Ga0070693_100077478
687 Ga0070665_100005940
688 Ga0070665_100018307
689 Ga0070665_100103344
690 Ga0070704_100000549
691 Ga0070704_100001958
692 Ga0070704_100880814
693 Ga0068855_100071177
694 Ga0068855_100319298
695 Ga0068855_100793672
696 Ga0068854_100014073
697 Ga0068854_100026914
698 Ga0070702_100000525
699 Ga0070702_100152135
700 Ga0068852_100095943
701 Ga0068852_100323620
702 Ga0068852_100561993
703 Ga0068859_100064052
704 Ga0068859_100261125
705 Ga0068864_100579579
706 Ga0068866_10019610
707 Ga0068861_100010503
708 Ga0068861_100135052
709 Ga0068851_10144557
710 Ga0068851_10220518
711 Ga0068870_10180474
712 Ga0068863_100006449
713 Ga0068863_100045381
714 Ga0068858_100001861
715 Ga0068858_100230900
716 Ga0068858_100480711
717 Ga0068860_100008239
718 Ga0068860_100325445
719 Ga0068860_100536601
720 Ga0068862_100002869
721 Ga0081455_10106805
722 Ga0081455_10112681
723 Ga0081538_10143400
724 Ga0075365_10040905
725 Ga0075365_10218241
726 Ga0075368_10136709
727 Ga0075363_100001735
728 Ga0075363_100007271
729 Ga0075363_100010655
730 Ga0075363_100054961
731 Ga0075363_100060056
732 Ga0075363_100124932
733 Ga0075363_100193985
734 Ga0075363_100205722
735 Ga0075363_100234286
736 Ga0075364_10004643
737 Ga0075364_10005467
738 Ga0075364_10006051
739 Ga0075364_10030880
740 Ga0075364_10075965
741 Ga0075364_10134665
742 Ga0075364_10468137
743 Ga0075364_10480963
744 Ga0070715_10007012
745 Ga0070716_100002482
746 Ga0070716_100005130
747 Ga0070716_100107510
748 Ga0070716_100940887
749 Ga0070712_100003058
750 Ga0070712_100004598
751 Ga0075362_10034577
752 Ga0075362_10040789
753 Ga0075362_10088444
754 Ga0075362_10096525
755 Ga0075367_10031970
756 Ga0075367_10046957
757 Ga0075367_10194716
758 Ga0075367_10261345
759 Ga0075369_10006081
760 Ga0075369_10007439
761 Ga0075369_10023106
762 Ga0075369_10064262
763 Ga0075369_10067295
764 Ga0075369_10081938
765 Ga0075369_10083345
766 Ga0075369_10124519
767 Ga0075369_10235963
768 Ga0097621_100044438
769 Ga0097621_100052009
770 Ga0075370_10001991
771 Ga0075370_10015673
772 Ga0075370_10039262
773 Ga0075370_10153437
774 Ga0075370_10154594
775 Ga0075370_10343706
776 Ga0075370_10407722
777 Ga0075428_100001546
778 Ga0075430_100060920
779 Ga0075431_100200975
780 Ga0075434_101339366
781 Ga0068865_100003473
782 Ga0097620_100064055
783 Ga0097620_100261120
784 Ga0099795_10150497
785 Ga0105250_10021530
786 Ga0105250_10166408
787 Ga0111539_10219484
788 Ga0105245_10079147
789 Ga0105247_10001915
790 Ga0105247_10053908
791 Ga0114129_10010984
792 Ga0114129_12519249
793 Ga0105243_10012219
794 Ga0105243_10236122
795 Ga0105241_10129659
796 Ga0105241_10248112
797 Ga0105242_10002136
798 Ga0105242_10044778
799 Ga0105248_10003952
800 Ga0105248_10238264
801 Ga0105248_10267778
802 Ga0105237_10000958
803 Ga0105237_10068351
804 Ga0105237_10241750
805 Ga0105238_10039942
806 Ga0105238_10095528
807 Ga0105249_10005426
808 Ga0105249_10012080
809 Ga0105249_10060114
810 Ga0099796_10212330
811 Ga0105239_10006535
812 Ga0105239_10152390
813 Ga0105239_10257893
814 Ga0105239_11295091
815 Ga0105239_11480912
816 Ga0105246_10030855
817 Ga0105246_10102440
818 Ga0105246_10136410
819 Ga0105246_10397732
820 Ga0157373_10399147
821 Ga0157371_10302086
822 Ga0157369_10468804
823 Ga0157374_10133040
824 Ga0157378_10005468
825 Ga0157378_10244088
826 Ga0163162_10009534
827 Ga0163162_10017305
828 Ga0163162_11658870
829 Ga0157372_10010064
830 Ga0157372_10282149
831 Ga0157375_10004508
832 Ga0157375_10242470
833 Ga0157375_10281177
834 Ga0157375_10563722
835 Ga0163163_10003208
836 Ga0163163_10231521
837 Ga0157380_10002673
838 Ga0157377_10223127
839 Ga0157379_10028160
840 Ga0157379_10286238
841 Ga0157376_10080270
842 Ga0157376_10308604
843 Ga0163161_10007759
844 Ga0163161_10234524
845 Ga0209051_1001007
846 Ga0209051_1003186
847 Ga0209051_1025465
848 Ga0209051_1028059
849 Ga0209051_1052345
850 Ga0207696_1128842
851 Ga0207653_10181071
852 Ga0207682_10184404
853 Ga0207642_10004632
854 Ga0207642_10104679
855 Ga0207710_10005003
856 Ga0207710_10154653
857 Ga0207710_10481830
858 Ga0207688_10004319
859 Ga0207688_10012121
860 Ga0207680_10009203
861 Ga0207680_10033803
862 Ga0207647_10040672
863 Ga0207647_10089131
864 Ga0207685_10029997
865 Ga0207699_10007149
866 Ga0207699_10045075
867 Ga0207645_10002540
868 Ga0207645_10045810
869 Ga0207654_10568321
870 Ga0207671_10100113
871 Ga0207671_10133658
872 Ga0207693_10006648
873 Ga0207693_10012261
874 Ga0207663_10008044
875 Ga0207663_10016453
876 Ga0207663_10045988
877 Ga0207662_10037227
878 Ga0207657_10042166
879 Ga0207657_10120840
880 Ga0207681_10093711
881 Ga0207694_10066249
882 Ga0207650_10365755
883 Ga0207659_10023795
884 Ga0207687_10003532
885 Ga0207687_10258773
886 Ga0207700_10151683
887 Ga0207700_10555148
888 Ga0207644_10007329
889 Ga0207644_10190954
890 Ga0207690_10048568
891 Ga0207706_10016848
892 Ga0207706_10020128
893 Ga0207686_10015636
894 Ga0207686_10068100
895 Ga0207709_10025056
896 Ga0207709_10159258
897 Ga0207670_10037196
898 Ga0207669_10005636
899 Ga0207704_10006498
900 Ga0207665_10001864
901 Ga0207665_10010250
902 Ga0207665_10175075
903 Ga0207691_10036287
904 Ga0207691_10056144
905 Ga0207711_10065152
906 Ga0207711_10124494
907 Ga0207711_10623228
908 Ga0207689_10011888
909 Ga0207667_10090430
910 Ga0207667_10106855
911 Ga0207667_10517701
912 Ga0207651_10140806
913 Ga0207712_10003279
914 Ga0207712_10090764
915 Ga0207712_10188942
916 Ga0207668_10007474
917 Ga0207668_10007489
918 Ga0207668_10048461
919 Ga0207668_10172361
920 Ga0207640_10101794
921 Ga0207658_10004887
922 Ga0207658_10023595
923 Ga0207658_10053073
924 Ga0207658_10814233
925 Ga0207658_11078473
926 Ga0207677_10004304
927 Ga0207677_10139786
928 Ga0207677_10534001
929 Ga0207703_10006135
930 Ga0207703_10124825
931 Ga0207703_10416761
932 Ga0207639_10006289
933 Ga0207639_10011972
934 Ga0207639_10579040
935 Ga0207678_10006285
936 Ga0207678_10008768
937 Ga0207678_10145120
938 Ga0207678_10150740
939 Ga0207708_10055054
940 Ga0207702_10833443
941 Ga0207641_10013464
942 Ga0207648_10001653
943 Ga0207648_10015709
944 Ga0207676_10090756
945 Ga0207675_100005991
946 Ga0207675_100100889
947 Ga0207683_10002318
948 Ga0207683_10012137
949 Ga0207698_10508912
950 Ga0207698_10610012
951 Ga0268266_10003956
952 Ga0268266_10037153
953 Ga0268266_10042462
954 Ga0268265_10013979
955 Ga0268265_10114299
956 Ga0268265_10605965
957 Ga0268264_10015971
958 Ga0268264_10089050
959 Ga0268264_10568923
960 Ga0307413_10006915
961 Ga0307413_10026166
962 Ga0307410_10034343
963 Ga0307412_10244171
964 Ga0307409_100013803
965 Ga0307416_100278051
966 Ga0307414_10128486
967 Ga0307415_100026312
968 Ga0373938_0030111
969 Ga0373951_0035670
970 Ga0373939_0094006
971 Ga0373961_0090244
972 Ga0373931_0006077
973 Ga0373931_0010333
974 Ga0373931_0060135
975 Ga0395901_0921848
976 Ga0439461_0003411
977 Ga0439466_0013035
978 Ga0439465_0064849
979 Ga0451797_1262391
980 Ga0451795_1034295
981 Ga0451802_1524428
982 Ga0451841_0753409
983 Ga0451853_1615242
984 Ga0439442_032735
985 Ga0439434_0075879
986 Ga0439459_0014674
987 Ga0466969_0050808
988 Ga0466972_0100332
989 Ga0466965_0019540
990 Ga0466965_0090724
991 Ga0466966_0440149
992 Ga0466961_0101778
993 Ga0466964_0113836
994 Ga0466964_0154853
995 Ga0466971_0021555
996 Ga0466968_0060645
997 Ga0466968_0190563
998 Ga0466970_0015820
999 Ga0466970_0046631
1000 Ga0466957_0129123
1001 Ga0466960_0074951
1002 Ga0466958_0171573
1003 Ga0466967_0233937
1004 Ga0466967_1407224
1005 Ga0495629_0002370
1006 Ga0495638_0023180
1007 Ga0495641_0030908
1008 Ga0495582_0175618
1009 Ga0495662_0187127
1010 Ga0495583_0046736
1011 Ga0495648_0000833
1012 Ga0495665_0059312
1013 Ga0495668_0122391
1014 Ga0495635_0044470
1015 Ga0495613_0200829
1016 Ga0495671_0123458
1017 Ga0495581_0036401
1018 Ga0495672_0001133
1019 Ga0495672_0069828
1020 Ga0495672_0142726
1021 Ga0495672_0223188
1022 Ga0495673_0000856
1023 Ga0495686_0031364
1024 Ga0495593_0183955
1025 Ga0496100_0001600
1026 Ga0496100_0002606
1027 Ga0496100_0071887
1028 Ga0496100_0208844
1029 Ga0496101_0000026
1030 Ga0496101_0001903
1031 Ga0496101_0072659
1032 Ga0496101_0115676
1033 Ga0496102_0000031
1034 Ga0496102_0025359
1035 Ga0496102_0040480
1036 Ga0496102_0040662
1037 Ga0496102_0065699
1038 Ga0496102_0360210
1039 Ga0496102_0512803
1040 Ga0496103_0000025
1041 Ga0496103_0003393
1042 Ga0496103_0046176
1043 Ga0496103_0143106
1044 Ga0496104_0023245
1045 Ga0496104_0031288
1046 Ga0496104_0578687
1047 Ga0496105_0031323
1048 Ga0496105_0104101
1049 Ga0496105_0292441
1050 Ga0496105_0513464
1051 Ga0496106_0002117
1052 Ga0496106_0015384
1053 Ga0496106_0026976
1054 Ga0496106_0030481
1055 Ga0496106_0061836
1056 Ga0496107_0005649
1057 Ga0496107_0015586
1058 Ga0496107_0058983
1059 Ga0496108_0000461
1060 Ga0496108_0018805
1061 Ga0496108_0073697
1062 Ga0496109_0003812
1063 Ga0496109_0057436
1064 Ga0496109_0313313
1065 Ga0496109_0663321
1066 Ga0496110_0010372
1067 Ga0496110_0028121
1068 Ga0496110_0528703
1069 Ga0496110_0962255
1070 Ga0496111_0022071
1071 Ga0496111_0042531
1072 Ga0496112_0005963
1073 Ga0496112_0032564
1074 Ga0496112_0142242
1075 Ga0496112_0257248
1076 Ga0496112_0263881
1077 Ga0496113_0014721
1078 Ga0496113_0220898
1079 Ga0496114_0009724
1080 Ga0496114_0010941
1081 Ga0496114_0248735
1082 Ga0496114_0347818
1083 Ga0496115_0005688
1084 Ga0496115_0061992
1085 Ga0496116_0000084
1086 Ga0496117_0000018
1087 Ga0496118_0000013
1088 Ga0496119_0168172
1089 Ga0496121_0000056
1090 Ga0496125_0153796
1091 Ga0496126_0000089
1092 Ga0496126_0037085
1093 Ga0496126_0171545
1094 Ga0501034_0034597
1095 Ga0501036_0126641
1096 Ga0501037_0001241
1097 Ga0501038_0179408
1098 Ga0501043_0008956
1099 Ga0501067_0131886
1100 Ga0501068_0226999
1101 Ga0501069_0059625
1102 Ga0501070_0073913
1103 Ga0501070_0136230
1104 Ga0501072_0487517
1105 Ga0501073_0230959
1106 Ga0501073_0237330
1107 Ga0501080_0049815
1108 Ga0501044_0099649
1109 Ga0501044_0192079
1110 nmdc:mga03683_21407_c1
1111 nmdc:mga03683_34598_c1
1112 nmdc:mga03683_48673_c1
1113 nmdc:mga03683_91336_c1
1114 nmdc:mga03n38_128601_c1
1115 nmdc:mga03n38_132192_c1
1116 nmdc:mga03n38_17409_c1
1117 nmdc:mga03n38_178335_c1
1118 nmdc:mga03n38_25921_c1
1119 nmdc:mga03n38_306951_c1
1120 nmdc:mga03n38_364468_c1
1121 nmdc:mga03n38_38230_c1
1122 nmdc:mga00v17_128040_c1
1123 nmdc:mga00v17_166816_c1
1124 nmdc:mga00v17_225112_c1
1125 nmdc:mga00v17_22682_c1
1126 nmdc:mga00v17_244392_c1
1127 nmdc:mga00v17_4012_c1
1128 nmdc:mga00v17_425719_c1
1129 nmdc:mga00v17_45566_c1
1130 nmdc:mga00v17_688003_c1
1131 nmdc:mga00v17_78182_c1
1132 nmdc:mga0yw44_238015_c1
1133 nmdc:mga0yw44_240255_c1
1134 nmdc:mga0yw44_25675_c1
1135 nmdc:mga06z11_18630_c1
1136 nmdc:mga06z11_80305_c1
1137 nmdc:mga07m45_139656_c1
1138 nmdc:mga07m45_204176_c1
1139 nmdc:mga07m45_28336_c1
1140 nmdc:mga07m45_298440_c1
1141 nmdc:mga07m45_33489_c1
1142 nmdc:mga07m45_4254_c1
1143 nmdc:mga07m45_454784_c1
1144 nmdc:mga0qj67_1083_c1
1145 nmdc:mga06r32_36007_c1
1146 nmdc:mga08y16_183086_c1
1147 nmdc:mga0n895_1309498_c1
1148 nmdc:mga0sz30_101236_c1
1149 nmdc:mga0sz30_101320_c1
1150 nmdc:mga0sz30_208162_c1
1151 nmdc:mga0sz30_36411_c1
1152 nmdc:mga0sz30_42790_c1
1153 nmdc:mga0sz30_5346_c2
1154 nmdc:mga0sz30_55762_c1
1155 nmdc:mga0sz30_61167_c1
1156 nmdc:mga0sz30_76265_c1
1157 nmdc:mga0sz30_85021_c1
1158 Ga0500610_0073145
1159 Ga0500635_0053676
1160 Ga0495655_0128964
1161 Ga0500643_001808
1162 Ga0500643_005035
1163 Ga0500650_0153758
1164 Ga0500642_0023735
1165 Ga0500652_000117
1166 Ga0500652_037646
1167 Ga0500658_0327549
1168 Ga0500559_0016808
1169 Ga0500616_0003714
1170 Ga0500627_0021090
1171 Ga0500645_000039
1172 Ga0500645_003398
1173 Ga0466962_0008820
1174 2644488117
1175 2738708012
1176 2739334261
1177 2842135666
1178 2902792309
1179 2902802455
1180 2902841202
1181 2929212434
1182 2939583520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

11

48

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7r-assembly1.cif.gz_A crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.7986 7 178
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.7982 7 177
3crj-assembly1.cif.gz_B crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 0.7922 7 178
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.7893 7 174
4kwa-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator from saccharomonospora viridis in complex with choline 0.7717 7 177
ID Description Score Start End Superfamily
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9385 6 55 1.10.10.60
3fiwD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.927 6 54 1.10.10.60
3zqlD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9193 3 59 1.10.10.60
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9186 5 59 1.10.10.60
2hxiB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9133 5 63 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7I9W7C0-F1-model_v4 Transcriptional regulator 0.9939 1 188 GO:0003677
GO:0006355
AF-G7CDQ0-F1-model_v4 TetR family transcriptional regulator 0.9927 5 188 GO:0003677
GO:0006355
AF-A0A7X5R4Z2-F1-model_v4 AcrR family transcriptional regulator 0.9903 5 188 GO:0003677
GO:0006355
AF-A0A1X0CVU0-F1-model_v4 Uncharacterized protein 0.9894 1 176 GO:0003677
GO:0006355
AF-A0A7I9W7C0-F1-model_v4 Transcriptional regulator 0.9886 1 188 GO:0003677
GO:0006355

Map