F467032
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 287 | 1180 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100569551|Ga0070684_1005695512 |
| Length | 152 |
| Sequence | MTRKLPTLARLELQILEVLWSRGHASVREIQEGFPEPRPAYTTVQTTVYRLEAKGALRRTRKIGNAHIFEPLVARDVARHRLFDTILRFFGGRAQPMMQQLAEAGKLTLDDVKDLSRATPRQPHRGDPHAGRRRVLVPPAGVVDRRATRRYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 194 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 195 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 196 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 197 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 198 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 199 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 200 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 201 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 234 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 261 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 263 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 269 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.18 |
| Nodule | 0 |
| Rhizoplane | 0.68 |
| Rhizosphere | 97.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 40.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070684_100569551 | 3300005535 | Bacteria | 1052 |
| 2 | JGI24751J29686_10016534 | 3300002459 | Unclassified | 1521 |
| 3 | Ga0065712_10107522 | 3300005290 | Bacteria | 1894 |
| 4 | Ga0065712_10335027 | 3300005290 | Unclassified | 808 |
| 5 | Ga0065707_10637140 | 3300005295 | Bacteria | 670 |
| 6 | Ga0065707_10932714 | 3300005295 | Unclassified | 557 |
| 7 | Ga0070683_100126921 | 3300005329 | Bacteria | 2412 |
| 8 | Ga0070683_100492311 | 3300005329 | Bacteria | 1171 |
| 9 | Ga0070690_100308093 | 3300005330 | Unclassified | 1137 |
| 10 | Ga0070670_100009679 | 3300005331 | Bacteria | 8227 |
| 11 | Ga0070670_100018703 | 3300005331 | Bacteria | 5938 |
| 12 | Ga0070670_100029182 | 3300005331 | Bacteria | 4747 |
| 13 | Ga0070670_100030565 | 3300005331 | Unclassified | 4638 |
| 14 | Ga0070670_100088405 | 3300005331 | Bacteria | 2663 |
| 15 | Ga0070670_101036167 | 3300005331 | Bacteria | 747 |
| 16 | Ga0070677_10574739 | 3300005333 | Unclassified | 621 |
| 17 | Ga0070677_10844593 | 3300005333 | Unclassified | 526 |
| 18 | Ga0068869_100121546 | 3300005334 | Unclassified | 1998 |
| 19 | Ga0070666_10823051 | 3300005335 | Unclassified | 684 |
| 20 | Ga0070680_100438846 | 3300005336 | Bacteria | 1115 |
| 21 | Ga0070689_100053933 | 3300005340 | Bacteria | 3112 |
| 22 | Ga0070689_100204357 | 3300005340 | Unclassified | 1614 |
| 23 | Ga0070689_100313642 | 3300005340 | Bacteria | 1308 |
| 24 | Ga0070689_100781452 | 3300005340 | Unclassified | 839 |
| 25 | Ga0070691_11063644 | 3300005341 | Bacteria | 508 |
| 26 | Ga0070687_100146227 | 3300005343 | Bacteria | 1382 |
| 27 | Ga0070661_101365702 | 3300005344 | Unclassified | 595 |
| 28 | Ga0070668_101950237 | 3300005347 | Unclassified | 541 |
| 29 | Ga0070669_100404390 | 3300005353 | Bacteria | 1118 |
| 30 | Ga0070669_100763799 | 3300005353 | Bacteria | 820 |
| 31 | Ga0070669_101042478 | 3300005353 | Unclassified | 703 |
| 32 | Ga0070669_101149193 | 3300005353 | Unclassified | 670 |
| 33 | Ga0070675_100001320 | 3300005354 | Bacteria | 18131 |
| 34 | Ga0070675_100192563 | 3300005354 | Bacteria | 1767 |
| 35 | Ga0070675_100410432 | 3300005354 | Unclassified | 1209 |
| 36 | Ga0070675_100546642 | 3300005354 | Bacteria | 1047 |
| 37 | Ga0070675_100947728 | 3300005354 | Bacteria | 790 |
| 38 | Ga0070671_100563230 | 3300005355 | Bacteria | 983 |
| 39 | Ga0070671_100579424 | 3300005355 | Bacteria | 969 |
| 40 | Ga0070671_101477680 | 3300005355 | Archaea | 601 |
| 41 | Ga0070671_101653205 | 3300005355 | Bacteria | 568 |
| 42 | Ga0070671_101848494 | 3300005355 | Bacteria | 537 |
| 43 | Ga0070673_100040819 | 3300005364 | Bacteria | 3562 |
| 44 | Ga0070673_100208943 | 3300005364 | Bacteria | 1685 |
| 45 | Ga0070673_101701668 | 3300005364 | Bacteria | 597 |
| 46 | Ga0070688_100085518 | 3300005365 | Bacteria | 2050 |
| 47 | Ga0070688_100091161 | 3300005365 | Bacteria | 1992 |
| 48 | Ga0070688_100094483 | 3300005365 | Unclassified | 1961 |
| 49 | Ga0070659_100419156 | 3300005366 | Bacteria | 1132 |
| 50 | Ga0070709_10204925 | 3300005434 | Bacteria | 1399 |
| 51 | Ga0070709_10473338 | 3300005434 | Unclassified | 947 |
| 52 | Ga0070714_100122319 | 3300005435 | Unclassified | 2316 |
| 53 | Ga0070713_100155120 | 3300005436 | Bacteria | 2040 |
| 54 | Ga0070713_100197376 | 3300005436 | Unclassified | 1816 |
| 55 | Ga0070713_100474597 | 3300005436 | Bacteria | 1178 |
| 56 | Ga0070713_101420458 | 3300005436 | Bacteria | 673 |
| 57 | Ga0070713_101988929 | 3300005436 | Unclassified | 564 |
| 58 | Ga0070710_10966350 | 3300005437 | Unclassified | 619 |
| 59 | Ga0070711_100124767 | 3300005439 | Bacteria | 1910 |
| 60 | Ga0070711_100174106 | 3300005439 | Bacteria | 1642 |
| 61 | Ga0070700_100930186 | 3300005441 | Unclassified | 710 |
| 62 | Ga0070694_100126155 | 3300005444 | Bacteria | 1843 |
| 63 | Ga0070678_101019821 | 3300005456 | Bacteria | 761 |
| 64 | Ga0070678_101603764 | 3300005456 | Unclassified | 611 |
| 65 | Ga0070662_100602952 | 3300005457 | Bacteria | 924 |
| 66 | Ga0070681_11562026 | 3300005458 | Unclassified | 585 |
| 67 | Ga0068867_100403611 | 3300005459 | Unclassified | 1153 |
| 68 | Ga0068867_100840884 | 3300005459 | Bacteria | 822 |
| 69 | Ga0070685_10083495 | 3300005466 | Bacteria | 1919 |
| 70 | Ga0070699_100270338 | 3300005518 | Bacteria | 1521 |
| 71 | Ga0070684_100440529 | 3300005535 | Unclassified | 1203 |
| 72 | Ga0070684_100893835 | 3300005535 | Unclassified | 832 |
| 73 | Ga0070672_100065048 | 3300005543 | Bacteria | 2883 |
| 74 | Ga0070672_100374367 | 3300005543 | Bacteria | 1217 |
| 75 | Ga0070672_100520043 | 3300005543 | Bacteria | 1031 |
| 76 | Ga0070686_100303954 | 3300005544 | Bacteria | 1184 |
| 77 | Ga0070695_100033420 | 3300005545 | Bacteria | 3218 |
| 78 | Ga0070696_100104393 | 3300005546 | Bacteria | 2035 |
| 79 | Ga0070696_100752278 | 3300005546 | Bacteria | 799 |
| 80 | Ga0070696_100865063 | 3300005546 | Unclassified | 748 |
| 81 | Ga0070693_100029000 | 3300005547 | Unclassified | 3014 |
| 82 | Ga0070693_100129060 | 3300005547 | Bacteria | 1578 |
| 83 | Ga0070665_100177311 | 3300005548 | Unclassified | 2132 |
| 84 | Ga0070704_100244604 | 3300005549 | Unclassified | 1470 |
| 85 | Ga0068855_101484792 | 3300005563 | Bacteria | 696 |
| 86 | Ga0070664_100052487 | 3300005564 | Unclassified | 3454 |
| 87 | Ga0070664_100078672 | 3300005564 | Bacteria | 2836 |
| 88 | Ga0070664_100297487 | 3300005564 | Bacteria | 1458 |
| 89 | Ga0070664_100817851 | 3300005564 | Unclassified | 872 |
| 90 | Ga0068857_100157870 | 3300005577 | Bacteria | 2057 |
| 91 | Ga0068857_101964352 | 3300005577 | Unclassified | 573 |
| 92 | Ga0068854_100284846 | 3300005578 | Bacteria | 1332 |
| 93 | Ga0068856_100019305 | 3300005614 | Bacteria | 6617 |
| 94 | Ga0068856_101739253 | 3300005614 | Unclassified | 636 |
| 95 | Ga0068856_101911439 | 3300005614 | Unclassified | 604 |
| 96 | Ga0068852_102799657 | 3300005616 | Unclassified | 506 |
| 97 | Ga0068859_100001265 | 3300005617 | Bacteria | 25831 |
| 98 | Ga0068859_100097682 | 3300005617 | Bacteria | 2990 |
| 99 | Ga0068859_100582857 | 3300005617 | Bacteria | 1212 |
| 100 | Ga0068859_100720698 | 3300005617 | Bacteria | 1087 |
| 101 | Ga0068859_100880592 | 3300005617 | Unclassified | 981 |
| 102 | Ga0068859_101083103 | 3300005617 | Unclassified | 881 |
| 103 | Ga0068859_101569313 | 3300005617 | Unclassified | 727 |
| 104 | Ga0068859_101722715 | 3300005617 | Unclassified | 692 |
| 105 | Ga0068864_100025611 | 3300005618 | Bacteria | 4970 |
| 106 | Ga0068864_100063185 | 3300005618 | Bacteria | 3209 |
| 107 | Ga0068864_100134760 | 3300005618 | Unclassified | 2222 |
| 108 | Ga0068864_100334554 | 3300005618 | Bacteria | 1425 |
| 109 | Ga0068864_100374655 | 3300005618 | Unclassified | 1348 |
| 110 | Ga0068866_10395468 | 3300005718 | Bacteria | 890 |
| 111 | Ga0068861_100163420 | 3300005719 | Bacteria | 1839 |
| 112 | Ga0068861_100740910 | 3300005719 | Unclassified | 917 |
| 113 | Ga0068870_10381781 | 3300005840 | Bacteria | 912 |
| 114 | Ga0068870_11005070 | 3300005840 | Bacteria | 595 |
| 115 | Ga0068870_11444622 | 3300005840 | Bacteria | 505 |
| 116 | Ga0068863_101165667 | 3300005841 | Bacteria | 776 |
| 117 | Ga0068858_100078194 | 3300005842 | Unclassified | 3074 |
| 118 | Ga0068858_101181717 | 3300005842 | Bacteria | 752 |
| 119 | Ga0068858_101702599 | 3300005842 | Unclassified | 623 |
| 120 | Ga0068860_101092839 | 3300005843 | Unclassified | 817 |
| 121 | Ga0068860_101483059 | 3300005843 | Bacteria | 700 |
| 122 | Ga0068862_100322641 | 3300005844 | Bacteria | 1426 |
| 123 | Ga0068862_101171496 | 3300005844 | Bacteria | 766 |
| 124 | Ga0068862_102531415 | 3300005844 | Unclassified | 525 |
| 125 | Ga0081455_10320901 | 3300005937 | Bacteria | 1103 |
| 126 | Ga0070717_10031029 | 3300006028 | Unclassified | 4297 |
| 127 | Ga0070717_10097241 | 3300006028 | Bacteria | 2494 |
| 128 | Ga0070717_10444974 | 3300006028 | Unclassified | 1167 |
| 129 | Ga0075364_10181277 | 3300006051 | Unclassified | 1425 |
| 130 | Ga0070716_100398057 | 3300006173 | Unclassified | 989 |
| 131 | Ga0075367_10022072 | 3300006178 | Bacteria | 3566 |
| 132 | Ga0075366_10069274 | 3300006195 | Unclassified | 2100 |
| 133 | Ga0097621_100001248 | 3300006237 | Bacteria | 17586 |
| 134 | Ga0097621_100351637 | 3300006237 | Unclassified | 1311 |
| 135 | Ga0097621_101088212 | 3300006237 | Bacteria | 750 |
| 136 | Ga0068871_100000496 | 3300006358 | Bacteria | 26925 |
| 137 | Ga0068871_100286727 | 3300006358 | Bacteria | 1442 |
| 138 | Ga0068871_100808806 | 3300006358 | Unclassified | 864 |
| 139 | Ga0075428_100133935 | 3300006844 | Unclassified | 2695 |
| 140 | Ga0075428_100187812 | 3300006844 | Bacteria | 2235 |
| 141 | Ga0075428_100253078 | 3300006844 | Bacteria | 1898 |
| 142 | Ga0075430_100007735 | 3300006846 | Bacteria | 9081 |
| 143 | Ga0075430_100222556 | 3300006846 | Unclassified | 1566 |
| 144 | Ga0075430_100644875 | 3300006846 | Unclassified | 873 |
| 145 | Ga0075431_100028618 | 3300006847 | Bacteria | 5728 |
| 146 | Ga0075431_100099882 | 3300006847 | Bacteria | 2994 |
| 147 | Ga0075431_100280871 | 3300006847 | Unclassified | 1686 |
| 148 | Ga0075431_100346677 | 3300006847 | Unclassified | 1494 |
| 149 | Ga0075431_101410263 | 3300006847 | Unclassified | 656 |
| 150 | Ga0075429_100077220 | 3300006880 | Unclassified | 2902 |
| 151 | Ga0075429_100110332 | 3300006880 | Unclassified | 2405 |
| 152 | Ga0075429_101182135 | 3300006880 | Unclassified | 668 |
| 153 | Ga0068865_100074214 | 3300006881 | Bacteria | 2421 |
| 154 | Ga0068865_100862748 | 3300006881 | Bacteria | 785 |
| 155 | Ga0097620_100001265 | 3300006931 | Bacteria | 25831 |
| 156 | Ga0097620_100097683 | 3300006931 | Bacteria | 2990 |
| 157 | Ga0097620_100582842 | 3300006931 | Bacteria | 1212 |
| 158 | Ga0097620_100720682 | 3300006931 | Bacteria | 1087 |
| 159 | Ga0097620_100880645 | 3300006931 | Unclassified | 981 |
| 160 | Ga0097620_101083192 | 3300006931 | Unclassified | 881 |
| 161 | Ga0097620_101569135 | 3300006931 | Unclassified | 727 |
| 162 | Ga0097620_101722379 | 3300006931 | Unclassified | 692 |
| 163 | Ga0099795_10331068 | 3300007788 | Bacteria | 677 |
| 164 | Ga0105240_10009400 | 3300009093 | Bacteria | 13843 |
| 165 | Ga0105240_10104476 | 3300009093 | Unclassified | 3440 |
| 166 | Ga0105240_10158944 | 3300009093 | Bacteria | 2686 |
| 167 | Ga0105240_10296102 | 3300009093 | Unclassified | 1853 |
| 168 | Ga0105240_10581395 | 3300009093 | Unclassified | 1235 |
| 169 | Ga0111539_10003328 | 3300009094 | Bacteria | 21227 |
| 170 | Ga0111539_10020865 | 3300009094 | Bacteria | 8067 |
| 171 | Ga0111539_10056271 | 3300009094 | Unclassified | 4675 |
| 172 | Ga0111539_10338955 | 3300009094 | Bacteria | 1750 |
| 173 | Ga0111539_11129080 | 3300009094 | Unclassified | 911 |
| 174 | Ga0111539_11918463 | 3300009094 | Unclassified | 687 |
| 175 | Ga0111539_12316478 | 3300009094 | Unclassified | 623 |
| 176 | Ga0105245_10054341 | 3300009098 | Bacteria | 3597 |
| 177 | Ga0105245_10062240 | 3300009098 | Bacteria | 3367 |
| 178 | Ga0105245_11457545 | 3300009098 | Unclassified | 735 |
| 179 | Ga0114129_10321576 | 3300009147 | Bacteria | 2057 |
| 180 | Ga0114129_11353015 | 3300009147 | Unclassified | 880 |
| 181 | Ga0114129_11699639 | 3300009147 | Unclassified | 770 |
| 182 | Ga0114129_12150740 | 3300009147 | Unclassified | 672 |
| 183 | Ga0105243_11340989 | 3300009148 | Bacteria | 734 |
| 184 | Ga0105243_12399985 | 3300009148 | Unclassified | 566 |
| 185 | Ga0105241_10323130 | 3300009174 | Bacteria | 1331 |
| 186 | Ga0105241_10605577 | 3300009174 | Unclassified | 990 |
| 187 | Ga0105242_10280276 | 3300009176 | Unclassified | 1514 |
| 188 | Ga0105242_10706463 | 3300009176 | Unclassified | 987 |
| 189 | Ga0105242_11112646 | 3300009176 | Bacteria | 805 |
| 190 | Ga0105248_10013908 | 3300009177 | Bacteria | 8856 |
| 191 | Ga0105248_10056861 | 3300009177 | Unclassified | 4389 |
| 192 | Ga0105248_10134885 | 3300009177 | Bacteria | 2785 |
| 193 | Ga0105248_10435958 | 3300009177 | Unclassified | 1476 |
| 194 | Ga0105248_11067858 | 3300009177 | Unclassified | 912 |
| 195 | Ga0105248_11721780 | 3300009177 | Unclassified | 711 |
| 196 | Ga0105248_12551858 | 3300009177 | Unclassified | 582 |
| 197 | Ga0105248_13023537 | 3300009177 | Unclassified | 536 |
| 198 | Ga0105237_10018552 | 3300009545 | Bacteria | 7199 |
| 199 | Ga0105237_10443109 | 3300009545 | Bacteria | 1304 |
| 200 | Ga0105237_12736306 | 3300009545 | Unclassified | 504 |
| 201 | Ga0105238_10081370 | 3300009551 | Bacteria | 3228 |
| 202 | Ga0105238_10625549 | 3300009551 | Unclassified | 1085 |
| 203 | Ga0105238_12264509 | 3300009551 | Unclassified | 578 |
| 204 | Ga0105249_10064870 | 3300009553 | Bacteria | 3358 |
| 205 | Ga0105249_10167287 | 3300009553 | Bacteria | 2129 |
| 206 | Ga0105249_10282944 | 3300009553 | Unclassified | 1657 |
| 207 | Ga0105249_12292743 | 3300009553 | Bacteria | 613 |
| 208 | Ga0105239_10053225 | 3300010375 | Bacteria | 4441 |
| 209 | Ga0105239_10723462 | 3300010375 | Unclassified | 1139 |
| 210 | Ga0105239_11545507 | 3300010375 | Bacteria | 767 |
| 211 | Ga0105246_11479371 | 3300011119 | Unclassified | 637 |
| 212 | Ga0105246_12459688 | 3300011119 | Unclassified | 512 |
| 213 | Ga0157370_10800989 | 3300013104 | Unclassified | 857 |
| 214 | Ga0157369_10103360 | 3300013105 | Bacteria | 3035 |
| 215 | Ga0157369_10434897 | 3300013105 | Bacteria | 1359 |
| 216 | Ga0157369_10445980 | 3300013105 | Bacteria | 1340 |
| 217 | Ga0157369_10607716 | 3300013105 | Unclassified | 1129 |
| 218 | Ga0157374_11136246 | 3300013296 | Bacteria | 802 |
| 219 | Ga0157378_10239178 | 3300013297 | Bacteria | 1734 |
| 220 | Ga0157378_10716911 | 3300013297 | Bacteria | 1021 |
| 221 | Ga0163162_10257492 | 3300013306 | Bacteria | 1877 |
| 222 | Ga0163162_10903111 | 3300013306 | Unclassified | 996 |
| 223 | Ga0163162_12013959 | 3300013306 | Unclassified | 662 |
| 224 | Ga0163162_12284592 | 3300013306 | Bacteria | 621 |
| 225 | Ga0157372_10005852 | 3300013307 | Bacteria | 13093 |
| 226 | Ga0157372_10096059 | 3300013307 | Unclassified | 3377 |
| 227 | Ga0157372_10502369 | 3300013307 | Bacteria | 1414 |
| 228 | Ga0157375_10998682 | 3300013308 | Unclassified | 977 |
| 229 | Ga0163163_10002902 | 3300014325 | Bacteria | 14505 |
| 230 | Ga0163163_10035368 | 3300014325 | Unclassified | 4844 |
| 231 | Ga0163163_10070392 | 3300014325 | Bacteria | 3484 |
| 232 | Ga0163163_13087730 | 3300014325 | Unclassified | 519 |
| 233 | Ga0157380_10198242 | 3300014326 | Bacteria | 1779 |
| 234 | Ga0157380_10979420 | 3300014326 | Unclassified | 878 |
| 235 | Ga0157380_11409408 | 3300014326 | Bacteria | 747 |
| 236 | Ga0157380_12264142 | 3300014326 | Unclassified | 608 |
| 237 | Ga0157377_10580785 | 3300014745 | Bacteria | 796 |
| 238 | Ga0157379_10008520 | 3300014968 | Bacteria | 8923 |
| 239 | Ga0157376_10071603 | 3300014969 | Bacteria | 2947 |
| 240 | Ga0163161_10478386 | 3300017792 | Unclassified | 1011 |
| 241 | Ga0213876_10120051 | 3300021384 | Unclassified | 1395 |
| 242 | Ga0213875_10076752 | 3300021388 | Unclassified | 1559 |
| 243 | Ga0207697_10175963 | 3300025315 | Bacteria | 937 |
| 244 | Ga0207697_10457293 | 3300025315 | Bacteria | 566 |
| 245 | Ga0207682_10331230 | 3300025893 | Unclassified | 716 |
| 246 | Ga0207680_10689470 | 3300025903 | Unclassified | 732 |
| 247 | Ga0207699_10726381 | 3300025906 | Unclassified | 728 |
| 248 | Ga0207643_10282381 | 3300025908 | Bacteria | 1030 |
| 249 | Ga0207654_10194641 | 3300025911 | Bacteria | 1331 |
| 250 | Ga0207654_10321589 | 3300025911 | Unclassified | 1058 |
| 251 | Ga0207695_10031397 | 3300025913 | Bacteria | 5826 |
| 252 | Ga0207695_10074327 | 3300025913 | Bacteria | 3460 |
| 253 | Ga0207695_10339469 | 3300025913 | Unclassified | 1390 |
| 254 | Ga0207695_10470869 | 3300025913 | Bacteria | 1139 |
| 255 | Ga0207671_10646790 | 3300025914 | Bacteria | 842 |
| 256 | Ga0207671_10675968 | 3300025914 | Unclassified | 822 |
| 257 | Ga0207663_10065421 | 3300025916 | Bacteria | 2324 |
| 258 | Ga0207663_10153936 | 3300025916 | Bacteria | 1615 |
| 259 | Ga0207660_10056473 | 3300025917 | Bacteria | 2809 |
| 260 | Ga0207660_11234605 | 3300025917 | Bacteria | 608 |
| 261 | Ga0207649_10827363 | 3300025920 | Unclassified | 724 |
| 262 | Ga0207681_10297186 | 3300025923 | Bacteria | 1277 |
| 263 | Ga0207681_10344232 | 3300025923 | Bacteria | 1192 |
| 264 | Ga0207681_10363902 | 3300025923 | Bacteria | 1161 |
| 265 | Ga0207681_10376077 | 3300025923 | Bacteria | 1143 |
| 266 | Ga0207681_10897850 | 3300025923 | Bacteria | 742 |
| 267 | Ga0207694_10018633 | 3300025924 | Bacteria | 5248 |
| 268 | Ga0207650_10005798 | 3300025925 | Bacteria | 8430 |
| 269 | Ga0207650_10032960 | 3300025925 | Bacteria | 3749 |
| 270 | Ga0207650_10150465 | 3300025925 | Unclassified | 1836 |
| 271 | Ga0207650_10787871 | 3300025925 | Bacteria | 805 |
| 272 | Ga0207659_10001410 | 3300025926 | Bacteria | 14319 |
| 273 | Ga0207659_10164163 | 3300025926 | Bacteria | 1746 |
| 274 | Ga0207659_10733047 | 3300025926 | Unclassified | 847 |
| 275 | Ga0207687_10002206 | 3300025927 | Bacteria | 13275 |
| 276 | Ga0207687_10275944 | 3300025927 | Bacteria | 1346 |
| 277 | Ga0207687_11114871 | 3300025927 | Unclassified | 678 |
| 278 | Ga0207700_10005596 | 3300025928 | Bacteria | 7540 |
| 279 | Ga0207700_10071682 | 3300025928 | Bacteria | 2669 |
| 280 | Ga0207700_10740486 | 3300025928 | Bacteria | 878 |
| 281 | Ga0207664_10056500 | 3300025929 | Bacteria | 3117 |
| 282 | Ga0207644_10762039 | 3300025931 | Bacteria | 809 |
| 283 | Ga0207644_11370801 | 3300025931 | Bacteria | 594 |
| 284 | Ga0207644_11804787 | 3300025931 | Unclassified | 512 |
| 285 | Ga0207690_10620882 | 3300025932 | Unclassified | 884 |
| 286 | Ga0207706_10624890 | 3300025933 | Bacteria | 924 |
| 287 | Ga0207686_10337837 | 3300025934 | Unclassified | 1130 |
| 288 | Ga0207686_10409347 | 3300025934 | Bacteria | 1035 |
| 289 | Ga0207686_10433460 | 3300025934 | Bacteria | 1008 |
| 290 | Ga0207686_10443745 | 3300025934 | Unclassified | 997 |
| 291 | Ga0207670_10129759 | 3300025936 | Unclassified | 1845 |
| 292 | Ga0207670_10191691 | 3300025936 | Bacteria | 1547 |
| 293 | Ga0207670_10345556 | 3300025936 | Bacteria | 1177 |
| 294 | Ga0207670_11183964 | 3300025936 | Unclassified | 646 |
| 295 | Ga0207669_11454799 | 3300025937 | Unclassified | 584 |
| 296 | Ga0207704_10195660 | 3300025938 | Unclassified | 1475 |
| 297 | Ga0207704_10392231 | 3300025938 | Bacteria | 1093 |
| 298 | Ga0207665_10367067 | 3300025939 | Unclassified | 1090 |
| 299 | Ga0207691_10011172 | 3300025940 | Bacteria | 8618 |
| 300 | Ga0207691_10464247 | 3300025940 | Bacteria | 1077 |
| 301 | Ga0207691_10508907 | 3300025940 | Unclassified | 1022 |
| 302 | Ga0207691_11366511 | 3300025940 | Bacteria | 583 |
| 303 | Ga0207711_10001493 | 3300025941 | Bacteria | 21780 |
| 304 | Ga0207711_10138250 | 3300025941 | Bacteria | 2190 |
| 305 | Ga0207711_10340768 | 3300025941 | Bacteria | 1387 |
| 306 | Ga0207711_11114570 | 3300025941 | Unclassified | 730 |
| 307 | Ga0207711_11295290 | 3300025941 | Unclassified | 671 |
| 308 | Ga0207689_10074932 | 3300025942 | Bacteria | 2781 |
| 309 | Ga0207689_10765838 | 3300025942 | Bacteria | 815 |
| 310 | Ga0207689_11296526 | 3300025942 | Unclassified | 612 |
| 311 | Ga0207661_10228717 | 3300025944 | Bacteria | 1646 |
| 312 | Ga0207661_11587755 | 3300025944 | Unclassified | 599 |
| 313 | Ga0207661_12149992 | 3300025944 | Unclassified | 504 |
| 314 | Ga0207679_10036586 | 3300025945 | Unclassified | 3483 |
| 315 | Ga0207679_10077486 | 3300025945 | Bacteria | 2529 |
| 316 | Ga0207679_10319571 | 3300025945 | Unclassified | 1344 |
| 317 | Ga0207651_10030112 | 3300025960 | Bacteria | 3451 |
| 318 | Ga0207651_12044547 | 3300025960 | Unclassified | 515 |
| 319 | Ga0207712_10089967 | 3300025961 | Bacteria | 2257 |
| 320 | Ga0207712_10465932 | 3300025961 | Bacteria | 1074 |
| 321 | Ga0207712_10491081 | 3300025961 | Bacteria | 1048 |
| 322 | Ga0207668_10406707 | 3300025972 | Bacteria | 1152 |
| 323 | Ga0207658_10280698 | 3300025986 | Bacteria | 1428 |
| 324 | Ga0207677_10760997 | 3300026023 | Bacteria | 864 |
| 325 | Ga0207703_10025650 | 3300026035 | Unclassified | 4638 |
| 326 | Ga0207703_10689526 | 3300026035 | Bacteria | 971 |
| 327 | Ga0207678_11561162 | 3300026067 | Bacteria | 582 |
| 328 | Ga0207708_10098967 | 3300026075 | Bacteria | 2255 |
| 329 | Ga0207702_10776360 | 3300026078 | Unclassified | 947 |
| 330 | Ga0207641_11262126 | 3300026088 | Bacteria | 739 |
| 331 | Ga0207641_11330885 | 3300026088 | Unclassified | 719 |
| 332 | Ga0207641_11628763 | 3300026088 | Unclassified | 647 |
| 333 | Ga0207648_10600727 | 3300026089 | Bacteria | 1014 |
| 334 | Ga0207648_10738278 | 3300026089 | Unclassified | 914 |
| 335 | Ga0207676_10029207 | 3300026095 | Bacteria | 4126 |
| 336 | Ga0207676_10156092 | 3300026095 | Bacteria | 1972 |
| 337 | Ga0207676_10164785 | 3300026095 | Bacteria | 1924 |
| 338 | Ga0207676_10532206 | 3300026095 | Bacteria | 1120 |
| 339 | Ga0207674_10066997 | 3300026116 | Bacteria | 3615 |
| 340 | Ga0207674_10179973 | 3300026116 | Bacteria | 2066 |
| 341 | Ga0207674_10340202 | 3300026116 | Bacteria | 1451 |
| 342 | Ga0207674_10699247 | 3300026116 | Unclassified | 979 |
| 343 | Ga0207674_10942677 | 3300026116 | Unclassified | 832 |
| 344 | Ga0207674_11728942 | 3300026116 | Unclassified | 593 |
| 345 | Ga0207674_11978852 | 3300026116 | Unclassified | 548 |
| 346 | Ga0207675_100083324 | 3300026118 | Bacteria | 2999 |
| 347 | Ga0207675_100559360 | 3300026118 | Bacteria | 1144 |
| 348 | Ga0207675_101382663 | 3300026118 | Unclassified | 725 |
| 349 | Ga0207683_10710086 | 3300026121 | Unclassified | 932 |
| 350 | Ga0207683_10937815 | 3300026121 | Bacteria | 804 |
| 351 | Ga0207698_11750398 | 3300026142 | Unclassified | 637 |
| 352 | Ga0209995_1039136 | 3300027471 | Bacteria | 799 |
| 353 | Ga0209966_1063481 | 3300027695 | Unclassified | 801 |
| 354 | Ga0209813_10223512 | 3300027866 | Unclassified | 706 |
| 355 | Ga0207428_10011794 | 3300027907 | Bacteria | 7703 |
| 356 | Ga0207428_10013618 | 3300027907 | Bacteria | 7094 |
| 357 | Ga0207428_10042472 | 3300027907 | Unclassified | 3677 |
| 358 | Ga0207428_10114618 | 3300027907 | Unclassified | 2071 |
| 359 | Ga0268266_10354025 | 3300028379 | Unclassified | 1380 |
| 360 | Ga0268266_12074098 | 3300028379 | Unclassified | 542 |
| 361 | Ga0268265_10500454 | 3300028380 | Bacteria | 1145 |
| 362 | Ga0268265_10529014 | 3300028380 | Bacteria | 1116 |
| 363 | Ga0268265_10680391 | 3300028380 | Unclassified | 992 |
| 364 | Ga0268264_10732415 | 3300028381 | Unclassified | 984 |
| 365 | Ga0268264_10858003 | 3300028381 | Bacteria | 910 |
| 366 | Ga0265330_10295268 | 3300031235 | Bacteria | 683 |
| 367 | Ga0265332_10302608 | 3300031238 | Bacteria | 660 |
| 368 | Ga0265316_10055179 | 3300031344 | Bacteria | 3109 |
| 369 | Ga0307408_100017034 | 3300031548 | Bacteria | 4860 |
| 370 | Ga0307408_100069007 | 3300031548 | Bacteria | 2605 |
| 371 | Ga0307408_100522474 | 3300031548 | Bacteria | 1043 |
| 372 | Ga0307405_10005945 | 3300031731 | Bacteria | 5953 |
| 373 | Ga0307405_10007899 | 3300031731 | Bacteria | 5359 |
| 374 | Ga0307413_10015597 | 3300031824 | Bacteria | 3900 |
| 375 | Ga0307413_10017098 | 3300031824 | Bacteria | 3769 |
| 376 | Ga0307410_10040851 | 3300031852 | Bacteria | 3055 |
| 377 | Ga0307410_10378504 | 3300031852 | Bacteria | 1138 |
| 378 | Ga0307410_11818189 | 3300031852 | Unclassified | 541 |
| 379 | Ga0307406_10434476 | 3300031901 | Bacteria | 1049 |
| 380 | Ga0307406_10911171 | 3300031901 | Bacteria | 749 |
| 381 | Ga0307407_10018933 | 3300031903 | Bacteria | 3495 |
| 382 | Ga0307412_10005536 | 3300031911 | Bacteria | 7093 |
| 383 | Ga0307412_10016028 | 3300031911 | Bacteria | 4454 |
| 384 | Ga0307409_100005053 | 3300031995 | Bacteria | 7517 |
| 385 | Ga0307409_100005870 | 3300031995 | Bacteria | 7130 |
| 386 | Ga0307409_100288059 | 3300031995 | Bacteria | 1522 |
| 387 | Ga0307409_100292194 | 3300031995 | Bacteria | 1512 |
| 388 | Ga0307409_100453543 | 3300031995 | Bacteria | 1238 |
| 389 | Ga0307416_100009763 | 3300032002 | Bacteria | 6306 |
| 390 | Ga0307416_100019343 | 3300032002 | Bacteria | 4825 |
| 391 | Ga0307416_100540754 | 3300032002 | Unclassified | 1237 |
| 392 | Ga0307414_10008200 | 3300032004 | Bacteria | 5910 |
| 393 | Ga0307414_10241375 | 3300032004 | Bacteria | 1496 |
| 394 | Ga0307414_11531688 | 3300032004 | Bacteria | 621 |
| 395 | Ga0307411_10007514 | 3300032005 | Bacteria | 5562 |
| 396 | Ga0307411_10705737 | 3300032005 | Unclassified | 879 |
| 397 | Ga0307415_100390654 | 3300032126 | Bacteria | 1184 |
| 398 | Ga0307415_100454421 | 3300032126 | Bacteria | 1108 |
| 399 | Ga0373934_0028994 | 3300035086 | Unclassified | 2159 |
| 400 | Ga0373952_0076626 | 3300035092 | Unclassified | 846 |
| 401 | Ga0373923_0342045 | 3300035111 | Bacteria | 713 |
| 402 | Ga0373932_0365181 | 3300035112 | Bacteria | 552 |
| 403 | Ga0373945_0015846 | 3300035116 | Bacteria | 2540 |
| 404 | Ga0373954_0013807 | 3300035118 | Unclassified | 3599 |
| 405 | Ga0373954_0262399 | 3300035118 | Unclassified | 851 |
| 406 | Ga0373956_0008699 | 3300035119 | Unclassified | 4112 |
| 407 | Ga0373956_0109247 | 3300035119 | Bacteria | 1287 |
| 408 | Ga0373957_0019824 | 3300035120 | Bacteria | 2370 |
| 409 | Ga0373957_0108991 | 3300035120 | Unclassified | 1114 |
| 410 | Ga0373943_0008295 | 3300035170 | Bacteria | 4663 |
| 411 | Ga0373955_0002092 | 3300035172 | Bacteria | 8613 |
| 412 | Ga0373955_0793835 | 3300035172 | Unclassified | 582 |
| 413 | Ga0373961_0117109 | 3300035241 | Bacteria | 879 |
| 414 | Ga0373962_0239246 | 3300035242 | Unclassified | 627 |
| 415 | Ga0373931_0143781 | 3300035691 | Bacteria | 1384 |
| 416 | Ga0373931_0300468 | 3300035691 | Unclassified | 991 |
| 417 | Ga0373935_0087058 | 3300035692 | Unclassified | 2039 |
| 418 | Ga0373927_0000960 | 3300035695 | Bacteria | 21995 |
| 419 | Ga0373933_0013030 | 3300035724 | Unclassified | 4602 |
| 420 | Ga0373933_0434121 | 3300035724 | Unclassified | 858 |
| 421 | Ga0373947_0000896 | 3300035725 | Bacteria | 18050 |
| 422 | Ga0373937_0000017 | 3300036401 | Bacteria | 144650 |
| 423 | Ga0373937_0031757 | 3300036401 | Bacteria | 4787 |
| 424 | Ga0373937_0107931 | 3300036401 | Bacteria | 2588 |
| 425 | Ga0373937_0932413 | 3300036401 | Unclassified | 817 |
| 426 | Ga0373925_0004652 | 3300037068 | Bacteria | 10360 |
| 427 | Ga0436364_0842285 | 3300037853 | Unclassified | 1797 |
| 428 | Ga0242420_029206 | 3300038996 | Bacteria | 1017 |
| 429 | Ga0439439_0090360 | 3300041406 | Bacteria | 836 |
| 430 | Ga0439461_0033181 | 3300041410 | Bacteria | 1085 |
| 431 | Ga0439431_0042370 | 3300041997 | Bacteria | 1163 |
| 432 | Ga0439431_0190878 | 3300041997 | Bacteria | 594 |
| 433 | Ga0439454_112109 | 3300042011 | Unclassified | 521 |
| 434 | Ga0439457_155262 | 3300042014 | Unclassified | 552 |
| 435 | Ga0450919_039210 | 3300042121 | Bacteria | 549 |
| 436 | Ga0450923_035390 | 3300042125 | Bacteria | 1033 |
| 437 | Ga0439446_0034548 | 3300042156 | Bacteria | 1472 |
| 438 | Ga0439434_0029301 | 3300042435 | Bacteria | 1669 |
| 439 | Ga0439434_0051953 | 3300042435 | Unclassified | 1272 |
| 440 | Ga0439435_0007071 | 3300042436 | Unclassified | 2551 |
| 441 | Ga0439444_0010412 | 3300042437 | Unclassified | 1485 |
| 442 | Ga0451577_1810843 | 3300042876 | Unclassified | 536 |
| 443 | Ga0451576_0666663 | 3300045051 | Bacteria | 1093 |
| 444 | Ga0451576_0823224 | 3300045051 | Unclassified | 975 |
| 445 | Ga0451576_2252976 | 3300045051 | Unclassified | 559 |
| 446 | Ga0495651_0057645 | 3300046462 | Unclassified | 2982 |
| 447 | Ga0495653_0329616 | 3300046463 | Bacteria | 987 |
| 448 | Ga0495580_0406789 | 3300046472 | Archaea | 917 |
| 449 | Ga0495664_0348580 | 3300046477 | Unclassified | 892 |
| 450 | Ga0495594_0087746 | 3300046499 | Unclassified | 1741 |
| 451 | Ga0495608_0221177 | 3300046511 | Unclassified | 1188 |
| 452 | Ga0495608_0428746 | 3300046511 | Unclassified | 806 |
| 453 | Ga0495618_0305523 | 3300046514 | Bacteria | 988 |
| 454 | Ga0495665_0174740 | 3300046531 | Bacteria | 1117 |
| 455 | Ga0495640_0837065 | 3300046533 | Unclassified | 547 |
| 456 | Ga0495586_0166656 | 3300046535 | Unclassified | 1244 |
| 457 | Ga0495587_0683106 | 3300046536 | Unclassified | 563 |
| 458 | Ga0495598_0257688 | 3300046537 | Unclassified | 648 |
| 459 | Ga0495621_0132980 | 3300046539 | Unclassified | 969 |
| 460 | Ga0495645_0057747 | 3300046543 | Unclassified | 2816 |
| 461 | Ga0495633_0081674 | 3300046558 | Unclassified | 1504 |
| 462 | Ga0495667_0442836 | 3300046559 | Unclassified | 817 |
| 463 | Ga0495635_0587760 | 3300046663 | Unclassified | 728 |
| 464 | Ga0495635_0871306 | 3300046663 | Unclassified | 578 |
| 465 | Ga0495657_0560822 | 3300046675 | Bacteria | 663 |
| 466 | Ga0495623_0215409 | 3300046679 | Bacteria | 1097 |
| 467 | Ga0495669_0096741 | 3300046684 | Unclassified | 1368 |
| 468 | Ga0495600_0067930 | 3300046809 | Unclassified | 2330 |
| 469 | Ga0495604_0744435 | 3300047317 | Unclassified | 620 |
| 470 | Ga0495674_0523494 | 3300047319 | Unclassified | 946 |
| 471 | Ga0495680_0493097 | 3300047322 | Bacteria | 832 |
| 472 | Ga0495680_0741167 | 3300047322 | Unclassified | 646 |
| 473 | Ga0495675_0166555 | 3300047444 | Bacteria | 1355 |
| 474 | Ga0495684_0434088 | 3300047471 | Bacteria | 916 |
| 475 | Ga0495684_0792263 | 3300047471 | Unclassified | 620 |
| 476 | Ga0496107_0806554 | 3300048910 | Unclassified | 687 |
| 477 | Ga0496109_0217269 | 3300048912 | Unclassified | 1798 |
| 478 | Ga0496109_0635266 | 3300048912 | Bacteria | 1004 |
| 479 | Ga0496114_0000387 | 3300048917 | Bacteria | 32535 |
| 480 | Ga0501291_127476 | 3300049514 | Unclassified | 558 |
| 481 | Ga0501299_132140 | 3300049522 | Unclassified | 613 |
| 482 | Ga0501031_0009027 | 3300049568 | Bacteria | 6489 |
| 483 | Ga0501032_0001308 | 3300049569 | Bacteria | 19955 |
| 484 | Ga0501032_0023328 | 3300049569 | Unclassified | 4278 |
| 485 | Ga0501032_0142117 | 3300049569 | Unclassified | 1580 |
| 486 | Ga0501033_0210507 | 3300049570 | Bacteria | 1386 |
| 487 | Ga0501034_0009959 | 3300049571 | Bacteria | 9934 |
| 488 | Ga0501034_0021837 | 3300049571 | Bacteria | 6521 |
| 489 | Ga0501034_0061629 | 3300049571 | Bacteria | 3766 |
| 490 | Ga0501036_0042567 | 3300049572 | Unclassified | 3845 |
| 491 | Ga0501037_0004354 | 3300049573 | Bacteria | 10276 |
| 492 | Ga0501038_0004194 | 3300049574 | Bacteria | 13389 |
| 493 | Ga0501038_0009033 | 3300049574 | Bacteria | 9146 |
| 494 | Ga0501038_0631805 | 3300049574 | Bacteria | 808 |
| 495 | Ga0501039_0003518 | 3300049575 | Bacteria | 11731 |
| 496 | Ga0501039_0009520 | 3300049575 | Bacteria | 7404 |
| 497 | Ga0501040_0348555 | 3300049576 | Unclassified | 1061 |
| 498 | Ga0501041_0157537 | 3300049577 | Bacteria | 1419 |
| 499 | Ga0501043_0005275 | 3300049579 | Bacteria | 10447 |
| 500 | Ga0501043_0016794 | 3300049579 | Bacteria | 5735 |
| 501 | Ga0501043_0019110 | 3300049579 | Bacteria | 5379 |
| 502 | Ga0501046_0002457 | 3300049580 | Bacteria | 17380 |
| 503 | Ga0501046_0008051 | 3300049580 | Bacteria | 9212 |
| 504 | Ga0501047_0004623 | 3300049581 | Bacteria | 12952 |
| 505 | Ga0501047_0009579 | 3300049581 | Bacteria | 9154 |
| 506 | Ga0501047_0046391 | 3300049581 | Bacteria | 4199 |
| 507 | Ga0501048_1057871 | 3300049582 | Unclassified | 584 |
| 508 | Ga0501048_1309989 | 3300049582 | Bacteria | 521 |
| 509 | Ga0501067_0002231 | 3300049583 | Bacteria | 10694 |
| 510 | Ga0501067_0006552 | 3300049583 | Bacteria | 6454 |
| 511 | Ga0501067_0074247 | 3300049583 | Unclassified | 1884 |
| 512 | Ga0501068_0000159 | 3300049584 | Bacteria | 31176 |
| 513 | Ga0501068_0001669 | 3300049584 | Bacteria | 11859 |
| 514 | Ga0501068_0003936 | 3300049584 | Bacteria | 8080 |
| 515 | Ga0501069_0001919 | 3300049585 | Bacteria | 10383 |
| 516 | Ga0501069_0012287 | 3300049585 | Bacteria | 4551 |
| 517 | Ga0501069_0029968 | 3300049585 | Bacteria | 2987 |
| 518 | Ga0501070_0043397 | 3300049586 | Bacteria | 3742 |
| 519 | Ga0501070_0046811 | 3300049586 | Bacteria | 3596 |
| 520 | Ga0501071_1332212 | 3300049587 | Unclassified | 554 |
| 521 | Ga0501072_0006932 | 3300049588 | Bacteria | 8600 |
| 522 | Ga0501072_0021053 | 3300049588 | Bacteria | 5058 |
| 523 | Ga0501072_0479496 | 3300049588 | Unclassified | 984 |
| 524 | Ga0501072_0969591 | 3300049588 | Unclassified | 663 |
| 525 | Ga0501073_0002400 | 3300049589 | Bacteria | 14015 |
| 526 | Ga0501073_0006223 | 3300049589 | Bacteria | 8906 |
| 527 | Ga0501073_0066222 | 3300049589 | Unclassified | 2518 |
| 528 | Ga0501074_0068949 | 3300049590 | Bacteria | 2542 |
| 529 | Ga0501075_0183736 | 3300049591 | Bacteria | 1595 |
| 530 | Ga0501075_1504191 | 3300049591 | Unclassified | 510 |
| 531 | Ga0501076_0003119 | 3300049592 | Bacteria | 11548 |
| 532 | Ga0501076_0290662 | 3300049592 | Bacteria | 1339 |
| 533 | Ga0501076_0959550 | 3300049592 | Unclassified | 705 |
| 534 | Ga0501077_0010368 | 3300049593 | Bacteria | 5798 |
| 535 | Ga0501077_0724762 | 3300049593 | Unclassified | 639 |
| 536 | Ga0501216_075254 | 3300049660 | Unclassified | 705 |
| 537 | Ga0501238_028197 | 3300049671 | Unclassified | 807 |
| 538 | Ga0501249_031996 | 3300049679 | Bacteria | 1175 |
| 539 | Ga0501252_052287 | 3300049682 | Unclassified | 619 |
| 540 | Ga0501260_025828 | 3300049689 | Bacteria | 656 |
| 541 | Ga0501079_0005815 | 3300049741 | Bacteria | 9222 |
| 542 | Ga0501079_0305965 | 3300049741 | Unclassified | 1244 |
| 543 | Ga0501080_0002837 | 3300049742 | Bacteria | 15227 |
| 544 | Ga0501080_0003704 | 3300049742 | Bacteria | 13488 |
| 545 | Ga0501083_0022049 | 3300049744 | Unclassified | 4421 |
| 546 | Ga0501267_010933 | 3300049764 | Unclassified | 920 |
| 547 | Ga0501273_018413 | 3300049770 | Unclassified | 929 |
| 548 | Ga0501035_0056744 | 3300049822 | Unclassified | 3493 |
| 549 | Ga0501035_0357623 | 3300049822 | Bacteria | 1221 |
| 550 | Ga0501035_0368960 | 3300049822 | Unclassified | 1198 |
| 551 | Ga0501044_0014724 | 3300049823 | Bacteria | 8432 |
| 552 | Ga0501044_0043968 | 3300049823 | Bacteria | 4638 |
| 553 | nmdc:mga06z11_164471_c1 | 3300050494 | Unclassified | 1270 |
| 554 | nmdc:mga04h51_253323_c1 | 3300050495 | Unclassified | 706 |
| 555 | nmdc:mga05p37_1908945_c1 | 3300050507 | Unclassified | 567 |
| 556 | nmdc:mga05p37_470848_c1 | 3300050507 | Bacteria | 1450 |
| 557 | nmdc:mga05p37_645726_c1 | 3300050507 | Bacteria | 1186 |
| 558 | nmdc:mga05p37_852260_c1 | 3300050507 | Bacteria | 989 |
| 559 | nmdc:mga09592_429550_c1 | 3300050508 | Bacteria | 1140 |
| 560 | nmdc:mga09592_56889_c2 | 3300050508 | Bacteria | 2315 |
| 561 | nmdc:mga0qj67_157431_c1 | 3300050509 | Bacteria | 1844 |
| 562 | nmdc:mga0qj67_158563_c1 | 3300050509 | Bacteria | 1837 |
| 563 | nmdc:mga0qj67_82115_c1 | 3300050509 | Bacteria | 2584 |
| 564 | nmdc:mga06r32_119545_c1 | 3300050510 | Unclassified | 2598 |
| 565 | nmdc:mga06r32_1267679_c1 | 3300050510 | Unclassified | 682 |
| 566 | nmdc:mga06r32_16950_c1 | 3300050510 | Bacteria | 6646 |
| 567 | nmdc:mga06r32_193101_c1 | 3300050510 | Bacteria | 2023 |
| 568 | nmdc:mga06r32_209930_c1 | 3300050510 | Bacteria | 1935 |
| 569 | nmdc:mga06r32_241792_c1 | 3300050510 | Bacteria | 1793 |
| 570 | nmdc:mga06r32_30671_c1 | 3300050510 | Bacteria | 5046 |
| 571 | nmdc:mga08y16_1528474_c1 | 3300050511 | Bacteria | 627 |
| 572 | nmdc:mga08y16_214921_c1 | 3300050511 | Bacteria | 1991 |
| 573 | nmdc:mga08y16_24686_c1 | 3300050511 | Bacteria | 6344 |
| 574 | nmdc:mga08y16_37936_c1 | 3300050511 | Bacteria | 5059 |
| 575 | nmdc:mga08y16_39366_c1 | 3300050511 | Unclassified | 4961 |
| 576 | nmdc:mga08y16_399027_c1 | 3300050511 | Bacteria | 1408 |
| 577 | nmdc:mga08y16_50651_c1 | 3300050511 | Unclassified | 4346 |
| 578 | nmdc:mga08y16_64295_c1 | 3300050511 | Unclassified | 3831 |
| 579 | nmdc:mga0n895_846181_c1 | 3300050512 | Bacteria | 903 |
| 580 | nmdc:mga08x19_1050855_c1 | 3300050514 | Unclassified | 578 |
| 581 | Ga0495601_0226296 | 3300053077 | Bacteria | 1222 |
| 582 | Ga0495601_0599426 | 3300053077 | Unclassified | 707 |
| 583 | Ga0495595_0190506 | 3300053084 | Bacteria | 1019 |
| 584 | Ga0495619_0095037 | 3300053085 | Bacteria | 2022 |
| 585 | Ga0500568_0005021 | 3300053139 | Bacteria | 6934 |
| 586 | Ga0501084_0008786 | 3300054114 | Bacteria | 8357 |
| 587 | Ga0501084_0189296 | 3300054114 | Unclassified | 1736 |
| 588 | Ga0501082_0006494 | 3300060353 | Bacteria | 10136 |
| 589 | Ga0501082_0008474 | 3300060353 | Bacteria | 8864 |
| 590 | Ga0530510_0702244 | 3300061734 | Unclassified | 771 |
| 591 | Ga0070684_100569551 | |||
| 592 | JGI24751J29686_10016534 | |||
| 593 | Ga0065712_10107522 | |||
| 594 | Ga0065712_10335027 | |||
| 595 | Ga0065707_10637140 | |||
| 596 | Ga0065707_10932714 | |||
| 597 | Ga0070683_100126921 | |||
| 598 | Ga0070683_100492311 | |||
| 599 | Ga0070690_100308093 | |||
| 600 | Ga0070670_100009679 | |||
| 601 | Ga0070670_100018703 | |||
| 602 | Ga0070670_100029182 | |||
| 603 | Ga0070670_100030565 | |||
| 604 | Ga0070670_100088405 | |||
| 605 | Ga0070670_101036167 | |||
| 606 | Ga0070677_10574739 | |||
| 607 | Ga0070677_10844593 | |||
| 608 | Ga0068869_100121546 | |||
| 609 | Ga0070666_10823051 | |||
| 610 | Ga0070680_100438846 | |||
| 611 | Ga0070689_100053933 | |||
| 612 | Ga0070689_100204357 | |||
| 613 | Ga0070689_100313642 | |||
| 614 | Ga0070689_100781452 | |||
| 615 | Ga0070691_11063644 | |||
| 616 | Ga0070687_100146227 | |||
| 617 | Ga0070661_101365702 | |||
| 618 | Ga0070668_101950237 | |||
| 619 | Ga0070669_100404390 | |||
| 620 | Ga0070669_100763799 | |||
| 621 | Ga0070669_101042478 | |||
| 622 | Ga0070669_101149193 | |||
| 623 | Ga0070675_100001320 | |||
| 624 | Ga0070675_100192563 | |||
| 625 | Ga0070675_100410432 | |||
| 626 | Ga0070675_100546642 | |||
| 627 | Ga0070675_100947728 | |||
| 628 | Ga0070671_100563230 | |||
| 629 | Ga0070671_100579424 | |||
| 630 | Ga0070671_101477680 | |||
| 631 | Ga0070671_101653205 | |||
| 632 | Ga0070671_101848494 | |||
| 633 | Ga0070673_100040819 | |||
| 634 | Ga0070673_100208943 | |||
| 635 | Ga0070673_101701668 | |||
| 636 | Ga0070688_100085518 | |||
| 637 | Ga0070688_100091161 | |||
| 638 | Ga0070688_100094483 | |||
| 639 | Ga0070659_100419156 | |||
| 640 | Ga0070709_10204925 | |||
| 641 | Ga0070709_10473338 | |||
| 642 | Ga0070714_100122319 | |||
| 643 | Ga0070713_100155120 | |||
| 644 | Ga0070713_100197376 | |||
| 645 | Ga0070713_100474597 | |||
| 646 | Ga0070713_101420458 | |||
| 647 | Ga0070713_101988929 | |||
| 648 | Ga0070710_10966350 | |||
| 649 | Ga0070711_100124767 | |||
| 650 | Ga0070711_100174106 | |||
| 651 | Ga0070700_100930186 | |||
| 652 | Ga0070694_100126155 | |||
| 653 | Ga0070678_101019821 | |||
| 654 | Ga0070678_101603764 | |||
| 655 | Ga0070662_100602952 | |||
| 656 | Ga0070681_11562026 | |||
| 657 | Ga0068867_100403611 | |||
| 658 | Ga0068867_100840884 | |||
| 659 | Ga0070685_10083495 | |||
| 660 | Ga0070699_100270338 | |||
| 661 | Ga0070684_100440529 | |||
| 662 | Ga0070684_100893835 | |||
| 663 | Ga0070672_100065048 | |||
| 664 | Ga0070672_100374367 | |||
| 665 | Ga0070672_100520043 | |||
| 666 | Ga0070686_100303954 | |||
| 667 | Ga0070695_100033420 | |||
| 668 | Ga0070696_100104393 | |||
| 669 | Ga0070696_100752278 | |||
| 670 | Ga0070696_100865063 | |||
| 671 | Ga0070693_100029000 | |||
| 672 | Ga0070693_100129060 | |||
| 673 | Ga0070665_100177311 | |||
| 674 | Ga0070704_100244604 | |||
| 675 | Ga0068855_101484792 | |||
| 676 | Ga0070664_100052487 | |||
| 677 | Ga0070664_100078672 | |||
| 678 | Ga0070664_100297487 | |||
| 679 | Ga0070664_100817851 | |||
| 680 | Ga0068857_100157870 | |||
| 681 | Ga0068857_101964352 | |||
| 682 | Ga0068854_100284846 | |||
| 683 | Ga0068856_100019305 | |||
| 684 | Ga0068856_101739253 | |||
| 685 | Ga0068856_101911439 | |||
| 686 | Ga0068852_102799657 | |||
| 687 | Ga0068859_100001265 | |||
| 688 | Ga0068859_100097682 | |||
| 689 | Ga0068859_100582857 | |||
| 690 | Ga0068859_100720698 | |||
| 691 | Ga0068859_100880592 | |||
| 692 | Ga0068859_101083103 | |||
| 693 | Ga0068859_101569313 | |||
| 694 | Ga0068859_101722715 | |||
| 695 | Ga0068864_100025611 | |||
| 696 | Ga0068864_100063185 | |||
| 697 | Ga0068864_100134760 | |||
| 698 | Ga0068864_100334554 | |||
| 699 | Ga0068864_100374655 | |||
| 700 | Ga0068866_10395468 | |||
| 701 | Ga0068861_100163420 | |||
| 702 | Ga0068861_100740910 | |||
| 703 | Ga0068870_10381781 | |||
| 704 | Ga0068870_11005070 | |||
| 705 | Ga0068870_11444622 | |||
| 706 | Ga0068863_101165667 | |||
| 707 | Ga0068858_100078194 | |||
| 708 | Ga0068858_101181717 | |||
| 709 | Ga0068858_101702599 | |||
| 710 | Ga0068860_101092839 | |||
| 711 | Ga0068860_101483059 | |||
| 712 | Ga0068862_100322641 | |||
| 713 | Ga0068862_101171496 | |||
| 714 | Ga0068862_102531415 | |||
| 715 | Ga0081455_10320901 | |||
| 716 | Ga0070717_10031029 | |||
| 717 | Ga0070717_10097241 | |||
| 718 | Ga0070717_10444974 | |||
| 719 | Ga0075364_10181277 | |||
| 720 | Ga0070716_100398057 | |||
| 721 | Ga0075367_10022072 | |||
| 722 | Ga0075366_10069274 | |||
| 723 | Ga0097621_100001248 | |||
| 724 | Ga0097621_100351637 | |||
| 725 | Ga0097621_101088212 | |||
| 726 | Ga0068871_100000496 | |||
| 727 | Ga0068871_100286727 | |||
| 728 | Ga0068871_100808806 | |||
| 729 | Ga0075428_100133935 | |||
| 730 | Ga0075428_100187812 | |||
| 731 | Ga0075428_100253078 | |||
| 732 | Ga0075430_100007735 | |||
| 733 | Ga0075430_100222556 | |||
| 734 | Ga0075430_100644875 | |||
| 735 | Ga0075431_100028618 | |||
| 736 | Ga0075431_100099882 | |||
| 737 | Ga0075431_100280871 | |||
| 738 | Ga0075431_100346677 | |||
| 739 | Ga0075431_101410263 | |||
| 740 | Ga0075429_100077220 | |||
| 741 | Ga0075429_100110332 | |||
| 742 | Ga0075429_101182135 | |||
| 743 | Ga0068865_100074214 | |||
| 744 | Ga0068865_100862748 | |||
| 745 | Ga0097620_100001265 | |||
| 746 | Ga0097620_100097683 | |||
| 747 | Ga0097620_100582842 | |||
| 748 | Ga0097620_100720682 | |||
| 749 | Ga0097620_100880645 | |||
| 750 | Ga0097620_101083192 | |||
| 751 | Ga0097620_101569135 | |||
| 752 | Ga0097620_101722379 | |||
| 753 | Ga0099795_10331068 | |||
| 754 | Ga0105240_10009400 | |||
| 755 | Ga0105240_10104476 | |||
| 756 | Ga0105240_10158944 | |||
| 757 | Ga0105240_10296102 | |||
| 758 | Ga0105240_10581395 | |||
| 759 | Ga0111539_10003328 | |||
| 760 | Ga0111539_10020865 | |||
| 761 | Ga0111539_10056271 | |||
| 762 | Ga0111539_10338955 | |||
| 763 | Ga0111539_11129080 | |||
| 764 | Ga0111539_11918463 | |||
| 765 | Ga0111539_12316478 | |||
| 766 | Ga0105245_10054341 | |||
| 767 | Ga0105245_10062240 | |||
| 768 | Ga0105245_11457545 | |||
| 769 | Ga0114129_10321576 | |||
| 770 | Ga0114129_11353015 | |||
| 771 | Ga0114129_11699639 | |||
| 772 | Ga0114129_12150740 | |||
| 773 | Ga0105243_11340989 | |||
| 774 | Ga0105243_12399985 | |||
| 775 | Ga0105241_10323130 | |||
| 776 | Ga0105241_10605577 | |||
| 777 | Ga0105242_10280276 | |||
| 778 | Ga0105242_10706463 | |||
| 779 | Ga0105242_11112646 | |||
| 780 | Ga0105248_10013908 | |||
| 781 | Ga0105248_10056861 | |||
| 782 | Ga0105248_10134885 | |||
| 783 | Ga0105248_10435958 | |||
| 784 | Ga0105248_11067858 | |||
| 785 | Ga0105248_11721780 | |||
| 786 | Ga0105248_12551858 | |||
| 787 | Ga0105248_13023537 | |||
| 788 | Ga0105237_10018552 | |||
| 789 | Ga0105237_10443109 | |||
| 790 | Ga0105237_12736306 | |||
| 791 | Ga0105238_10081370 | |||
| 792 | Ga0105238_10625549 | |||
| 793 | Ga0105238_12264509 | |||
| 794 | Ga0105249_10064870 | |||
| 795 | Ga0105249_10167287 | |||
| 796 | Ga0105249_10282944 | |||
| 797 | Ga0105249_12292743 | |||
| 798 | Ga0105239_10053225 | |||
| 799 | Ga0105239_10723462 | |||
| 800 | Ga0105239_11545507 | |||
| 801 | Ga0105246_11479371 | |||
| 802 | Ga0105246_12459688 | |||
| 803 | Ga0157370_10800989 | |||
| 804 | Ga0157369_10103360 | |||
| 805 | Ga0157369_10434897 | |||
| 806 | Ga0157369_10445980 | |||
| 807 | Ga0157369_10607716 | |||
| 808 | Ga0157374_11136246 | |||
| 809 | Ga0157378_10239178 | |||
| 810 | Ga0157378_10716911 | |||
| 811 | Ga0163162_10257492 | |||
| 812 | Ga0163162_10903111 | |||
| 813 | Ga0163162_12013959 | |||
| 814 | Ga0163162_12284592 | |||
| 815 | Ga0157372_10005852 | |||
| 816 | Ga0157372_10096059 | |||
| 817 | Ga0157372_10502369 | |||
| 818 | Ga0157375_10998682 | |||
| 819 | Ga0163163_10002902 | |||
| 820 | Ga0163163_10035368 | |||
| 821 | Ga0163163_10070392 | |||
| 822 | Ga0163163_13087730 | |||
| 823 | Ga0157380_10198242 | |||
| 824 | Ga0157380_10979420 | |||
| 825 | Ga0157380_11409408 | |||
| 826 | Ga0157380_12264142 | |||
| 827 | Ga0157377_10580785 | |||
| 828 | Ga0157379_10008520 | |||
| 829 | Ga0157376_10071603 | |||
| 830 | Ga0163161_10478386 | |||
| 831 | Ga0213876_10120051 | |||
| 832 | Ga0213875_10076752 | |||
| 833 | Ga0207697_10175963 | |||
| 834 | Ga0207697_10457293 | |||
| 835 | Ga0207682_10331230 | |||
| 836 | Ga0207680_10689470 | |||
| 837 | Ga0207699_10726381 | |||
| 838 | Ga0207643_10282381 | |||
| 839 | Ga0207654_10194641 | |||
| 840 | Ga0207654_10321589 | |||
| 841 | Ga0207695_10031397 | |||
| 842 | Ga0207695_10074327 | |||
| 843 | Ga0207695_10339469 | |||
| 844 | Ga0207695_10470869 | |||
| 845 | Ga0207671_10646790 | |||
| 846 | Ga0207671_10675968 | |||
| 847 | Ga0207663_10065421 | |||
| 848 | Ga0207663_10153936 | |||
| 849 | Ga0207660_10056473 | |||
| 850 | Ga0207660_11234605 | |||
| 851 | Ga0207649_10827363 | |||
| 852 | Ga0207681_10297186 | |||
| 853 | Ga0207681_10344232 | |||
| 854 | Ga0207681_10363902 | |||
| 855 | Ga0207681_10376077 | |||
| 856 | Ga0207681_10897850 | |||
| 857 | Ga0207694_10018633 | |||
| 858 | Ga0207650_10005798 | |||
| 859 | Ga0207650_10032960 | |||
| 860 | Ga0207650_10150465 | |||
| 861 | Ga0207650_10787871 | |||
| 862 | Ga0207659_10001410 | |||
| 863 | Ga0207659_10164163 | |||
| 864 | Ga0207659_10733047 | |||
| 865 | Ga0207687_10002206 | |||
| 866 | Ga0207687_10275944 | |||
| 867 | Ga0207687_11114871 | |||
| 868 | Ga0207700_10005596 | |||
| 869 | Ga0207700_10071682 | |||
| 870 | Ga0207700_10740486 | |||
| 871 | Ga0207664_10056500 | |||
| 872 | Ga0207644_10762039 | |||
| 873 | Ga0207644_11370801 | |||
| 874 | Ga0207644_11804787 | |||
| 875 | Ga0207690_10620882 | |||
| 876 | Ga0207706_10624890 | |||
| 877 | Ga0207686_10337837 | |||
| 878 | Ga0207686_10409347 | |||
| 879 | Ga0207686_10433460 | |||
| 880 | Ga0207686_10443745 | |||
| 881 | Ga0207670_10129759 | |||
| 882 | Ga0207670_10191691 | |||
| 883 | Ga0207670_10345556 | |||
| 884 | Ga0207670_11183964 | |||
| 885 | Ga0207669_11454799 | |||
| 886 | Ga0207704_10195660 | |||
| 887 | Ga0207704_10392231 | |||
| 888 | Ga0207665_10367067 | |||
| 889 | Ga0207691_10011172 | |||
| 890 | Ga0207691_10464247 | |||
| 891 | Ga0207691_10508907 | |||
| 892 | Ga0207691_11366511 | |||
| 893 | Ga0207711_10001493 | |||
| 894 | Ga0207711_10138250 | |||
| 895 | Ga0207711_10340768 | |||
| 896 | Ga0207711_11114570 | |||
| 897 | Ga0207711_11295290 | |||
| 898 | Ga0207689_10074932 | |||
| 899 | Ga0207689_10765838 | |||
| 900 | Ga0207689_11296526 | |||
| 901 | Ga0207661_10228717 | |||
| 902 | Ga0207661_11587755 | |||
| 903 | Ga0207661_12149992 | |||
| 904 | Ga0207679_10036586 | |||
| 905 | Ga0207679_10077486 | |||
| 906 | Ga0207679_10319571 | |||
| 907 | Ga0207651_10030112 | |||
| 908 | Ga0207651_12044547 | |||
| 909 | Ga0207712_10089967 | |||
| 910 | Ga0207712_10465932 | |||
| 911 | Ga0207712_10491081 | |||
| 912 | Ga0207668_10406707 | |||
| 913 | Ga0207658_10280698 | |||
| 914 | Ga0207677_10760997 | |||
| 915 | Ga0207703_10025650 | |||
| 916 | Ga0207703_10689526 | |||
| 917 | Ga0207678_11561162 | |||
| 918 | Ga0207708_10098967 | |||
| 919 | Ga0207702_10776360 | |||
| 920 | Ga0207641_11262126 | |||
| 921 | Ga0207641_11330885 | |||
| 922 | Ga0207641_11628763 | |||
| 923 | Ga0207648_10600727 | |||
| 924 | Ga0207648_10738278 | |||
| 925 | Ga0207676_10029207 | |||
| 926 | Ga0207676_10156092 | |||
| 927 | Ga0207676_10164785 | |||
| 928 | Ga0207676_10532206 | |||
| 929 | Ga0207674_10066997 | |||
| 930 | Ga0207674_10179973 | |||
| 931 | Ga0207674_10340202 | |||
| 932 | Ga0207674_10699247 | |||
| 933 | Ga0207674_10942677 | |||
| 934 | Ga0207674_11728942 | |||
| 935 | Ga0207674_11978852 | |||
| 936 | Ga0207675_100083324 | |||
| 937 | Ga0207675_100559360 | |||
| 938 | Ga0207675_101382663 | |||
| 939 | Ga0207683_10710086 | |||
| 940 | Ga0207683_10937815 | |||
| 941 | Ga0207698_11750398 | |||
| 942 | Ga0209995_1039136 | |||
| 943 | Ga0209966_1063481 | |||
| 944 | Ga0209813_10223512 | |||
| 945 | Ga0207428_10011794 | |||
| 946 | Ga0207428_10013618 | |||
| 947 | Ga0207428_10042472 | |||
| 948 | Ga0207428_10114618 | |||
| 949 | Ga0268266_10354025 | |||
| 950 | Ga0268266_12074098 | |||
| 951 | Ga0268265_10500454 | |||
| 952 | Ga0268265_10529014 | |||
| 953 | Ga0268265_10680391 | |||
| 954 | Ga0268264_10732415 | |||
| 955 | Ga0268264_10858003 | |||
| 956 | Ga0265330_10295268 | |||
| 957 | Ga0265332_10302608 | |||
| 958 | Ga0265316_10055179 | |||
| 959 | Ga0307408_100017034 | |||
| 960 | Ga0307408_100069007 | |||
| 961 | Ga0307408_100522474 | |||
| 962 | Ga0307405_10005945 | |||
| 963 | Ga0307405_10007899 | |||
| 964 | Ga0307413_10015597 | |||
| 965 | Ga0307413_10017098 | |||
| 966 | Ga0307410_10040851 | |||
| 967 | Ga0307410_10378504 | |||
| 968 | Ga0307410_11818189 | |||
| 969 | Ga0307406_10434476 | |||
| 970 | Ga0307406_10911171 | |||
| 971 | Ga0307407_10018933 | |||
| 972 | Ga0307412_10005536 | |||
| 973 | Ga0307412_10016028 | |||
| 974 | Ga0307409_100005053 | |||
| 975 | Ga0307409_100005870 | |||
| 976 | Ga0307409_100288059 | |||
| 977 | Ga0307409_100292194 | |||
| 978 | Ga0307409_100453543 | |||
| 979 | Ga0307416_100009763 | |||
| 980 | Ga0307416_100019343 | |||
| 981 | Ga0307416_100540754 | |||
| 982 | Ga0307414_10008200 | |||
| 983 | Ga0307414_10241375 | |||
| 984 | Ga0307414_11531688 | |||
| 985 | Ga0307411_10007514 | |||
| 986 | Ga0307411_10705737 | |||
| 987 | Ga0307415_100390654 | |||
| 988 | Ga0307415_100454421 | |||
| 989 | Ga0373934_0028994 | |||
| 990 | Ga0373952_0076626 | |||
| 991 | Ga0373923_0342045 | |||
| 992 | Ga0373932_0365181 | |||
| 993 | Ga0373945_0015846 | |||
| 994 | Ga0373954_0013807 | |||
| 995 | Ga0373954_0262399 | |||
| 996 | Ga0373956_0008699 | |||
| 997 | Ga0373956_0109247 | |||
| 998 | Ga0373957_0019824 | |||
| 999 | Ga0373957_0108991 | |||
| 1000 | Ga0373943_0008295 | |||
| 1001 | Ga0373955_0002092 | |||
| 1002 | Ga0373955_0793835 | |||
| 1003 | Ga0373961_0117109 | |||
| 1004 | Ga0373962_0239246 | |||
| 1005 | Ga0373931_0143781 | |||
| 1006 | Ga0373931_0300468 | |||
| 1007 | Ga0373935_0087058 | |||
| 1008 | Ga0373927_0000960 | |||
| 1009 | Ga0373933_0013030 | |||
| 1010 | Ga0373933_0434121 | |||
| 1011 | Ga0373947_0000896 | |||
| 1012 | Ga0373937_0000017 | |||
| 1013 | Ga0373937_0031757 | |||
| 1014 | Ga0373937_0107931 | |||
| 1015 | Ga0373937_0932413 | |||
| 1016 | Ga0373925_0004652 | |||
| 1017 | Ga0436364_0842285 | |||
| 1018 | Ga0242420_029206 | |||
| 1019 | Ga0439439_0090360 | |||
| 1020 | Ga0439461_0033181 | |||
| 1021 | Ga0439431_0042370 | |||
| 1022 | Ga0439431_0190878 | |||
| 1023 | Ga0439454_112109 | |||
| 1024 | Ga0439457_155262 | |||
| 1025 | Ga0450919_039210 | |||
| 1026 | Ga0450923_035390 | |||
| 1027 | Ga0439446_0034548 | |||
| 1028 | Ga0439434_0029301 | |||
| 1029 | Ga0439434_0051953 | |||
| 1030 | Ga0439435_0007071 | |||
| 1031 | Ga0439444_0010412 | |||
| 1032 | Ga0451577_1810843 | |||
| 1033 | Ga0451576_0666663 | |||
| 1034 | Ga0451576_0823224 | |||
| 1035 | Ga0451576_2252976 | |||
| 1036 | Ga0495651_0057645 | |||
| 1037 | Ga0495653_0329616 | |||
| 1038 | Ga0495580_0406789 | |||
| 1039 | Ga0495664_0348580 | |||
| 1040 | Ga0495594_0087746 | |||
| 1041 | Ga0495608_0221177 | |||
| 1042 | Ga0495608_0428746 | |||
| 1043 | Ga0495618_0305523 | |||
| 1044 | Ga0495665_0174740 | |||
| 1045 | Ga0495640_0837065 | |||
| 1046 | Ga0495586_0166656 | |||
| 1047 | Ga0495587_0683106 | |||
| 1048 | Ga0495598_0257688 | |||
| 1049 | Ga0495621_0132980 | |||
| 1050 | Ga0495645_0057747 | |||
| 1051 | Ga0495633_0081674 | |||
| 1052 | Ga0495667_0442836 | |||
| 1053 | Ga0495635_0587760 | |||
| 1054 | Ga0495635_0871306 | |||
| 1055 | Ga0495657_0560822 | |||
| 1056 | Ga0495623_0215409 | |||
| 1057 | Ga0495669_0096741 | |||
| 1058 | Ga0495600_0067930 | |||
| 1059 | Ga0495604_0744435 | |||
| 1060 | Ga0495674_0523494 | |||
| 1061 | Ga0495680_0493097 | |||
| 1062 | Ga0495680_0741167 | |||
| 1063 | Ga0495675_0166555 | |||
| 1064 | Ga0495684_0434088 | |||
| 1065 | Ga0495684_0792263 | |||
| 1066 | Ga0496107_0806554 | |||
| 1067 | Ga0496109_0217269 | |||
| 1068 | Ga0496109_0635266 | |||
| 1069 | Ga0496114_0000387 | |||
| 1070 | Ga0501291_127476 | |||
| 1071 | Ga0501299_132140 | |||
| 1072 | Ga0501031_0009027 | |||
| 1073 | Ga0501032_0001308 | |||
| 1074 | Ga0501032_0023328 | |||
| 1075 | Ga0501032_0142117 | |||
| 1076 | Ga0501033_0210507 | |||
| 1077 | Ga0501034_0009959 | |||
| 1078 | Ga0501034_0021837 | |||
| 1079 | Ga0501034_0061629 | |||
| 1080 | Ga0501036_0042567 | |||
| 1081 | Ga0501037_0004354 | |||
| 1082 | Ga0501038_0004194 | |||
| 1083 | Ga0501038_0009033 | |||
| 1084 | Ga0501038_0631805 | |||
| 1085 | Ga0501039_0003518 | |||
| 1086 | Ga0501039_0009520 | |||
| 1087 | Ga0501040_0348555 | |||
| 1088 | Ga0501041_0157537 | |||
| 1089 | Ga0501043_0005275 | |||
| 1090 | Ga0501043_0016794 | |||
| 1091 | Ga0501043_0019110 | |||
| 1092 | Ga0501046_0002457 | |||
| 1093 | Ga0501046_0008051 | |||
| 1094 | Ga0501047_0004623 | |||
| 1095 | Ga0501047_0009579 | |||
| 1096 | Ga0501047_0046391 | |||
| 1097 | Ga0501048_1057871 | |||
| 1098 | Ga0501048_1309989 | |||
| 1099 | Ga0501067_0002231 | |||
| 1100 | Ga0501067_0006552 | |||
| 1101 | Ga0501067_0074247 | |||
| 1102 | Ga0501068_0000159 | |||
| 1103 | Ga0501068_0001669 | |||
| 1104 | Ga0501068_0003936 | |||
| 1105 | Ga0501069_0001919 | |||
| 1106 | Ga0501069_0012287 | |||
| 1107 | Ga0501069_0029968 | |||
| 1108 | Ga0501070_0043397 | |||
| 1109 | Ga0501070_0046811 | |||
| 1110 | Ga0501071_1332212 | |||
| 1111 | Ga0501072_0006932 | |||
| 1112 | Ga0501072_0021053 | |||
| 1113 | Ga0501072_0479496 | |||
| 1114 | Ga0501072_0969591 | |||
| 1115 | Ga0501073_0002400 | |||
| 1116 | Ga0501073_0006223 | |||
| 1117 | Ga0501073_0066222 | |||
| 1118 | Ga0501074_0068949 | |||
| 1119 | Ga0501075_0183736 | |||
| 1120 | Ga0501075_1504191 | |||
| 1121 | Ga0501076_0003119 | |||
| 1122 | Ga0501076_0290662 | |||
| 1123 | Ga0501076_0959550 | |||
| 1124 | Ga0501077_0010368 | |||
| 1125 | Ga0501077_0724762 | |||
| 1126 | Ga0501216_075254 | |||
| 1127 | Ga0501238_028197 | |||
| 1128 | Ga0501249_031996 | |||
| 1129 | Ga0501252_052287 | |||
| 1130 | Ga0501260_025828 | |||
| 1131 | Ga0501079_0005815 | |||
| 1132 | Ga0501079_0305965 | |||
| 1133 | Ga0501080_0002837 | |||
| 1134 | Ga0501080_0003704 | |||
| 1135 | Ga0501083_0022049 | |||
| 1136 | Ga0501267_010933 | |||
| 1137 | Ga0501273_018413 | |||
| 1138 | Ga0501035_0056744 | |||
| 1139 | Ga0501035_0357623 | |||
| 1140 | Ga0501035_0368960 | |||
| 1141 | Ga0501044_0014724 | |||
| 1142 | Ga0501044_0043968 | |||
| 1143 | nmdc:mga06z11_164471_c1 | |||
| 1144 | nmdc:mga04h51_253323_c1 | |||
| 1145 | nmdc:mga05p37_1908945_c1 | |||
| 1146 | nmdc:mga05p37_470848_c1 | |||
| 1147 | nmdc:mga05p37_645726_c1 | |||
| 1148 | nmdc:mga05p37_852260_c1 | |||
| 1149 | nmdc:mga09592_429550_c1 | |||
| 1150 | nmdc:mga09592_56889_c2 | |||
| 1151 | nmdc:mga0qj67_157431_c1 | |||
| 1152 | nmdc:mga0qj67_158563_c1 | |||
| 1153 | nmdc:mga0qj67_82115_c1 | |||
| 1154 | nmdc:mga06r32_119545_c1 | |||
| 1155 | nmdc:mga06r32_1267679_c1 | |||
| 1156 | nmdc:mga06r32_16950_c1 | |||
| 1157 | nmdc:mga06r32_193101_c1 | |||
| 1158 | nmdc:mga06r32_209930_c1 | |||
| 1159 | nmdc:mga06r32_241792_c1 | |||
| 1160 | nmdc:mga06r32_30671_c1 | |||
| 1161 | nmdc:mga08y16_1528474_c1 | |||
| 1162 | nmdc:mga08y16_214921_c1 | |||
| 1163 | nmdc:mga08y16_24686_c1 | |||
| 1164 | nmdc:mga08y16_37936_c1 | |||
| 1165 | nmdc:mga08y16_39366_c1 | |||
| 1166 | nmdc:mga08y16_399027_c1 | |||
| 1167 | nmdc:mga08y16_50651_c1 | |||
| 1168 | nmdc:mga08y16_64295_c1 | |||
| 1169 | nmdc:mga0n895_846181_c1 | |||
| 1170 | nmdc:mga08x19_1050855_c1 | |||
| 1171 | Ga0495601_0226296 | |||
| 1172 | Ga0495601_0599426 | |||
| 1173 | Ga0495595_0190506 | |||
| 1174 | Ga0495619_0095037 | |||
| 1175 | Ga0500568_0005021 | |||
| 1176 | Ga0501084_0008786 | |||
| 1177 | Ga0501084_0189296 | |||
| 1178 | Ga0501082_0006494 | |||
| 1179 | Ga0501082_0008474 | |||
| 1180 | Ga0530510_0702244 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.907 | 9 | 71 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9048 | 9 | 71 |
| 4ija-assembly1.cif.gz_A | structure of s. aureus methicillin resistance factor mecr2 | 0.8732 | 11 | 69 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8659 | 4 | 72 |
| 2xig-assembly2.cif.gz_A | the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites | 0.8656 | 12 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9192 | 6 | 68 | 1.10.10.10 |
| 5j6xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.907 | 9 | 71 | 1.10.10.10 |
| 4lb5B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9048 | 9 | 71 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8911 | 6 | 68 | 1.10.10.10 |
| af_P76066_81_136_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8746 | 10 | 68 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3LD04-F1-model_v4 | Transcriptional repressor, CopY family | 0.9624 | 1 | 130 |
GO:0003677
GO:0045892 |
| AF-A0A2U3LD04-F1-model_v4 | Transcriptional repressor, CopY family | 0.9483 | 1 | 130 |
GO:0003677
GO:0045892 |
| AF-A0A3N5L3E6-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.9269 | 1 | 126 |
GO:0003677
GO:0045892 |
| AF-A0A6N8WJ80-F1-model_v4 | deleted | 0.9255 | 4 | 126 |
|
| AF-A0A2N9MV04-F1-model_v4 | Transcriptional repressor, CopY family | 0.9226 | 1 | 81 |
GO:0003677
GO:0045892 |