F467010

General Info

Members Datasets Scaffolds Average Seq Length
590 330 578 188

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_298933_c1|nmdc:mga08y16_298933_c1_775_1434
Length 219
Sequence LQLFGARGARRTTLDQGRSETIMAKQLEGKRIAFLAADGFEQSELEQPWNEIKNAGATVELLSVHKGSIQGMRHMDKGDAFEVDRLVAESDAADYDGLVLPGGVANPDMLRTNLPAVEFVRDFFAQSKPVAAICHGPWTLVEADVVRGRTVTSWPSLKTDIRNAGGQWVDEEVHVDRGLVTSRKPADLPAFCAKAIEEFAEGRHSGRRAAEQSTQRPSV

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
3 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
4 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
5 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
6 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
7 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
8 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
9 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
10 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
11 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
96 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
303 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
304 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
308 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.31
Metatranscriptomes 9.66
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 3.9
Rhizosphere 86.95
Stem 0
Stem Tuber 0
Unclassified 6.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10002871 3300003373 Bacteria 4102
2 JGI25407J50210_10025243 3300003373 Bacteria 1541
3 JGI25407J50210_10026802 3300003373 Bacteria 1494
4 Ga0006562J51391_1027212 3300003578 Bacteria 4058
5 Ga0070683_100075218 3300005329 Bacteria 3155
6 Ga0068869_100071045 3300005334 Bacteria 2577
7 Ga0070680_100100332 3300005336 Bacteria 2403
8 Ga0070682_100150451 3300005337 Bacteria 1596
9 Ga0068868_100185162 3300005338 Bacteria 1729
10 Ga0070692_10051859 3300005345 Bacteria 2135
11 Ga0070671_100291495 3300005355 Bacteria 1389
12 Ga0070703_10097025 3300005406 Bacteria 1033
13 Ga0070709_10004861 3300005434 Bacteria 7262
14 Ga0070709_10030918 3300005434 Bacteria 3217
15 Ga0070709_10056492 3300005434 Bacteria 2482
16 Ga0070709_10085287 3300005434 Bacteria 2071
17 Ga0070709_10245075 3300005434 Bacteria 1288
18 Ga0070709_10276561 3300005434 Bacteria 1219
19 Ga0070714_100003734 3300005435 Bacteria 11416
20 Ga0070714_100020292 3300005435 Bacteria 5425
21 Ga0070714_100045045 3300005435 Bacteria 3737
22 Ga0070713_100116333 3300005436 Bacteria 2338
23 Ga0070713_100534013 3300005436 Bacteria 1109
24 Ga0070713_100555422 3300005436 Bacteria 1087
25 Ga0070710_10062485 3300005437 Bacteria 2124
26 Ga0070710_10067015 3300005437 Bacteria 2059
27 Ga0070710_10141203 3300005437 Bacteria 1477
28 Ga0070701_10020718 3300005438 Bacteria 3126
29 Ga0070701_10067689 3300005438 Bacteria 1900
30 Ga0070711_100001344 3300005439 Bacteria 13433
31 Ga0070711_100176983 3300005439 Bacteria 1630
32 Ga0070711_100244919 3300005439 Bacteria 1403
33 Ga0070694_100329355 3300005444 Bacteria 1177
34 Ga0070694_101238766 3300005444 Bacteria 626
35 Ga0070662_100031723 3300005457 Bacteria 3711
36 Ga0070681_10441018 3300005458 Bacteria 1214
37 Ga0068867_100893430 3300005459 Bacteria 799
38 Ga0070685_10092536 3300005466 Bacteria 1832
39 Ga0070684_100032346 3300005535 Bacteria 4457
40 Ga0070695_100485194 3300005545 Bacteria 953
41 Ga0070696_100189369 3300005546 Bacteria 1531
42 Ga0068855_100010026 3300005563 Bacteria 11418
43 Ga0070664_100017823 3300005564 Bacteria 5831
44 Ga0070664_100500612 3300005564 Bacteria 1120
45 Ga0068857_100199910 3300005577 Bacteria 1822
46 Ga0068854_100181392 3300005578 Bacteria 1645
47 Ga0068856_100031483 3300005614 Bacteria 5190
48 Ga0068856_100196061 3300005614 Bacteria 2034
49 Ga0068856_100404548 3300005614 Bacteria 1384
50 Ga0068856_100772159 3300005614 Bacteria 981
51 Ga0068852_100106717 3300005616 Bacteria 2539
52 Ga0068859_100001908 3300005617 Bacteria 21260
53 Ga0068859_100075074 3300005617 Bacteria 3421
54 Ga0068859_101889324 3300005617 Bacteria 659
55 Ga0068861_100018401 3300005719 Bacteria 4978
56 Ga0068860_101172375 3300005843 Bacteria 788
57 Ga0068862_100271597 3300005844 Bacteria 1551
58 Ga0081455_10000396 3300005937 Bacteria 57399
59 Ga0081538_10000113 3300005981 Bacteria 81440
60 Ga0081538_10000358 3300005981 Bacteria 51878
61 Ga0081538_10001730 3300005981 Bacteria 22186
62 Ga0081538_10005533 3300005981 Bacteria 11346
63 Ga0081540_1000134 3300005983 Bacteria 79126
64 Ga0081539_10007485 3300005985 Bacteria 9929
65 Ga0070717_10000010 3300006028 Bacteria 283501
66 Ga0070717_10179890 3300006028 Bacteria 1843
67 Ga0070717_10627153 3300006028 Bacteria 975
68 Ga0075368_10270361 3300006042 Bacteria 729
69 Ga0075363_100411037 3300006048 Bacteria 796
70 Ga0070716_100003762 3300006173 Bacteria 7185
71 Ga0070716_100062657 3300006173 Bacteria 2157
72 Ga0070712_100041266 3300006175 Bacteria 3168
73 Ga0070712_100150672 3300006175 Bacteria 1785
74 Ga0070712_100419855 3300006175 Bacteria 1108
75 Ga0070712_100570304 3300006175 Bacteria 955
76 Ga0075428_100034195 3300006844 Bacteria 5608
77 Ga0075428_100067932 3300006844 Bacteria 3900
78 Ga0075430_100002361 3300006846 Bacteria 15685
79 Ga0075430_100065028 3300006846 Bacteria 3065
80 Ga0075431_100057829 3300006847 Bacteria 3999
81 Ga0075434_100028417 3300006871 Bacteria 5494
82 Ga0075436_100145047 3300006914 Bacteria 1669
83 Ga0097620_100001908 3300006931 Bacteria 21260
84 Ga0097620_100075074 3300006931 Bacteria 3421
85 Ga0097620_101888639 3300006931 Bacteria 659
86 Ga0105245_10109368 3300009098 Bacteria 2568
87 Ga0105247_10000043 3300009101 Bacteria 157839
88 Ga0105247_10001971 3300009101 Bacteria 14262
89 Ga0105247_10272944 3300009101 Bacteria 1164
90 Ga0105243_10135150 3300009148 Bacteria 2097
91 Ga0105243_10336043 3300009148 Bacteria 1382
92 Ga0105243_11303627 3300009148 Bacteria 743
93 Ga0105241_10140018 3300009174 Bacteria 1969
94 Ga0105241_10851736 3300009174 Bacteria 843
95 Ga0105242_10391854 3300009176 Bacteria 1294
96 Ga0105248_10004160 3300009177 Bacteria 16004
97 Ga0105248_10495602 3300009177 Bacteria 1377
98 Ga0105237_10318260 3300009545 Bacteria 1559
99 Ga0105237_10443481 3300009545 Bacteria 1304
100 Ga0105238_10103489 3300009551 Bacteria 2828
101 Ga0105249_10418848 3300009553 Bacteria 1373
102 Ga0105249_10881733 3300009553 Bacteria 961
103 Ga0105239_10406304 3300010375 Bacteria 1541
104 Ga0157370_10017021 3300013104 Bacteria 7345
105 Ga0157370_10021704 3300013104 Bacteria 6397
106 Ga0157369_10023921 3300013105 Bacteria 6800
107 Ga0157369_10029248 3300013105 Bacteria 6090
108 Ga0157369_10735323 3300013105 Bacteria 1015
109 Ga0157374_10333883 3300013296 Bacteria 1504
110 Ga0163162_10887496 3300013306 Bacteria 1005
111 Ga0157372_10441502 3300013307 Bacteria 1517
112 Ga0157375_10452768 3300013308 Bacteria 1449
113 Ga0157375_10577400 3300013308 Bacteria 1285
114 Ga0157375_10872147 3300013308 Bacteria 1045
115 Ga0163163_10253062 3300014325 Bacteria 1812
116 Ga0163163_10995208 3300014325 Bacteria 902
117 Ga0157380_10232400 3300014326 Bacteria 1657
118 Ga0157380_10812587 3300014326 Bacteria 953
119 Ga0157379_10213370 3300014968 Bacteria 1748
120 Ga0157379_11500084 3300014968 Bacteria 656
121 Ga0157376_10030809 3300014969 Bacteria 4288
122 Ga0163161_10658713 3300017792 Bacteria 868
123 Ga0197907_10086055 3300020069 Bacteria 1597
124 Ga0197907_10178928 3300020069 Bacteria 1415
125 Ga0197907_11096209 3300020069 Bacteria 1773
126 Ga0197907_11127221 3300020069 Bacteria 602
127 Ga0197907_11401217 3300020069 Bacteria 1157
128 Ga0197907_11442931 3300020069 Bacteria 2172
129 Ga0206356_10889118 3300020070 Bacteria 1469
130 Ga0206356_11126787 3300020070 Bacteria 1550
131 Ga0206349_1149084 3300020075 Bacteria 708
132 Ga0206349_1615072 3300020075 Bacteria 673
133 Ga0206349_1761265 3300020075 Bacteria 615
134 Ga0206355_1548352 3300020076 Bacteria 1112
135 Ga0206355_1614130 3300020076 Bacteria 748
136 Ga0206351_10024129 3300020077 Bacteria 1614
137 Ga0206352_10882461 3300020078 Bacteria 1355
138 Ga0206350_10233564 3300020080 Bacteria 951
139 Ga0206350_10260939 3300020080 Bacteria 859
140 Ga0206350_10694190 3300020080 Bacteria 678
141 Ga0206350_10999973 3300020080 Bacteria 1616
142 Ga0206350_11122083 3300020080 Bacteria 1205
143 Ga0206350_11303434 3300020080 Bacteria 1136
144 Ga0206350_11565754 3300020080 Unclassified 635
145 Ga0206354_10204561 3300020081 Bacteria 930
146 Ga0206354_10740676 3300020081 Bacteria 1518
147 Ga0206353_10752160 3300020082 Bacteria 1209
148 Ga0154015_1616732 3300020610 Bacteria 886
149 Ga0213876_10031079 3300021384 Bacteria 2819
150 Ga0213876_10156836 3300021384 Bacteria 1211
151 Ga0213875_10001681 3300021388 Bacteria 13934
152 Ga0213875_10146747 3300021388 Bacteria 1105
153 Ga0224712_10007328 3300022467 Bacteria 3207
154 Ga0224712_10016623 3300022467 Bacteria 2422
155 Ga0224712_10029936 3300022467 Bacteria 1960
156 Ga0224712_10050345 3300022467 Bacteria 1618
157 Ga0224712_10053952 3300022467 Bacteria 1576
158 Ga0224712_10187834 3300022467 Bacteria 934
159 Ga0224712_10285643 3300022467 Bacteria 769
160 Ga0224712_10424345 3300022467 Bacteria 636
161 Ga0224712_10464196 3300022467 Bacteria 609
162 Ga0224712_10482934 3300022467 Bacteria 597
163 Ga0256744_151210 3300023309 Bacteria 919
164 Ga0256743_102384 3300023436 Unclassified 1011
165 Ga0207426_1001457 3300025302 Bacteria 19586
166 Ga0207713_1050987 3300025735 Bacteria 1648
167 Ga0207692_10044810 3300025898 Bacteria 2209
168 Ga0207692_10085260 3300025898 Bacteria 1699
169 Ga0207692_10141843 3300025898 Bacteria 1367
170 Ga0207642_10095462 3300025899 Bacteria 1480
171 Ga0207710_10000064 3300025900 Bacteria 162498
172 Ga0207710_10051326 3300025900 Bacteria 1852
173 Ga0207710_10147737 3300025900 Unclassified 1138
174 Ga0207688_10480726 3300025901 Bacteria 776
175 Ga0207680_10227495 3300025903 Bacteria 1281
176 Ga0207699_10004168 3300025906 Bacteria 6924
177 Ga0207699_10004397 3300025906 Bacteria 6740
178 Ga0207699_10057446 3300025906 Bacteria 2323
179 Ga0207699_10059550 3300025906 Bacteria 2289
180 Ga0207699_10264188 3300025906 Bacteria 1190
181 Ga0207707_10087974 3300025912 Bacteria 2714
182 Ga0207695_10023759 3300025913 Bacteria 6918
183 Ga0207671_10792909 3300025914 Bacteria 751
184 Ga0207693_10013495 3300025915 Bacteria 6585
185 Ga0207693_10047634 3300025915 Bacteria 3367
186 Ga0207693_10124138 3300025915 Bacteria 2028
187 Ga0207693_10135899 3300025915 Bacteria 1933
188 Ga0207693_10139457 3300025915 Bacteria 1907
189 Ga0207663_10079277 3300025916 Bacteria 2144
190 Ga0207663_10189056 3300025916 Bacteria 1477
191 Ga0207663_10308338 3300025916 Bacteria 1185
192 Ga0207663_10354951 3300025916 Bacteria 1111
193 Ga0207663_10451676 3300025916 Bacteria 991
194 Ga0207660_10059322 3300025917 Bacteria 2746
195 Ga0207660_10687692 3300025917 Bacteria 834
196 Ga0207662_10364602 3300025918 Bacteria 973
197 Ga0207657_10279991 3300025919 Bacteria 1324
198 Ga0207657_10790813 3300025919 Bacteria 734
199 Ga0207652_10141118 3300025921 Bacteria 2154
200 Ga0207687_10236705 3300025927 Bacteria 1445
201 Ga0207687_10497667 3300025927 Bacteria 1017
202 Ga0207700_10011627 3300025928 Bacteria 5624
203 Ga0207700_10036458 3300025928 Bacteria 3552
204 Ga0207700_10489711 3300025928 Bacteria 1087
205 Ga0207664_10007842 3300025929 Bacteria 7417
206 Ga0207664_10016099 3300025929 Bacteria 5447
207 Ga0207664_10063634 3300025929 Bacteria 2948
208 Ga0207664_10065693 3300025929 Bacteria 2905
209 Ga0207664_10101021 3300025929 Bacteria 2382
210 Ga0207644_10354776 3300025931 Bacteria 1192
211 Ga0207690_10095124 3300025932 Bacteria 2116
212 Ga0207704_10100550 3300025938 Bacteria 1926
213 Ga0207665_10007521 3300025939 Bacteria 7201
214 Ga0207665_10009742 3300025939 Bacteria 6308
215 Ga0207665_10072912 3300025939 Bacteria 2347
216 Ga0207711_10075760 3300025941 Bacteria 2929
217 Ga0207689_10081438 3300025942 Bacteria 2661
218 Ga0207661_10151716 3300025944 Bacteria 2003
219 Ga0207640_10041191 3300025981 Bacteria 2936
220 Ga0207640_10100645 3300025981 Bacteria 2026
221 Ga0207640_10732354 3300025981 Bacteria 851
222 Ga0207677_10980072 3300026023 Bacteria 766
223 Ga0207708_10003460 3300026075 Bacteria 11636
224 Ga0207708_10004679 3300026075 Bacteria 10067
225 Ga0207708_10021807 3300026075 Bacteria 4833
226 Ga0207702_10022140 3300026078 Bacteria 5267
227 Ga0207702_10071037 3300026078 Bacteria 2996
228 Ga0207702_10497884 3300026078 Bacteria 1188
229 Ga0207648_10287513 3300026089 Bacteria 1471
230 Ga0207676_10227052 3300026095 Bacteria 1667
231 Ga0207674_10151499 3300026116 Bacteria 2276
232 Ga0207675_100068423 3300026118 Bacteria 3318
233 Ga0207698_10170666 3300026142 Bacteria 1915
234 Ga0207698_10327602 3300026142 Bacteria 1437
235 Ga0210000_1032451 3300027462 Bacteria 819
236 Ga0207428_10185844 3300027907 Bacteria 1568
237 Ga0207428_10468242 3300027907 Bacteria 917
238 Ga0268266_10039924 3300028379 Bacteria 3998
239 Ga0268266_11087802 3300028379 Bacteria 774
240 Ga0307517_10002470 3300028786 Bacteria 29566
241 Ga0307515_10001437 3300028794 Bacteria 53784
242 Ga0307515_10192604 3300028794 Bacteria 1943
243 Ga0307515_10337868 3300028794 Bacteria 1160
244 Ga0311001_1064471 3300029277 Unclassified 918
245 Ga0307511_10097416 3300030521 Bacteria 1953
246 Ga0307512_10031781 3300030522 Bacteria 4566
247 Ga0307408_100254992 3300031548 Bacteria 1449
248 Ga0307508_10083830 3300031616 Bacteria 2770
249 Ga0307514_10124636 3300031649 Bacteria 1788
250 Ga0307514_10198102 3300031649 Bacteria 1267
251 Ga0307516_10033191 3300031730 Bacteria 5194
252 Ga0307405_10536379 3300031731 Bacteria 944
253 Ga0307413_10104148 3300031824 Bacteria 1883
254 Ga0307413_10306653 3300031824 Bacteria 1206
255 Ga0307518_10055967 3300031838 Bacteria 2866
256 Ga0307410_10033289 3300031852 Bacteria 3326
257 Ga0307406_10183033 3300031901 Bacteria 1527
258 Ga0307407_10361358 3300031903 Bacteria 1031
259 Ga0307412_10121678 3300031911 Bacteria 1880
260 Ga0307409_100041481 3300031995 Bacteria 3438
261 Ga0307416_100024731 3300032002 Bacteria 4390
262 Ga0307416_100637936 3300032002 Bacteria 1149
263 Ga0307416_100850769 3300032002 Bacteria 1010
264 Ga0307416_102217934 3300032002 Bacteria 650
265 Ga0307414_10023024 3300032004 Bacteria 3941
266 Ga0307411_10170800 3300032005 Bacteria 1639
267 Ga0307415_100099069 3300032126 Bacteria 2132
268 Ga0307415_100211585 3300032126 Bacteria 1547
269 Ga0307415_100285196 3300032126 Bacteria 1360
270 Ga0307415_100442696 3300032126 Bacteria 1121
271 Ga0307415_100553120 3300032126 Bacteria 1016
272 Ga0307507_10011220 3300033179 Bacteria 11365
273 Ga0373926_0003247 3300035083 Bacteria 5224
274 Ga0373926_0003471 3300035083 Bacteria 5091
275 Ga0373944_0001489 3300035089 Bacteria 5920
276 Ga0373944_0001715 3300035089 Bacteria 5546
277 Ga0373923_0010331 3300035111 Bacteria 3394
278 Ga0373923_0027654 3300035111 Bacteria 2263
279 Ga0373936_0001869 3300035113 Bacteria 7766
280 Ga0373936_0005507 3300035113 Bacteria 4776
281 Ga0373945_0004046 3300035116 Bacteria 4639
282 Ga0373945_0011963 3300035116 Bacteria 2875
283 Ga0373943_0004349 3300035170 Bacteria 6427
284 Ga0373943_0005188 3300035170 Bacteria 5863
285 Ga0373946_0000042 3300035171 Bacteria 32829
286 Ga0373946_0000575 3300035171 Bacteria 12112
287 Ga0373955_0049025 3300035172 Bacteria 2292
288 Ga0373955_0106106 3300035172 Bacteria 1619
289 Ga0373924_0028123 3300035410 Bacteria 2239
290 Ga0373935_0001080 3300035692 Bacteria 14884
291 Ga0373935_0026219 3300035692 Bacteria 3595
292 Ga0373927_0003836 3300035695 Bacteria 10678
293 Ga0373927_0010216 3300035695 Bacteria 6270
294 Ga0373947_0001186 3300035725 Bacteria 16041
295 Ga0373947_0194236 3300035725 Bacteria 1325
296 Ga0373937_0245754 3300036401 Bacteria 1686
297 Ga0373937_0705843 3300036401 Bacteria 955
298 Ga0373925_0012878 3300037068 Bacteria 6058
299 Ga0373925_0069162 3300037068 Bacteria 2666
300 Ga0395899_0087104 3300037312 Bacteria 2267
301 Ga0395900_0074446 3300037418 Bacteria 3491
302 Ga0395900_0119581 3300037418 Bacteria 2704
303 Ga0395898_0168569 3300037466 Bacteria 2093
304 Ga0395898_0769268 3300037466 Bacteria 904
305 Ga0436364_0861475 3300037853 Bacteria 1250
306 Ga0436364_1025760 3300037853 Bacteria 46353
307 Ga0395901_0056160 3300038443 Bacteria 4096
308 Ga0395901_0110634 3300038443 Bacteria 2884
309 Ga0395901_0583896 3300038443 Bacteria 1129
310 Ga0436365_0327584 3300039437 Bacteria 17350
311 Ga0436365_0933082 3300039437 Bacteria 737
312 Ga0436362_0068107 3300039453 Bacteria 1776
313 Ga0466969_0000554 3300044656 Bacteria 20536
314 Ga0466969_0015397 3300044656 Bacteria 4009
315 Ga0466969_0019537 3300044656 Bacteria 3520
316 Ga0466969_0055878 3300044656 Bacteria 1929
317 Ga0466969_0180769 3300044656 Bacteria 965
318 Ga0466965_0017743 3300044683 Bacteria 3404
319 Ga0466965_0082631 3300044683 Bacteria 1625
320 Ga0466966_0012056 3300044684 Bacteria 5728
321 Ga0466966_0020874 3300044684 Bacteria 4306
322 Ga0466966_0193614 3300044684 Bacteria 1231
323 Ga0466966_0295896 3300044684 Bacteria 973
324 Ga0466961_0009301 3300044693 Bacteria 6256
325 Ga0466961_0157929 3300044693 Bacteria 1414
326 Ga0466961_0336565 3300044693 Bacteria 919
327 Ga0466963_0008564 3300044694 Bacteria 6139
328 Ga0466963_0012536 3300044694 Bacteria 5192
329 Ga0466963_0015382 3300044694 Bacteria 4736
330 Ga0466963_0038565 3300044694 Bacteria 3125
331 Ga0466963_0062782 3300044694 Bacteria 2485
332 Ga0466963_0139724 3300044694 Bacteria 1677
333 Ga0466963_0141357 3300044694 Bacteria 1668
334 Ga0466964_0359420 3300044706 Bacteria 750
335 Ga0466971_0158743 3300044719 Bacteria 1058
336 Ga0466970_0019622 3300044765 Bacteria 3506
337 Ga0466970_0044326 3300044765 Bacteria 2368
338 Ga0466970_0326065 3300044765 Bacteria 869
339 Ga0466970_0643493 3300044765 Bacteria 616
340 Ga0466957_0028287 3300044842 Bacteria 3337
341 Ga0466957_0049792 3300044842 Unclassified 2548
342 Ga0466957_0075535 3300044842 Bacteria 2091
343 Ga0466960_0146762 3300044901 Bacteria 1257
344 Ga0466960_0150196 3300044901 Bacteria 1244
345 Ga0466959_0152767 3300045049 Bacteria 1626
346 Ga0466959_0250298 3300045049 Bacteria 1222
347 Ga0466959_0298550 3300045049 Bacteria 1103
348 Ga0466959_0472641 3300045049 Bacteria 849
349 Ga0466958_0013798 3300045836 Bacteria 4606
350 Ga0466958_0088615 3300045836 Bacteria 1912
351 Ga0466958_0097265 3300045836 Bacteria 1827
352 Ga0466958_0189382 3300045836 Bacteria 1307
353 Ga0466958_0351855 3300045836 Bacteria 948
354 Ga0466958_0699421 3300045836 Bacteria 660
355 Ga0466967_0047896 3300045976 Bacteria 3729
356 Ga0466967_0109999 3300045976 Bacteria 2530
357 Ga0466967_0137775 3300045976 Bacteria 2271
358 Ga0466967_0188082 3300045976 Bacteria 1950
359 Ga0466967_0556818 3300045976 Bacteria 1129
360 Ga0466967_1590455 3300045976 Bacteria 651
361 Ga0495603_0105267 3300046455 Bacteria 1646
362 Ga0495603_0257973 3300046455 Bacteria 1003
363 Ga0495629_0001221 3300046459 Bacteria 20197
364 Ga0495629_0188919 3300046459 Bacteria 1426
365 Ga0495629_0305964 3300046459 Bacteria 1088
366 Ga0495638_0040336 3300046460 Bacteria 2959
367 Ga0495641_0009489 3300046461 Bacteria 5776
368 Ga0495641_0014000 3300046461 Bacteria 4366
369 Ga0495651_0221150 3300046462 Bacteria 1310
370 Ga0495651_0562169 3300046462 Bacteria 723
371 Ga0495653_0019372 3300046463 Bacteria 5519
372 Ga0495653_0025616 3300046463 Bacteria 4736
373 Ga0495582_0006701 3300046473 Bacteria 6399
374 Ga0495582_0019118 3300046473 Bacteria 3749
375 Ga0495639_0033051 3300046475 Bacteria 2309
376 Ga0495662_0010934 3300046476 Bacteria 4439
377 Ga0495662_0118063 3300046476 Bacteria 1301
378 Ga0495664_0006698 3300046477 Bacteria 6371
379 Ga0495664_0058322 3300046477 Bacteria 2296
380 Ga0495583_0221059 3300046506 Bacteria 765
381 Ga0495606_0037138 3300046507 Bacteria 3310
382 Ga0495608_0036336 3300046511 Bacteria 3317
383 Ga0495608_0143016 3300046511 Bacteria 1526
384 Ga0495618_0010834 3300046514 Bacteria 5521
385 Ga0495618_0084824 3300046514 Bacteria 2024
386 Ga0495620_0149522 3300046515 Bacteria 911
387 Ga0495628_0503793 3300046516 Bacteria 874
388 Ga0495630_0006044 3300046517 Bacteria 8574
389 Ga0495630_0100745 3300046517 Bacteria 2185
390 Ga0495648_0327024 3300046524 Bacteria 708
391 Ga0495663_0298425 3300046525 Bacteria 580
392 Ga0495652_0074859 3300046529 Bacteria 2815
393 Ga0495652_0145363 3300046529 Bacteria 1859
394 Ga0495665_0035475 3300046531 Bacteria 2664
395 Ga0495665_0052675 3300046531 Bacteria 2154
396 Ga0495640_0015045 3300046533 Bacteria 5830
397 Ga0495640_0054709 3300046533 Bacteria 2732
398 Ga0495586_0347136 3300046535 Bacteria 852
399 Ga0495645_0204505 3300046543 Bacteria 1337
400 Ga0495667_0001662 3300046559 Bacteria 14750
401 Ga0495667_0006224 3300046559 Bacteria 8088
402 Ga0495668_0023812 3300046616 Bacteria 3488
403 Ga0495634_0040656 3300046642 Bacteria 3160
404 Ga0495634_0046647 3300046642 Bacteria 2923
405 Ga0495625_0044224 3300046660 Bacteria 3225
406 Ga0495625_0053277 3300046660 Bacteria 2894
407 Ga0495635_0001316 3300046663 Bacteria 16535
408 Ga0495635_0006919 3300046663 Bacteria 7921
409 Ga0495588_0053571 3300046674 Bacteria 2080
410 Ga0495657_0007892 3300046675 Bacteria 8167
411 Ga0495657_0041497 3300046675 Bacteria 3148
412 Ga0495599_0040085 3300046678 Bacteria 2942
413 Ga0495599_0209307 3300046678 Bacteria 1196
414 Ga0495646_0453643 3300046680 Bacteria 662
415 Ga0495624_0001128 3300046690 Bacteria 21123
416 Ga0495624_0007519 3300046690 Bacteria 7644
417 Ga0495671_0003734 3300046692 Bacteria 9263
418 Ga0495600_0030565 3300046809 Bacteria 3489
419 Ga0495600_0157577 3300046809 Bacteria 1468
420 Ga0495581_0018592 3300047315 Bacteria 4036
421 Ga0495581_0047696 3300047315 Bacteria 2475
422 Ga0495636_0173090 3300047318 Bacteria 977
423 Ga0495674_0006084 3300047319 Bacteria 11586
424 Ga0495674_0017109 3300047319 Bacteria 6753
425 Ga0495676_0002527 3300047321 Bacteria 16280
426 Ga0495676_0006548 3300047321 Bacteria 10732
427 Ga0495676_0021662 3300047321 Bacteria 5607
428 Ga0495676_0153041 3300047321 Bacteria 1639
429 Ga0495680_0095280 3300047322 Bacteria 2225
430 Ga0495680_0109069 3300047322 Bacteria 2053
431 Ga0495687_014300 3300047443 Bacteria 4091
432 Ga0495681_0004493 3300047470 Bacteria 9521
433 Ga0495684_0024834 3300047471 Bacteria 4609
434 Ga0495684_0050902 3300047471 Bacteria 3161
435 Ga0495686_0074433 3300047472 Bacteria 2084
436 Ga0495686_0106455 3300047472 Bacteria 1686
437 Ga0495593_0031800 3300047673 Bacteria 2880
438 Ga0495614_0001620 3300048089 Bacteria 9807
439 Ga0496100_0000479 3300048903 Bacteria 19190
440 Ga0496101_0000401 3300048904 Bacteria 28366
441 Ga0496101_0098336 3300048904 Bacteria 2186
442 Ga0496101_0175318 3300048904 Bacteria 1649
443 Ga0496101_0282930 3300048904 Bacteria 1296
444 Ga0496102_0000557 3300048905 Bacteria 39916
445 Ga0496102_0334658 3300048905 Bacteria 1426
446 Ga0496103_0000434 3300048906 Bacteria 36328
447 Ga0496104_0040702 3300048907 Bacteria 4357
448 Ga0496107_0043780 3300048910 Bacteria 3217
449 Ga0496108_0098842 3300048911 Bacteria 2487
450 Ga0496108_0128669 3300048911 Bacteria 2176
451 Ga0496109_0448158 3300048912 Bacteria 1219
452 Ga0496109_0822914 3300048912 Bacteria 866
453 Ga0496110_0126931 3300048913 Bacteria 2302
454 Ga0496110_0235544 3300048913 Bacteria 1666
455 Ga0496110_0924269 3300048913 Bacteria 779
456 Ga0496111_0477931 3300048914 Bacteria 918
457 Ga0496112_0511387 3300048915 Bacteria 1136
458 Ga0496114_0061213 3300048917 Bacteria 3148
459 Ga0496114_0134739 3300048917 Bacteria 2135
460 Ga0496114_0577177 3300048917 Bacteria 992
461 Ga0496114_0603422 3300048917 Bacteria 968
462 Ga0496117_0208051 3300048920 Bacteria 1099
463 Ga0496118_0004525 3300048921 Bacteria 16428
464 Ga0496119_0000215 3300048922 Bacteria 82231
465 Ga0496119_0043024 3300048922 Bacteria 2858
466 Ga0496120_0000264 3300048923 Bacteria 87474
467 Ga0496120_0011220 3300048923 Bacteria 6179
468 Ga0496120_0205285 3300048923 Bacteria 951
469 Ga0496121_0039957 3300048924 Bacteria 4124
470 Ga0496122_0013255 3300048925 Bacteria 8083
471 Ga0496123_0001649 3300048926 Bacteria 29965
472 Ga0496124_0418713 3300048927 Bacteria 924
473 Ga0496126_0104917 3300048929 Bacteria 2469
474 Ga0501031_0147995 3300049568 Bacteria 1534
475 Ga0501032_0059003 3300049569 Bacteria 2575
476 Ga0501032_0068889 3300049569 Bacteria 2361
477 Ga0501034_0141695 3300049571 Bacteria 2383
478 Ga0501036_0031995 3300049572 Bacteria 4444
479 Ga0501036_0075937 3300049572 Bacteria 2842
480 Ga0501036_0119708 3300049572 Bacteria 2223
481 Ga0501037_0077633 3300049573 Bacteria 2410
482 Ga0501037_0185668 3300049573 Bacteria 1474
483 Ga0501038_0090351 3300049574 Bacteria 2567
484 Ga0501038_0236878 3300049574 Bacteria 1450
485 Ga0501039_0026838 3300049575 Bacteria 4426
486 Ga0501040_0013175 3300049576 Bacteria 5438
487 Ga0501041_0039656 3300049577 Bacteria 2858
488 Ga0501042_0007133 3300049578 Bacteria 7309
489 Ga0501043_0023462 3300049579 Bacteria 4838
490 Ga0501043_0131725 3300049579 Bacteria 1959
491 Ga0501043_0281710 3300049579 Bacteria 1274
492 Ga0501046_0089609 3300049580 Bacteria 2367
493 Ga0501046_0289578 3300049580 Bacteria 1198
494 Ga0501047_0003949 3300049581 Bacteria 13939
495 Ga0501047_0129446 3300049581 Bacteria 2404
496 Ga0501048_0049156 3300049582 Bacteria 3006
497 Ga0501067_0000062 3300049583 Bacteria 61908
498 Ga0501067_0364935 3300049583 Bacteria 805
499 Ga0501068_0000016 3300049584 Bacteria 62571
500 Ga0501069_0001293 3300049585 Bacteria 12281
501 Ga0501069_0052000 3300049585 Bacteria 2281
502 Ga0501069_0140503 3300049585 Bacteria 1385
503 Ga0501069_0176405 3300049585 Bacteria 1234
504 Ga0501070_0231293 3300049586 Bacteria 1514
505 Ga0501070_0253779 3300049586 Bacteria 1438
506 Ga0501070_0272336 3300049586 Bacteria 1382
507 Ga0501071_0012857 3300049587 Bacteria 5692
508 Ga0501071_0311096 3300049587 Bacteria 1195
509 Ga0501071_0324691 3300049587 Bacteria 1169
510 Ga0501072_0003348 3300049588 Bacteria 12058
511 Ga0501072_0625109 3300049588 Bacteria 848
512 Ga0501073_0117360 3300049589 Bacteria 1844
513 Ga0501074_0033898 3300049590 Bacteria 3702
514 Ga0501075_0032114 3300049591 Bacteria 3899
515 Ga0501076_0005562 3300049592 Bacteria 9079
516 Ga0501077_0015745 3300049593 Bacteria 4762
517 Ga0501077_0340251 3300049593 Bacteria 957
518 Ga0501079_0076624 3300049741 Bacteria 2586
519 Ga0501080_0078578 3300049742 Bacteria 3068
520 Ga0501080_0272108 3300049742 Bacteria 1541
521 Ga0501080_1111979 3300049742 Bacteria 682
522 Ga0501081_0005277 3300049743 Bacteria 8330
523 Ga0501083_0054986 3300049744 Bacteria 2670
524 Ga0501083_0259953 3300049744 Bacteria 1130
525 Ga0501035_0065337 3300049822 Bacteria 3231
526 Ga0501035_0097254 3300049822 Bacteria 2586
527 Ga0501035_0114922 3300049822 Bacteria 2356
528 Ga0501035_1098636 3300049822 Bacteria 621
529 Ga0501035_1288944 3300049822 Bacteria 564
530 Ga0501044_0051074 3300049823 Bacteria 4264
531 Ga0501044_0070812 3300049823 Bacteria 3546
532 Ga0501044_0127177 3300049823 Bacteria 2545
533 Ga0501045_0629570 3300049824 Bacteria 793
534 nmdc:mga03683_143183_c1 3300050489 Bacteria 1075
535 nmdc:mga0qj67_6664_c1 3300050509 Bacteria 8482
536 nmdc:mga0qj67_766199_c1 3300050509 Bacteria 765
537 nmdc:mga06r32_13212_c1 3300050510 Bacteria 7478
538 nmdc:mga08y16_1169989_c1 3300050511 Bacteria 741
539 nmdc:mga08y16_298933_c1 3300050511 Bacteria 1659
540 nmdc:mga0n895_34628_c1 3300050512 Bacteria 4863
541 nmdc:mga08x19_309992_c1 3300050514 Bacteria 1097
542 Ga0495612_0033699 3300053078 Bacteria 2073
543 Ga0495612_0284934 3300053078 Bacteria 739
544 Ga0495595_0444073 3300053084 Bacteria 659
545 Ga0500646_0200547 3300053090 Bacteria 684
546 Ga0500583_0076223 3300053092 Bacteria 1613
547 Ga0500650_0125896 3300053098 Bacteria 1193
548 Ga0500560_049518 3300053107 Bacteria 1344
549 Ga0500652_317883 3300053131 Bacteria 597
550 Ga0500658_0066438 3300053134 Bacteria 1513
551 Ga0500616_0175245 3300053153 Bacteria 970
552 Ga0500634_0034221 3300053161 Bacteria 2768
553 Ga0500609_004997 3300053731 Bacteria 1815
554 Ga0501084_0013456 3300054114 Bacteria 6772
555 Ga0587070_021502 3300059491 Bacteria 1090
556 Ga0587073_0003126 3300059492 Bacteria 2233
557 Ga0587077_017953 3300059493 Bacteria 1212
558 Ga0587080_021416 3300059503 Bacteria 1063
559 Ga0587082_021406 3300059504 Bacteria 1056
560 Ga0587091_041506 3300059511 Bacteria 909
561 Ga0587094_023955 3300059513 Bacteria 906
562 Ga0587101_008211 3300059623 Bacteria 1255
563 Ga0587109_021926 3300059624 Bacteria 1146
564 Ga0587115_016917 3300059626 Bacteria 980
565 Ga0587067_023966 3300059640 Bacteria 1074
566 Ga0587069_029239 3300059642 Bacteria 880
567 Ga0587072_026550 3300059643 Bacteria 1058
568 Ga0587075_088623 3300059644 Bacteria 601
569 Ga0587076_032215 3300059645 Bacteria 936
570 Ga0587079_043964 3300059647 Bacteria 913
571 Ga0587107_017295 3300059652 Bacteria 963
572 Ga0501082_0010220 3300060353 Bacteria 8080
573 Ga0466962_0004800 3300061719 Bacteria 6506
574 Ga0466962_0009699 3300061719 Bacteria 4619
575 Ga0466962_0188366 3300061719 Bacteria 1006
576 Ga0466962_0298176 3300061719 Bacteria 797
577 Ga0530510_0018053 3300061734 Bacteria 5001
578 Ga0530510_0050654 3300061734 Bacteria 2999

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0259953 Ga0501083_0259953_548_1033 149
2 3300009176 Ga0105242_10391854 Ga0105242_103918543 150
3 3300049585 Ga0501069_0176405 Ga0501069_0176405_23_475 150
4 3300046525 Ga0495663_0298425 Ga0495663_0298425_104_565 152
5 3300009148 Ga0105243_10336043 Ga0105243_103360432 159
6 3300050509 nmdc:mga0qj67_766199_c1 nmdc:mga0qj67_766199_c1_217_753 162
7 3300014326 Ga0157380_10812587 Ga0157380_108125871 164
8 3300049822 Ga0501035_1288944 Ga0501035_1288944_43_546 165
9 3300053153 Ga0500616_0175245 Ga0500616_0175245_215_802 169
10 3300046616 Ga0495668_0023812 Ga0495668_0023812_1053_1604 171
11 3300047472 Ga0495686_0074433 Ga0495686_0074433_923_1471 171
12 3300044694 Ga0466963_0008564 Ga0466963_0008564_3706_4275 172
13 3300044842 Ga0466957_0049792 Ga0466957_0049792_331_900 172
14 3300049573 Ga0501037_0077633 Ga0501037_0077633_640_1200 172
15 3300049574 Ga0501038_0236878 Ga0501038_0236878_871_1431 172
16 iso_pu_bacteria 2808606359 2808845034 173
17 iso_pu_bacteria 2954002825 2954009887 173
18 iso_pu_bacteria 3006493962 3006494255 173
19 iso_pu_bacteria 8033684223 8033687185 173
20 3300005614 Ga0068856_100772159 Ga0068856_1007721591 175
21 3300014325 Ga0163163_10995208 Ga0163163_109952083 175
22 iso_pu_bacteria 2747842501 2748018204 175
23 iso_pu_bacteria 2832004796 2832010471 175
24 iso_pu_bacteria 2839989709 2839990316 175
25 iso_pu_bacteria 2866065130 2866071195 175
26 iso_pu_bacteria 2928972540 2928973099 175
27 iso_pu_bacteria 2977240413 2977242877 175
28 3300028379 Ga0268266_10039924 Ga0268266_100399245 176
29 iso_pu_bacteria 2582580736 2583149250 176
30 iso_pu_bacteria 2675903060 2676489712 176
31 3300025302 Ga0207426_1001457 Ga0207426_10014579 177
32 3300028786 Ga0307517_10002470 Ga0307517_100024702 177
33 3300028794 Ga0307515_10001437 Ga0307515_100014373 177
34 3300028794 Ga0307515_10337868 Ga0307515_103378681 177
35 3300030521 Ga0307511_10097416 Ga0307511_100974162 177
36 3300030522 Ga0307512_10031781 Ga0307512_100317816 177
37 3300031616 Ga0307508_10083830 Ga0307508_100838303 177
38 3300031649 Ga0307514_10124636 Ga0307514_101246363 177
39 3300031649 Ga0307514_10198102 Ga0307514_101981021 177
40 3300031730 Ga0307516_10033191 Ga0307516_100331916 177
41 3300031838 Ga0307518_10055967 Ga0307518_100559676 177
42 3300033179 Ga0307507_10011220 Ga0307507_100112204 177
43 3300046455 Ga0495603_0257973 Ga0495603_0257973_135_677 177
44 3300046459 Ga0495629_0001221 Ga0495629_0001221_16686_17234 177
45 3300046460 Ga0495638_0040336 Ga0495638_0040336_1061_1609 177
46 3300046473 Ga0495582_0019118 Ga0495582_0019118_1592_2134 177
47 3300046506 Ga0495583_0221059 Ga0495583_0221059_73_621 177
48 3300046660 Ga0495625_0044224 Ga0495625_0044224_2479_3018 177
49 3300046660 Ga0495625_0053277 Ga0495625_0053277_241_789 177
50 3300046674 Ga0495588_0053571 Ga0495588_0053571_1420_1968 177
51 3300046680 Ga0495646_0453643 Ga0495646_0453643_48_596 177
52 3300046692 Ga0495671_0003734 Ga0495671_0003734_1344_1892 177
53 3300047318 Ga0495636_0173090 Ga0495636_0173090_258_806 177
54 3300047321 Ga0495676_0153041 Ga0495676_0153041_36_584 177
55 3300047443 Ga0495687_014300 Ga0495687_014300_2591_3139 177
56 3300047470 Ga0495681_0004493 Ga0495681_0004493_2432_2980 177
57 3300047472 Ga0495686_0106455 Ga0495686_0106455_848_1396 177
58 3300048089 Ga0495614_0001620 Ga0495614_0001620_7700_8248 177
59 3300049568 Ga0501031_0147995 Ga0501031_0147995_383_931 177
60 3300049571 Ga0501034_0141695 Ga0501034_0141695_944_1492 177
61 3300049572 Ga0501036_0075937 Ga0501036_0075937_731_1279 177
62 3300049573 Ga0501037_0185668 Ga0501037_0185668_44_592 177
63 3300049574 Ga0501038_0090351 Ga0501038_0090351_645_1193 177
64 3300049579 Ga0501043_0023462 Ga0501043_0023462_1513_2061 177
65 3300049580 Ga0501046_0289578 Ga0501046_0289578_189_737 177
66 3300049581 Ga0501047_0003949 Ga0501047_0003949_3941_4489 177
67 3300049586 Ga0501070_0272336 Ga0501070_0272336_647_1195 177
68 3300049822 Ga0501035_0065337 Ga0501035_0065337_542_1090 177
69 3300049823 Ga0501044_0051074 Ga0501044_0051074_1447_1995 177
70 3300049824 Ga0501045_0629570 Ga0501045_0629570_169_717 177
71 3300053090 Ga0500646_0200547 Ga0500646_0200547_69_617 177
72 3300053092 Ga0500583_0076223 Ga0500583_0076223_889_1437 177
73 3300053098 Ga0500650_0125896 Ga0500650_0125896_270_818 177
74 3300053107 Ga0500560_049518 Ga0500560_049518_548_1096 177
75 3300053131 Ga0500652_317883 Ga0500652_317883_36_584 177
76 3300053161 Ga0500634_0034221 Ga0500634_0034221_2138_2689 177
77 3300005434 Ga0070709_10056492 Ga0070709_100564924 178
78 3300005457 Ga0070662_100031723 Ga0070662_1000317232 178
79 3300005564 Ga0070664_100017823 Ga0070664_1000178234 178
80 3300020070 Ga0206356_11126787 Ga0206356_111267871 178
81 3300022467 Ga0224712_10424345 Ga0224712_104243451 178
82 3300023309 Ga0256744_151210 Ga0256744_1512101 178
83 3300023436 Ga0256743_102384 Ga0256743_1023842 178
84 3300026075 Ga0207708_10021807 Ga0207708_100218071 178
85 3300026118 Ga0207675_100068423 Ga0207675_1000684233 178
86 3300029277 Ga0311001_1064471 Ga0311001_10644711 178
87 3300031548 Ga0307408_100254992 Ga0307408_1002549922 178
88 3300031824 Ga0307413_10104148 Ga0307413_101041481 178
89 3300031903 Ga0307407_10361358 Ga0307407_103613581 178
90 3300031995 Ga0307409_100041481 Ga0307409_1000414814 178
91 3300032002 Ga0307416_100637936 Ga0307416_1006379362 178
92 3300032004 Ga0307414_10023024 Ga0307414_100230241 178
93 3300032126 Ga0307415_100285196 Ga0307415_1002851962 178
94 3300050511 nmdc:mga08y16_1169989_c1 nmdc:mga08y16_1169989_c1_152_688 178
95 3300003373 JGI25407J50210_10025243 JGI25407J50210_100252432 179
96 3300003373 JGI25407J50210_10026802 JGI25407J50210_100268022 179
97 3300003578 Ga0006562J51391_1027212 Ga0006562J51391_10272123 179
98 3300005329 Ga0070683_100075218 Ga0070683_1000752182 179
99 3300005334 Ga0068869_100071045 Ga0068869_1000710452 179
100 3300005336 Ga0070680_100100332 Ga0070680_1001003322 179
101 3300005337 Ga0070682_100150451 Ga0070682_1001504512 179
102 3300005338 Ga0068868_100185162 Ga0068868_1001851622 179
103 3300005345 Ga0070692_10051859 Ga0070692_100518592 179
104 3300005355 Ga0070671_100291495 Ga0070671_1002914952 179
105 3300005406 Ga0070703_10097025 Ga0070703_100970251 179
106 3300005434 Ga0070709_10004861 Ga0070709_100048616 179
107 3300005435 Ga0070714_100003734 Ga0070714_1000037348 179
108 3300005435 Ga0070714_100045045 Ga0070714_1000450453 179
109 3300005436 Ga0070713_100116333 Ga0070713_1001163332 179
110 3300005437 Ga0070710_10067015 Ga0070710_100670152 179
111 3300005438 Ga0070701_10020718 Ga0070701_100207182 179
112 3300005438 Ga0070701_10067689 Ga0070701_100676892 179
113 3300005439 Ga0070711_100001344 Ga0070711_10000134417 179
114 3300005444 Ga0070694_100329355 Ga0070694_1003293551 179
115 3300005444 Ga0070694_101238766 Ga0070694_1012387661 179
116 3300005458 Ga0070681_10441018 Ga0070681_104410182 179
117 3300005459 Ga0068867_100893430 Ga0068867_1008934301 179
118 3300005466 Ga0070685_10092536 Ga0070685_100925361 179
119 3300005535 Ga0070684_100032346 Ga0070684_1000323464 179
120 3300005545 Ga0070695_100485194 Ga0070695_1004851942 179
121 3300005546 Ga0070696_100189369 Ga0070696_1001893691 179
122 3300005577 Ga0068857_100199910 Ga0068857_1001999102 179
123 3300005578 Ga0068854_100181392 Ga0068854_1001813922 179
124 3300005614 Ga0068856_100031483 Ga0068856_1000314833 179
125 3300005614 Ga0068856_100404548 Ga0068856_1004045482 179
126 3300005616 Ga0068852_100106717 Ga0068852_1001067172 179
127 3300005617 Ga0068859_100075074 Ga0068859_1000750742 179
128 3300005617 Ga0068859_101889324 Ga0068859_1018893241 179
129 3300005719 Ga0068861_100018401 Ga0068861_1000184013 179
130 3300005843 Ga0068860_101172375 Ga0068860_1011723751 179
131 3300005844 Ga0068862_100271597 Ga0068862_1002715972 179
132 3300005981 Ga0081538_10000113 Ga0081538_1000011333 179
133 3300005981 Ga0081538_10000358 Ga0081538_1000035830 179
134 3300005985 Ga0081539_10007485 Ga0081539_1000748511 179
135 3300006028 Ga0070717_10000010 Ga0070717_10000010239 179
136 3300006173 Ga0070716_100003762 Ga0070716_1000037628 179
137 3300006175 Ga0070712_100041266 Ga0070712_1000412663 179
138 3300006175 Ga0070712_100150672 Ga0070712_1001506724 179
139 3300006844 Ga0075428_100034195 Ga0075428_1000341952 179
140 3300006844 Ga0075428_100067932 Ga0075428_1000679322 179
141 3300006846 Ga0075430_100002361 Ga0075430_10000236117 179
142 3300006846 Ga0075430_100065028 Ga0075430_1000650284 179
143 3300006847 Ga0075431_100057829 Ga0075431_1000578293 179
144 3300006871 Ga0075434_100028417 Ga0075434_1000284173 179
145 3300006914 Ga0075436_100145047 Ga0075436_1001450472 179
146 3300006931 Ga0097620_100075074 Ga0097620_1000750742 179
147 3300006931 Ga0097620_101888639 Ga0097620_1018886391 179
148 3300009098 Ga0105245_10109368 Ga0105245_101093682 179
149 3300009101 Ga0105247_10272944 Ga0105247_102729442 179
150 3300009148 Ga0105243_10135150 Ga0105243_101351503 179
151 3300009148 Ga0105243_11303627 Ga0105243_113036271 179
152 3300009174 Ga0105241_10140018 Ga0105241_101400182 179
153 3300009177 Ga0105248_10495602 Ga0105248_104956021 179
154 3300009545 Ga0105237_10318260 Ga0105237_103182602 179
155 3300009545 Ga0105237_10443481 Ga0105237_104434812 179
156 3300009551 Ga0105238_10103489 Ga0105238_101034894 179
157 3300009553 Ga0105249_10418848 Ga0105249_104188482 179
158 3300009553 Ga0105249_10881733 Ga0105249_108817332 179
159 3300010375 Ga0105239_10406304 Ga0105239_104063043 179
160 3300013104 Ga0157370_10017021 Ga0157370_100170213 179
161 3300013105 Ga0157369_10023921 Ga0157369_100239212 179
162 3300013105 Ga0157369_10735323 Ga0157369_107353232 179
163 3300013296 Ga0157374_10333883 Ga0157374_103338832 179
164 3300013306 Ga0163162_10887496 Ga0163162_108874962 179
165 3300013308 Ga0157375_10452768 Ga0157375_104527682 179
166 3300013308 Ga0157375_10577400 Ga0157375_105774002 179
167 3300013308 Ga0157375_10872147 Ga0157375_108721472 179
168 3300014326 Ga0157380_10232400 Ga0157380_102324002 179
169 3300014968 Ga0157379_10213370 Ga0157379_102133702 179
170 3300014968 Ga0157379_11500084 Ga0157379_115000841 179
171 3300014969 Ga0157376_10030809 Ga0157376_100308094 179
172 3300017792 Ga0163161_10658713 Ga0163161_106587132 179
173 3300020069 Ga0197907_10086055 Ga0197907_100860553 179
174 3300020069 Ga0197907_10178928 Ga0197907_101789282 179
175 3300020076 Ga0206355_1614130 Ga0206355_16141301 179
176 3300020078 Ga0206352_10882461 Ga0206352_108824612 179
177 3300020080 Ga0206350_10260939 Ga0206350_102609392 179
178 3300020080 Ga0206350_10999973 Ga0206350_109999732 179
179 3300020080 Ga0206350_11122083 Ga0206350_111220832 179
180 3300020080 Ga0206350_11303434 Ga0206350_113034342 179
181 3300020080 Ga0206350_11565754 Ga0206350_115657541 179
182 3300020081 Ga0206354_10740676 Ga0206354_107406761 179
183 3300020082 Ga0206353_10752160 Ga0206353_107521602 179
184 3300021388 Ga0213875_10001681 Ga0213875_100016817 179
185 3300022467 Ga0224712_10007328 Ga0224712_100073283 179
186 3300022467 Ga0224712_10187834 Ga0224712_101878342 179
187 3300025898 Ga0207692_10044810 Ga0207692_100448101 179
188 3300025899 Ga0207642_10095462 Ga0207642_100954622 179
189 3300025900 Ga0207710_10147737 Ga0207710_101477372 179
190 3300025901 Ga0207688_10480726 Ga0207688_104807261 179
191 3300025903 Ga0207680_10227495 Ga0207680_102274952 179
192 3300025906 Ga0207699_10004168 Ga0207699_100041684 179
193 3300025912 Ga0207707_10087974 Ga0207707_100879744 179
194 3300025914 Ga0207671_10792909 Ga0207671_107929091 179
195 3300025915 Ga0207693_10124138 Ga0207693_101241381 179
196 3300025915 Ga0207693_10139457 Ga0207693_101394573 179
197 3300025916 Ga0207663_10451676 Ga0207663_104516762 179
198 3300025917 Ga0207660_10059322 Ga0207660_100593222 179
199 3300025917 Ga0207660_10687692 Ga0207660_106876922 179
200 3300025918 Ga0207662_10364602 Ga0207662_103646021 179
201 3300025919 Ga0207657_10790813 Ga0207657_107908131 179
202 3300025927 Ga0207687_10236705 Ga0207687_102367051 179
203 3300025927 Ga0207687_10497667 Ga0207687_104976672 179
204 3300025929 Ga0207664_10007842 Ga0207664_100078425 179
205 3300025929 Ga0207664_10063634 Ga0207664_100636344 179
206 3300025931 Ga0207644_10354776 Ga0207644_103547762 179
207 3300025932 Ga0207690_10095124 Ga0207690_100951244 179
208 3300025938 Ga0207704_10100550 Ga0207704_101005501 179
209 3300025939 Ga0207665_10007521 Ga0207665_1000752110 179
210 3300025942 Ga0207689_10081438 Ga0207689_100814383 179
211 3300025944 Ga0207661_10151716 Ga0207661_101517163 179
212 3300025981 Ga0207640_10041191 Ga0207640_100411911 179
213 3300025981 Ga0207640_10732354 Ga0207640_107323542 179
214 3300026023 Ga0207677_10980072 Ga0207677_109800721 179
215 3300026075 Ga0207708_10003460 Ga0207708_100034608 179
216 3300026075 Ga0207708_10004679 Ga0207708_100046798 179
217 3300026078 Ga0207702_10022140 Ga0207702_100221405 179
218 3300026078 Ga0207702_10071037 Ga0207702_100710373 179
219 3300026089 Ga0207648_10287513 Ga0207648_102875131 179
220 3300026095 Ga0207676_10227052 Ga0207676_102270523 179
221 3300026116 Ga0207674_10151499 Ga0207674_101514992 179
222 3300026142 Ga0207698_10170666 Ga0207698_101706662 179
223 3300027462 Ga0210000_1032451 Ga0210000_10324511 179
224 3300027907 Ga0207428_10185844 Ga0207428_101858442 179
225 3300027907 Ga0207428_10468242 Ga0207428_104682421 179
226 3300028379 Ga0268266_11087802 Ga0268266_110878022 179
227 3300028794 Ga0307515_10192604 Ga0307515_101926042 179
228 3300031731 Ga0307405_10536379 Ga0307405_105363792 179
229 3300031824 Ga0307413_10306653 Ga0307413_103066531 179
230 3300031852 Ga0307410_10033289 Ga0307410_100332893 179
231 3300031901 Ga0307406_10183033 Ga0307406_101830331 179
232 3300031911 Ga0307412_10121678 Ga0307412_101216782 179
233 3300032002 Ga0307416_100024731 Ga0307416_1000247315 179
234 3300032002 Ga0307416_102217934 Ga0307416_1022179341 179
235 3300032005 Ga0307411_10170800 Ga0307411_101708002 179
236 3300032126 Ga0307415_100099069 Ga0307415_1000990692 179
237 3300032126 Ga0307415_100211585 Ga0307415_1002115852 179
238 3300032126 Ga0307415_100442696 Ga0307415_1004426962 179
239 3300037312 Ga0395899_0087104 Ga0395899_0087104_1069_1629 179
240 3300037418 Ga0395900_0119581 Ga0395900_0119581_485_1075 179
241 3300037466 Ga0395898_0168569 Ga0395898_0168569_978_1529 179
242 3300037853 Ga0436364_1025760 Ga0436364_1025760_24856_25434 179
243 3300038443 Ga0395901_0056160 Ga0395901_0056160_1158_1748 179
244 3300038443 Ga0395901_0583896 Ga0395901_0583896_263_808 179
245 3300044656 Ga0466969_0015397 Ga0466969_0015397_962_1510 179
246 3300044683 Ga0466965_0082631 Ga0466965_0082631_146_721 179
247 3300044684 Ga0466966_0193614 Ga0466966_0193614_306_854 179
248 3300044694 Ga0466963_0015382 Ga0466963_0015382_125_700 179
249 3300044694 Ga0466963_0139724 Ga0466963_0139724_166_738 179
250 3300044765 Ga0466970_0326065 Ga0466970_0326065_143_709 179
251 3300044842 Ga0466957_0028287 Ga0466957_0028287_1510_2085 179
252 3300045049 Ga0466959_0152767 Ga0466959_0152767_92_640 179
253 3300045836 Ga0466958_0088615 Ga0466958_0088615_756_1304 179
254 3300045836 Ga0466958_0097265 Ga0466958_0097265_302_868 179
255 3300045976 Ga0466967_0188082 Ga0466967_0188082_725_1309 179
256 3300046507 Ga0495606_0037138 Ga0495606_0037138_662_1225 179
257 3300046524 Ga0495648_0327024 Ga0495648_0327024_56_607 179
258 3300048903 Ga0496100_0000479 Ga0496100_0000479_2672_3238 179
259 3300048904 Ga0496101_0000401 Ga0496101_0000401_25773_26339 179
260 3300048904 Ga0496101_0098336 Ga0496101_0098336_1444_2028 179
261 3300048904 Ga0496101_0282930 Ga0496101_0282930_599_1183 179
262 3300048905 Ga0496102_0334658 Ga0496102_0334658_508_1092 179
263 3300048907 Ga0496104_0040702 Ga0496104_0040702_382_963 179
264 3300048910 Ga0496107_0043780 Ga0496107_0043780_1819_2403 179
265 3300048911 Ga0496108_0098842 Ga0496108_0098842_1755_2339 179
266 3300048911 Ga0496108_0128669 Ga0496108_0128669_351_920 179
267 3300048912 Ga0496109_0448158 Ga0496109_0448158_559_1128 179
268 3300048912 Ga0496109_0822914 Ga0496109_0822914_124_708 179
269 3300048913 Ga0496110_0126931 Ga0496110_0126931_1073_1639 179
270 3300048913 Ga0496110_0924269 Ga0496110_0924269_120_704 179
271 3300048914 Ga0496111_0477931 Ga0496111_0477931_304_888 179
272 3300048915 Ga0496112_0511387 Ga0496112_0511387_159_743 179
273 3300048917 Ga0496114_0134739 Ga0496114_0134739_870_1454 179
274 3300048917 Ga0496114_0577177 Ga0496114_0577177_223_807 179
275 3300048917 Ga0496114_0603422 Ga0496114_0603422_116_769 179
276 3300048925 Ga0496122_0013255 Ga0496122_0013255_2754_3320 179
277 3300048926 Ga0496123_0001649 Ga0496123_0001649_16215_16781 179
278 3300048927 Ga0496124_0418713 Ga0496124_0418713_315_881 179
279 3300049569 Ga0501032_0059003 Ga0501032_0059003_1540_2106 179
280 3300049569 Ga0501032_0068889 Ga0501032_0068889_999_1583 179
281 3300049572 Ga0501036_0031995 Ga0501036_0031995_1849_2433 179
282 3300049572 Ga0501036_0119708 Ga0501036_0119708_464_1030 179
283 3300049575 Ga0501039_0026838 Ga0501039_0026838_1453_2037 179
284 3300049576 Ga0501040_0013175 Ga0501040_0013175_1356_1940 179
285 3300049577 Ga0501041_0039656 Ga0501041_0039656_913_1497 179
286 3300049578 Ga0501042_0007133 Ga0501042_0007133_4030_4614 179
287 3300049579 Ga0501043_0131725 Ga0501043_0131725_447_1013 179
288 3300049579 Ga0501043_0281710 Ga0501043_0281710_340_924 179
289 3300049580 Ga0501046_0089609 Ga0501046_0089609_1537_2103 179
290 3300049581 Ga0501047_0129446 Ga0501047_0129446_299_865 179
291 3300049582 Ga0501048_0049156 Ga0501048_0049156_1502_2086 179
292 3300049583 Ga0501067_0000062 Ga0501067_0000062_54373_54957 179
293 3300049583 Ga0501067_0364935 Ga0501067_0364935_157_741 179
294 3300049584 Ga0501068_0000016 Ga0501068_0000016_39856_40440 179
295 3300049585 Ga0501069_0001293 Ga0501069_0001293_1544_2128 179
296 3300049585 Ga0501069_0140503 Ga0501069_0140503_132_716 179
297 3300049586 Ga0501070_0231293 Ga0501070_0231293_91_654 179
298 3300049587 Ga0501071_0012857 Ga0501071_0012857_3483_4067 179
299 3300049587 Ga0501071_0311096 Ga0501071_0311096_40_624 179
300 3300049587 Ga0501071_0324691 Ga0501071_0324691_448_1038 179
301 3300049588 Ga0501072_0003348 Ga0501072_0003348_1923_2507 179
302 3300049588 Ga0501072_0625109 Ga0501072_0625109_16_606 179
303 3300049589 Ga0501073_0117360 Ga0501073_0117360_384_968 179
304 3300049590 Ga0501074_0033898 Ga0501074_0033898_1418_2002 179
305 3300049591 Ga0501075_0032114 Ga0501075_0032114_611_1195 179
306 3300049592 Ga0501076_0005562 Ga0501076_0005562_3649_4233 179
307 3300049593 Ga0501077_0015745 Ga0501077_0015745_2081_2665 179
308 3300049741 Ga0501079_0076624 Ga0501079_0076624_742_1326 179
309 3300049742 Ga0501080_0272108 Ga0501080_0272108_83_670 179
310 3300049742 Ga0501080_1111979 Ga0501080_1111979_50_631 179
311 3300049743 Ga0501081_0005277 Ga0501081_0005277_1607_2191 179
312 3300049744 Ga0501083_0054986 Ga0501083_0054986_1121_1705 179
313 3300049822 Ga0501035_0097254 Ga0501035_0097254_506_1090 179
314 3300049822 Ga0501035_0114922 Ga0501035_0114922_277_843 179
315 3300049822 Ga0501035_1098636 Ga0501035_1098636_48_602 179
316 3300049823 Ga0501044_0070812 Ga0501044_0070812_1443_2009 179
317 3300049823 Ga0501044_0127177 Ga0501044_0127177_1604_2158 179
318 3300050509 nmdc:mga0qj67_6664_c1 nmdc:mga0qj67_6664_c1_6006_6596 179
319 3300050510 nmdc:mga06r32_13212_c1 nmdc:mga06r32_13212_c1_1020_1610 179
320 3300050511 nmdc:mga08y16_298933_c1 nmdc:mga08y16_298933_c1_775_1434 179
321 3300050512 nmdc:mga0n895_34628_c1 nmdc:mga0n895_34628_c1_1636_2220 179
322 3300050514 nmdc:mga08x19_309992_c1 nmdc:mga08x19_309992_c1_359_922 179
323 3300053731 Ga0500609_004997 Ga0500609_004997_1119_1670 179
324 3300054114 Ga0501084_0013456 Ga0501084_0013456_1862_2446 179
325 3300059491 Ga0587070_021502 Ga0587070_021502_318_911 179
326 3300059492 Ga0587073_0003126 Ga0587073_0003126_347_940 179
327 3300059493 Ga0587077_017953 Ga0587077_017953_305_898 179
328 3300059503 Ga0587080_021416 Ga0587080_021416_291_884 179
329 3300059504 Ga0587082_021406 Ga0587082_021406_303_896 179
330 3300059511 Ga0587091_041506 Ga0587091_041506_155_748 179
331 3300059513 Ga0587094_023955 Ga0587094_023955_98_691 179
332 3300059623 Ga0587101_008211 Ga0587101_008211_159_752 179
333 3300059624 Ga0587109_021926 Ga0587109_021926_107_700 179
334 3300059626 Ga0587115_016917 Ga0587115_016917_233_826 179
335 3300059640 Ga0587067_023966 Ga0587067_023966_168_761 179
336 3300059642 Ga0587069_029239 Ga0587069_029239_146_739 179
337 3300059643 Ga0587072_026550 Ga0587072_026550_304_897 179
338 3300059644 Ga0587075_088623 Ga0587075_088623_15_584 179
339 3300059645 Ga0587076_032215 Ga0587076_032215_169_762 179
340 3300059647 Ga0587079_043964 Ga0587079_043964_160_753 179
341 3300059652 Ga0587107_017295 Ga0587107_017295_190_783 179
342 3300060353 Ga0501082_0010220 Ga0501082_0010220_1616_2200 179
343 3300061719 Ga0466962_0009699 Ga0466962_0009699_3144_3716 179
344 3300061719 Ga0466962_0298176 Ga0466962_0298176_46_594 179
345 3300061734 Ga0530510_0018053 Ga0530510_0018053_4384_4968 179
346 3300061734 Ga0530510_0050654 Ga0530510_0050654_238_822 179
347 3300005434 Ga0070709_10030918 Ga0070709_100309182 180
348 3300005435 Ga0070714_100020292 Ga0070714_1000202927 180
349 3300005436 Ga0070713_100534013 Ga0070713_1005340132 180
350 3300005437 Ga0070710_10062485 Ga0070710_100624852 180
351 3300005439 Ga0070711_100176983 Ga0070711_1001769831 180
352 3300005981 Ga0081538_10005533 Ga0081538_1000553310 180
353 3300006028 Ga0070717_10179890 Ga0070717_101798904 180
354 3300006173 Ga0070716_100062657 Ga0070716_1000626573 180
355 3300025898 Ga0207692_10085260 Ga0207692_100852602 180
356 3300025906 Ga0207699_10004397 Ga0207699_100043976 180
357 3300025915 Ga0207693_10013495 Ga0207693_100134952 180
358 3300025916 Ga0207663_10079277 Ga0207663_100792771 180
359 3300025916 Ga0207663_10308338 Ga0207663_103083382 180
360 3300025928 Ga0207700_10036458 Ga0207700_100364582 180
361 3300025929 Ga0207664_10016099 Ga0207664_100160993 180
362 3300025939 Ga0207665_10072912 Ga0207665_100729122 180
363 3300032002 Ga0307416_100850769 Ga0307416_1008507692 180
364 3300032126 Ga0307415_100553120 Ga0307415_1005531201 180
365 3300035083 Ga0373926_0003471 Ga0373926_0003471_1602_2153 180
366 3300035089 Ga0373944_0001715 Ga0373944_0001715_1026_1577 180
367 3300035111 Ga0373923_0010331 Ga0373923_0010331_1472_2023 180
368 3300035113 Ga0373936_0005507 Ga0373936_0005507_2831_3382 180
369 3300035116 Ga0373945_0004046 Ga0373945_0004046_1909_2460 180
370 3300035170 Ga0373943_0005188 Ga0373943_0005188_3971_4522 180
371 3300035171 Ga0373946_0000575 Ga0373946_0000575_3940_4491 180
372 3300035172 Ga0373955_0106106 Ga0373955_0106106_30_581 180
373 3300035410 Ga0373924_0028123 Ga0373924_0028123_170_721 180
374 3300035692 Ga0373935_0026219 Ga0373935_0026219_1519_2070 180
375 3300035695 Ga0373927_0010216 Ga0373927_0010216_3880_4431 180
376 3300035725 Ga0373947_0194236 Ga0373947_0194236_500_1051 180
377 3300036401 Ga0373937_0245754 Ga0373937_0245754_1029_1580 180
378 3300037068 Ga0373925_0069162 Ga0373925_0069162_1941_2492 180
379 3300044901 Ga0466960_0146762 Ga0466960_0146762_149_706 180
380 3300046459 Ga0495629_0188919 Ga0495629_0188919_432_983 180
381 3300046461 Ga0495641_0009489 Ga0495641_0009489_3744_4295 180
382 3300046462 Ga0495651_0562169 Ga0495651_0562169_89_640 180
383 3300046463 Ga0495653_0019372 Ga0495653_0019372_4420_4971 180
384 3300046476 Ga0495662_0010934 Ga0495662_0010934_2038_2589 180
385 3300046477 Ga0495664_0006698 Ga0495664_0006698_4362_4913 180
386 3300046511 Ga0495608_0036336 Ga0495608_0036336_1094_1645 180
387 3300046514 Ga0495618_0084824 Ga0495618_0084824_1343_1894 180
388 3300046516 Ga0495628_0503793 Ga0495628_0503793_132_683 180
389 3300046517 Ga0495630_0100745 Ga0495630_0100745_1365_1916 180
390 3300046529 Ga0495652_0145363 Ga0495652_0145363_1035_1586 180
391 3300046531 Ga0495665_0035475 Ga0495665_0035475_924_1475 180
392 3300046533 Ga0495640_0054709 Ga0495640_0054709_1099_1650 180
393 3300046559 Ga0495667_0006224 Ga0495667_0006224_5537_6088 180
394 3300046642 Ga0495634_0046647 Ga0495634_0046647_1306_1857 180
395 3300046663 Ga0495635_0006919 Ga0495635_0006919_5529_6080 180
396 3300046675 Ga0495657_0041497 Ga0495657_0041497_1184_1735 180
397 3300046678 Ga0495599_0040085 Ga0495599_0040085_2060_2611 180
398 3300046690 Ga0495624_0007519 Ga0495624_0007519_5902_6453 180
399 3300046809 Ga0495600_0030565 Ga0495600_0030565_2852_3403 180
400 3300047315 Ga0495581_0047696 Ga0495581_0047696_821_1372 180
401 3300047319 Ga0495674_0017109 Ga0495674_0017109_1843_2394 180
402 3300047321 Ga0495676_0021662 Ga0495676_0021662_4811_5362 180
403 3300047322 Ga0495680_0109069 Ga0495680_0109069_35_586 180
404 3300047471 Ga0495684_0050902 Ga0495684_0050902_1111_1662 180
405 3300047673 Ga0495593_0031800 Ga0495593_0031800_1206_1757 180
406 3300048922 Ga0496119_0043024 Ga0496119_0043024_2194_2760 180
407 3300048923 Ga0496120_0011220 Ga0496120_0011220_133_699 180
408 3300049593 Ga0501077_0340251 Ga0501077_0340251_122_703 180
409 3300044656 Ga0466969_0055878 Ga0466969_0055878_28_624 181
410 3300025981 Ga0207640_10100645 Ga0207640_101006452 182
411 3300026078 Ga0207702_10497884 Ga0207702_104978842 182
412 3300005563 Ga0068855_100010026 Ga0068855_1000100264 183
413 3300005937 Ga0081455_10000396 Ga0081455_1000039652 183
414 3300013104 Ga0157370_10021704 Ga0157370_100217043 183
415 3300013105 Ga0157369_10029248 Ga0157369_100292484 183
416 3300013307 Ga0157372_10441502 Ga0157372_104415023 183
417 3300020069 Ga0197907_11096209 Ga0197907_110962091 183
418 3300020069 Ga0197907_11127221 Ga0197907_111272211 183
419 3300020069 Ga0197907_11442931 Ga0197907_114429312 183
420 3300020070 Ga0206356_10889118 Ga0206356_108891181 183
421 3300020075 Ga0206349_1615072 Ga0206349_16150721 183
422 3300020077 Ga0206351_10024129 Ga0206351_100241291 183
423 3300020080 Ga0206350_10694190 Ga0206350_106941901 183
424 3300020081 Ga0206354_10204561 Ga0206354_102045611 183
425 3300021384 Ga0213876_10031079 Ga0213876_100310794 183
426 3300022467 Ga0224712_10016623 Ga0224712_100166233 183
427 3300022467 Ga0224712_10029936 Ga0224712_100299363 183
428 3300022467 Ga0224712_10053952 Ga0224712_100539522 183
429 3300025913 Ga0207695_10023759 Ga0207695_100237593 183
430 3300025919 Ga0207657_10279991 Ga0207657_102799911 183
431 3300025921 Ga0207652_10141118 Ga0207652_101411183 183
432 3300026142 Ga0207698_10327602 Ga0207698_103276022 183
433 3300037418 Ga0395900_0074446 Ga0395900_0074446_1769_2323 183
434 3300038443 Ga0395901_0110634 Ga0395901_0110634_2272_2826 183
435 3300044656 Ga0466969_0019537 Ga0466969_0019537_30_581 183
436 3300044656 Ga0466969_0180769 Ga0466969_0180769_168_719 183
437 3300044684 Ga0466966_0012056 Ga0466966_0012056_4205_4774 183
438 3300044684 Ga0466966_0020874 Ga0466966_0020874_3684_4235 183
439 3300044693 Ga0466961_0009301 Ga0466961_0009301_4119_4688 183
440 3300044765 Ga0466970_0019622 Ga0466970_0019622_2618_3187 183
441 3300044765 Ga0466970_0643493 Ga0466970_0643493_42_593 183
442 3300045049 Ga0466959_0298550 Ga0466959_0298550_122_673 183
443 3300045836 Ga0466958_0699421 Ga0466958_0699421_47_598 183
444 3300048904 Ga0496101_0175318 Ga0496101_0175318_907_1464 183
445 3300048917 Ga0496114_0061213 Ga0496114_0061213_270_827 183
446 3300061719 Ga0466962_0004800 Ga0466962_0004800_2583_3134 183
447 3300003373 JGI25407J50210_10002871 JGI25407J50210_100028714 184
448 3300005434 Ga0070709_10085287 Ga0070709_100852872 184
449 3300005434 Ga0070709_10245075 Ga0070709_102450752 184
450 3300005434 Ga0070709_10276561 Ga0070709_102765612 184
451 3300005436 Ga0070713_100555422 Ga0070713_1005554222 184
452 3300005437 Ga0070710_10141203 Ga0070710_101412032 184
453 3300005439 Ga0070711_100244919 Ga0070711_1002449192 184
454 3300005564 Ga0070664_100500612 Ga0070664_1005006122 184
455 3300005614 Ga0068856_100196061 Ga0068856_1001960611 184
456 3300005617 Ga0068859_100001908 Ga0068859_1000019089 184
457 3300005981 Ga0081538_10001730 Ga0081538_1000173013 184
458 3300005983 Ga0081540_1000134 Ga0081540_100013487 184
459 3300006028 Ga0070717_10627153 Ga0070717_106271532 184
460 3300006042 Ga0075368_10270361 Ga0075368_102703611 184
461 3300006048 Ga0075363_100411037 Ga0075363_1004110371 184
462 3300006175 Ga0070712_100419855 Ga0070712_1004198552 184
463 3300006175 Ga0070712_100570304 Ga0070712_1005703041 184
464 3300006931 Ga0097620_100001908 Ga0097620_10000190813 184
465 3300009101 Ga0105247_10000043 Ga0105247_1000004348 184
466 3300009101 Ga0105247_10001971 Ga0105247_100019715 184
467 3300009174 Ga0105241_10851736 Ga0105241_108517361 184
468 3300009177 Ga0105248_10004160 Ga0105248_1000416014 184
469 3300014325 Ga0163163_10253062 Ga0163163_102530622 184
470 3300020069 Ga0197907_11401217 Ga0197907_114012173 184
471 3300020075 Ga0206349_1149084 Ga0206349_11490841 184
472 3300020075 Ga0206349_1761265 Ga0206349_17612651 184
473 3300020076 Ga0206355_1548352 Ga0206355_15483523 184
474 3300020080 Ga0206350_10233564 Ga0206350_102335642 184
475 3300020610 Ga0154015_1616732 Ga0154015_16167322 184
476 3300021384 Ga0213876_10156836 Ga0213876_101568362 184
477 3300021388 Ga0213875_10146747 Ga0213875_101467472 184
478 3300022467 Ga0224712_10050345 Ga0224712_100503452 184
479 3300022467 Ga0224712_10285643 Ga0224712_102856431 184
480 3300022467 Ga0224712_10464196 Ga0224712_104641961 184
481 3300022467 Ga0224712_10482934 Ga0224712_104829341 184
482 3300025735 Ga0207713_1050987 Ga0207713_10509872 184
483 3300025898 Ga0207692_10141843 Ga0207692_101418432 184
484 3300025900 Ga0207710_10000064 Ga0207710_1000006455 184
485 3300025900 Ga0207710_10051326 Ga0207710_100513264 184
486 3300025906 Ga0207699_10057446 Ga0207699_100574462 184
487 3300025906 Ga0207699_10059550 Ga0207699_100595502 184
488 3300025906 Ga0207699_10264188 Ga0207699_102641882 184
489 3300025915 Ga0207693_10047634 Ga0207693_100476342 184
490 3300025915 Ga0207693_10135899 Ga0207693_101358992 184
491 3300025916 Ga0207663_10189056 Ga0207663_101890562 184
492 3300025916 Ga0207663_10354951 Ga0207663_103549512 184
493 3300025928 Ga0207700_10011627 Ga0207700_100116275 184
494 3300025928 Ga0207700_10489711 Ga0207700_104897112 184
495 3300025929 Ga0207664_10065693 Ga0207664_100656931 184
496 3300025929 Ga0207664_10101021 Ga0207664_101010214 184
497 3300025939 Ga0207665_10009742 Ga0207665_100097422 184
498 3300025941 Ga0207711_10075760 Ga0207711_100757603 184
499 3300035083 Ga0373926_0003247 Ga0373926_0003247_429_992 184
500 3300035089 Ga0373944_0001489 Ga0373944_0001489_2643_3206 184
501 3300035111 Ga0373923_0027654 Ga0373923_0027654_1036_1599 184
502 3300035113 Ga0373936_0001869 Ga0373936_0001869_3738_4301 184
503 3300035116 Ga0373945_0011963 Ga0373945_0011963_1717_2280 184
504 3300035170 Ga0373943_0004349 Ga0373943_0004349_816_1379 184
505 3300035171 Ga0373946_0000042 Ga0373946_0000042_28213_28776 184
506 3300035172 Ga0373955_0049025 Ga0373955_0049025_1642_2220 184
507 3300035692 Ga0373935_0001080 Ga0373935_0001080_10191_10754 184
508 3300035695 Ga0373927_0003836 Ga0373927_0003836_6406_6969 184
509 3300035725 Ga0373947_0001186 Ga0373947_0001186_5870_6433 184
510 3300036401 Ga0373937_0705843 Ga0373937_0705843_350_913 184
511 3300037068 Ga0373925_0012878 Ga0373925_0012878_2757_3320 184
512 3300037466 Ga0395898_0769268 Ga0395898_0769268_318_878 184
513 3300037853 Ga0436364_0861475 Ga0436364_0861475_253_822 184
514 3300039437 Ga0436365_0327584 Ga0436365_0327584_139_699 184
515 3300039437 Ga0436365_0933082 Ga0436365_0933082_33_602 184
516 3300039453 Ga0436362_0068107 Ga0436362_0068107_778_1338 184
517 3300044656 Ga0466969_0000554 Ga0466969_0000554_17569_18165 184
518 3300044683 Ga0466965_0017743 Ga0466965_0017743_236_799 184
519 3300044684 Ga0466966_0295896 Ga0466966_0295896_332_940 184
520 3300044693 Ga0466961_0157929 Ga0466961_0157929_817_1371 184
521 3300044693 Ga0466961_0336565 Ga0466961_0336565_234_809 184
522 3300044694 Ga0466963_0012536 Ga0466963_0012536_2807_3370 184
523 3300044694 Ga0466963_0038565 Ga0466963_0038565_1522_2079 184
524 3300044694 Ga0466963_0062782 Ga0466963_0062782_1255_1809 184
525 3300044694 Ga0466963_0141357 Ga0466963_0141357_802_1365 184
526 3300044706 Ga0466964_0359420 Ga0466964_0359420_40_603 184
527 3300044719 Ga0466971_0158743 Ga0466971_0158743_337_891 184
528 3300044765 Ga0466970_0044326 Ga0466970_0044326_757_1317 184
529 3300044842 Ga0466957_0075535 Ga0466957_0075535_281_841 184
530 3300044901 Ga0466960_0150196 Ga0466960_0150196_336_899 184
531 3300045049 Ga0466959_0250298 Ga0466959_0250298_402_956 184
532 3300045049 Ga0466959_0472641 Ga0466959_0472641_243_818 184
533 3300045836 Ga0466958_0013798 Ga0466958_0013798_2840_3400 184
534 3300045836 Ga0466958_0189382 Ga0466958_0189382_698_1273 184
535 3300045836 Ga0466958_0351855 Ga0466958_0351855_69_632 184
536 3300045976 Ga0466967_0047896 Ga0466967_0047896_1941_2504 184
537 3300045976 Ga0466967_0109999 Ga0466967_0109999_498_1061 184
538 3300045976 Ga0466967_0137775 Ga0466967_0137775_889_1443 184
539 3300045976 Ga0466967_0556818 Ga0466967_0556818_510_1064 184
540 3300045976 Ga0466967_1590455 Ga0466967_1590455_45_605 184
541 3300046455 Ga0495603_0105267 Ga0495603_0105267_814_1380 184
542 3300046459 Ga0495629_0305964 Ga0495629_0305964_246_809 184
543 3300046461 Ga0495641_0014000 Ga0495641_0014000_1800_2363 184
544 3300046462 Ga0495651_0221150 Ga0495651_0221150_464_1027 184
545 3300046463 Ga0495653_0025616 Ga0495653_0025616_1984_2547 184
546 3300046473 Ga0495582_0006701 Ga0495582_0006701_3062_3625 184
547 3300046475 Ga0495639_0033051 Ga0495639_0033051_1334_1897 184
548 3300046476 Ga0495662_0118063 Ga0495662_0118063_158_721 184
549 3300046477 Ga0495664_0058322 Ga0495664_0058322_264_827 184
550 3300046511 Ga0495608_0143016 Ga0495608_0143016_381_944 184
551 3300046514 Ga0495618_0010834 Ga0495618_0010834_3236_3799 184
552 3300046515 Ga0495620_0149522 Ga0495620_0149522_15_575 184
553 3300046517 Ga0495630_0006044 Ga0495630_0006044_6267_6830 184
554 3300046529 Ga0495652_0074859 Ga0495652_0074859_523_1086 184
555 3300046531 Ga0495665_0052675 Ga0495665_0052675_1233_1796 184
556 3300046533 Ga0495640_0015045 Ga0495640_0015045_5002_5565 184
557 3300046535 Ga0495586_0347136 Ga0495586_0347136_261_824 184
558 3300046543 Ga0495645_0204505 Ga0495645_0204505_135_698 184
559 3300046559 Ga0495667_0001662 Ga0495667_0001662_5155_5718 184
560 3300046642 Ga0495634_0040656 Ga0495634_0040656_1863_2426 184
561 3300046663 Ga0495635_0001316 Ga0495635_0001316_10090_10653 184
562 3300046675 Ga0495657_0007892 Ga0495657_0007892_1030_1593 184
563 3300046678 Ga0495599_0209307 Ga0495599_0209307_435_1043 184
564 3300046690 Ga0495624_0001128 Ga0495624_0001128_8894_9457 184
565 3300046809 Ga0495600_0157577 Ga0495600_0157577_563_1126 184
566 3300047315 Ga0495581_0018592 Ga0495581_0018592_3388_3951 184
567 3300047319 Ga0495674_0006084 Ga0495674_0006084_6684_7247 184
568 3300047321 Ga0495676_0002527 Ga0495676_0002527_4141_4704 184
569 3300047321 Ga0495676_0006548 Ga0495676_0006548_1281_1847 184
570 3300047322 Ga0495680_0095280 Ga0495680_0095280_489_1052 184
571 3300047471 Ga0495684_0024834 Ga0495684_0024834_3952_4515 184
572 3300048905 Ga0496102_0000557 Ga0496102_0000557_1111_1668 184
573 3300048906 Ga0496103_0000434 Ga0496103_0000434_33050_33607 184
574 3300048913 Ga0496110_0235544 Ga0496110_0235544_257_820 184
575 3300048920 Ga0496117_0208051 Ga0496117_0208051_86_643 184
576 3300048921 Ga0496118_0004525 Ga0496118_0004525_2706_3263 184
577 3300048922 Ga0496119_0000215 Ga0496119_0000215_264_845 184
578 3300048923 Ga0496120_0000264 Ga0496120_0000264_83678_84259 184
579 3300048923 Ga0496120_0205285 Ga0496120_0205285_89_646 184
580 3300048924 Ga0496121_0039957 Ga0496121_0039957_877_1434 184
581 3300048929 Ga0496126_0104917 Ga0496126_0104917_1846_2415 184
582 3300049585 Ga0501069_0052000 Ga0501069_0052000_1706_2266 184
583 3300049586 Ga0501070_0253779 Ga0501070_0253779_856_1416 184
584 3300049742 Ga0501080_0078578 Ga0501080_0078578_1699_2256 184
585 3300050489 nmdc:mga03683_143183_c1 nmdc:mga03683_143183_c1_478_1044 184
586 3300053078 Ga0495612_0033699 Ga0495612_0033699_1460_2038 184
587 3300053078 Ga0495612_0284934 Ga0495612_0284934_163_726 184
588 3300053084 Ga0495595_0444073 Ga0495595_0444073_28_591 184
589 3300053134 Ga0500658_0066438 Ga0500658_0066438_536_1090 184
590 3300061719 Ga0466962_0188366 Ga0466962_0188366_93_668 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

30

198

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9772 5 182
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9706 8 181
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9676 9 181
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9676 9 180
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9655 9 181
ID Description Score Start End Superfamily
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9752 5 182 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9676 9 181 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9539 7 184 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9489 8 184 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9449 9 181 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1F2Q4L0-F1-model_v4 deleted 1.005 92 181
AF-A0A4R6WVT8-F1-model_v4 deleted 1.002 92 181
AF-A0A7W9IBH6-F1-model_v4 Protease I (EC 3.2.-.-) 1 5 175 GO:0006508
GO:0008233
GO:0016798
AF-A0A7K2MGU3-F1-model_v4 Protease 1 9 148 GO:0006508
GO:0008233
AF-A0A2N8PBM3-F1-model_v4 Glutamine amidotransferase 0.9999 9 184 GO:0016740

Feature Viewer

pLDDT pTM Quality
97.55 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map