F467010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 330 | 578 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300050511|nmdc:mga08y16_298933_c1|nmdc:mga08y16_298933_c1_775_1434 |
| Length | 219 |
| Sequence | LQLFGARGARRTTLDQGRSETIMAKQLEGKRIAFLAADGFEQSELEQPWNEIKNAGATVELLSVHKGSIQGMRHMDKGDAFEVDRLVAESDAADYDGLVLPGGVANPDMLRTNLPAVEFVRDFFAQSKPVAAICHGPWTLVEADVVRGRTVTSWPSLKTDIRNAGGQWVDEEVHVDRGLVTSRKPADLPAFCAKAIEEFAEGRHSGRRAAEQSTQRPSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 2 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 3 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 4 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 5 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 6 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 7 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 8 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 9 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 10 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 11 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 52 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 94 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 96 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 97 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 139 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 140 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 143 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 301 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 302 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 304 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 305 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 330 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.31 |
| Metatranscriptomes | 9.66 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.2 |
| Nodule | 0 |
| Rhizoplane | 3.9 |
| Rhizosphere | 86.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10002871 | 3300003373 | Bacteria | 4102 |
| 2 | JGI25407J50210_10025243 | 3300003373 | Bacteria | 1541 |
| 3 | JGI25407J50210_10026802 | 3300003373 | Bacteria | 1494 |
| 4 | Ga0006562J51391_1027212 | 3300003578 | Bacteria | 4058 |
| 5 | Ga0070683_100075218 | 3300005329 | Bacteria | 3155 |
| 6 | Ga0068869_100071045 | 3300005334 | Bacteria | 2577 |
| 7 | Ga0070680_100100332 | 3300005336 | Bacteria | 2403 |
| 8 | Ga0070682_100150451 | 3300005337 | Bacteria | 1596 |
| 9 | Ga0068868_100185162 | 3300005338 | Bacteria | 1729 |
| 10 | Ga0070692_10051859 | 3300005345 | Bacteria | 2135 |
| 11 | Ga0070671_100291495 | 3300005355 | Bacteria | 1389 |
| 12 | Ga0070703_10097025 | 3300005406 | Bacteria | 1033 |
| 13 | Ga0070709_10004861 | 3300005434 | Bacteria | 7262 |
| 14 | Ga0070709_10030918 | 3300005434 | Bacteria | 3217 |
| 15 | Ga0070709_10056492 | 3300005434 | Bacteria | 2482 |
| 16 | Ga0070709_10085287 | 3300005434 | Bacteria | 2071 |
| 17 | Ga0070709_10245075 | 3300005434 | Bacteria | 1288 |
| 18 | Ga0070709_10276561 | 3300005434 | Bacteria | 1219 |
| 19 | Ga0070714_100003734 | 3300005435 | Bacteria | 11416 |
| 20 | Ga0070714_100020292 | 3300005435 | Bacteria | 5425 |
| 21 | Ga0070714_100045045 | 3300005435 | Bacteria | 3737 |
| 22 | Ga0070713_100116333 | 3300005436 | Bacteria | 2338 |
| 23 | Ga0070713_100534013 | 3300005436 | Bacteria | 1109 |
| 24 | Ga0070713_100555422 | 3300005436 | Bacteria | 1087 |
| 25 | Ga0070710_10062485 | 3300005437 | Bacteria | 2124 |
| 26 | Ga0070710_10067015 | 3300005437 | Bacteria | 2059 |
| 27 | Ga0070710_10141203 | 3300005437 | Bacteria | 1477 |
| 28 | Ga0070701_10020718 | 3300005438 | Bacteria | 3126 |
| 29 | Ga0070701_10067689 | 3300005438 | Bacteria | 1900 |
| 30 | Ga0070711_100001344 | 3300005439 | Bacteria | 13433 |
| 31 | Ga0070711_100176983 | 3300005439 | Bacteria | 1630 |
| 32 | Ga0070711_100244919 | 3300005439 | Bacteria | 1403 |
| 33 | Ga0070694_100329355 | 3300005444 | Bacteria | 1177 |
| 34 | Ga0070694_101238766 | 3300005444 | Bacteria | 626 |
| 35 | Ga0070662_100031723 | 3300005457 | Bacteria | 3711 |
| 36 | Ga0070681_10441018 | 3300005458 | Bacteria | 1214 |
| 37 | Ga0068867_100893430 | 3300005459 | Bacteria | 799 |
| 38 | Ga0070685_10092536 | 3300005466 | Bacteria | 1832 |
| 39 | Ga0070684_100032346 | 3300005535 | Bacteria | 4457 |
| 40 | Ga0070695_100485194 | 3300005545 | Bacteria | 953 |
| 41 | Ga0070696_100189369 | 3300005546 | Bacteria | 1531 |
| 42 | Ga0068855_100010026 | 3300005563 | Bacteria | 11418 |
| 43 | Ga0070664_100017823 | 3300005564 | Bacteria | 5831 |
| 44 | Ga0070664_100500612 | 3300005564 | Bacteria | 1120 |
| 45 | Ga0068857_100199910 | 3300005577 | Bacteria | 1822 |
| 46 | Ga0068854_100181392 | 3300005578 | Bacteria | 1645 |
| 47 | Ga0068856_100031483 | 3300005614 | Bacteria | 5190 |
| 48 | Ga0068856_100196061 | 3300005614 | Bacteria | 2034 |
| 49 | Ga0068856_100404548 | 3300005614 | Bacteria | 1384 |
| 50 | Ga0068856_100772159 | 3300005614 | Bacteria | 981 |
| 51 | Ga0068852_100106717 | 3300005616 | Bacteria | 2539 |
| 52 | Ga0068859_100001908 | 3300005617 | Bacteria | 21260 |
| 53 | Ga0068859_100075074 | 3300005617 | Bacteria | 3421 |
| 54 | Ga0068859_101889324 | 3300005617 | Bacteria | 659 |
| 55 | Ga0068861_100018401 | 3300005719 | Bacteria | 4978 |
| 56 | Ga0068860_101172375 | 3300005843 | Bacteria | 788 |
| 57 | Ga0068862_100271597 | 3300005844 | Bacteria | 1551 |
| 58 | Ga0081455_10000396 | 3300005937 | Bacteria | 57399 |
| 59 | Ga0081538_10000113 | 3300005981 | Bacteria | 81440 |
| 60 | Ga0081538_10000358 | 3300005981 | Bacteria | 51878 |
| 61 | Ga0081538_10001730 | 3300005981 | Bacteria | 22186 |
| 62 | Ga0081538_10005533 | 3300005981 | Bacteria | 11346 |
| 63 | Ga0081540_1000134 | 3300005983 | Bacteria | 79126 |
| 64 | Ga0081539_10007485 | 3300005985 | Bacteria | 9929 |
| 65 | Ga0070717_10000010 | 3300006028 | Bacteria | 283501 |
| 66 | Ga0070717_10179890 | 3300006028 | Bacteria | 1843 |
| 67 | Ga0070717_10627153 | 3300006028 | Bacteria | 975 |
| 68 | Ga0075368_10270361 | 3300006042 | Bacteria | 729 |
| 69 | Ga0075363_100411037 | 3300006048 | Bacteria | 796 |
| 70 | Ga0070716_100003762 | 3300006173 | Bacteria | 7185 |
| 71 | Ga0070716_100062657 | 3300006173 | Bacteria | 2157 |
| 72 | Ga0070712_100041266 | 3300006175 | Bacteria | 3168 |
| 73 | Ga0070712_100150672 | 3300006175 | Bacteria | 1785 |
| 74 | Ga0070712_100419855 | 3300006175 | Bacteria | 1108 |
| 75 | Ga0070712_100570304 | 3300006175 | Bacteria | 955 |
| 76 | Ga0075428_100034195 | 3300006844 | Bacteria | 5608 |
| 77 | Ga0075428_100067932 | 3300006844 | Bacteria | 3900 |
| 78 | Ga0075430_100002361 | 3300006846 | Bacteria | 15685 |
| 79 | Ga0075430_100065028 | 3300006846 | Bacteria | 3065 |
| 80 | Ga0075431_100057829 | 3300006847 | Bacteria | 3999 |
| 81 | Ga0075434_100028417 | 3300006871 | Bacteria | 5494 |
| 82 | Ga0075436_100145047 | 3300006914 | Bacteria | 1669 |
| 83 | Ga0097620_100001908 | 3300006931 | Bacteria | 21260 |
| 84 | Ga0097620_100075074 | 3300006931 | Bacteria | 3421 |
| 85 | Ga0097620_101888639 | 3300006931 | Bacteria | 659 |
| 86 | Ga0105245_10109368 | 3300009098 | Bacteria | 2568 |
| 87 | Ga0105247_10000043 | 3300009101 | Bacteria | 157839 |
| 88 | Ga0105247_10001971 | 3300009101 | Bacteria | 14262 |
| 89 | Ga0105247_10272944 | 3300009101 | Bacteria | 1164 |
| 90 | Ga0105243_10135150 | 3300009148 | Bacteria | 2097 |
| 91 | Ga0105243_10336043 | 3300009148 | Bacteria | 1382 |
| 92 | Ga0105243_11303627 | 3300009148 | Bacteria | 743 |
| 93 | Ga0105241_10140018 | 3300009174 | Bacteria | 1969 |
| 94 | Ga0105241_10851736 | 3300009174 | Bacteria | 843 |
| 95 | Ga0105242_10391854 | 3300009176 | Bacteria | 1294 |
| 96 | Ga0105248_10004160 | 3300009177 | Bacteria | 16004 |
| 97 | Ga0105248_10495602 | 3300009177 | Bacteria | 1377 |
| 98 | Ga0105237_10318260 | 3300009545 | Bacteria | 1559 |
| 99 | Ga0105237_10443481 | 3300009545 | Bacteria | 1304 |
| 100 | Ga0105238_10103489 | 3300009551 | Bacteria | 2828 |
| 101 | Ga0105249_10418848 | 3300009553 | Bacteria | 1373 |
| 102 | Ga0105249_10881733 | 3300009553 | Bacteria | 961 |
| 103 | Ga0105239_10406304 | 3300010375 | Bacteria | 1541 |
| 104 | Ga0157370_10017021 | 3300013104 | Bacteria | 7345 |
| 105 | Ga0157370_10021704 | 3300013104 | Bacteria | 6397 |
| 106 | Ga0157369_10023921 | 3300013105 | Bacteria | 6800 |
| 107 | Ga0157369_10029248 | 3300013105 | Bacteria | 6090 |
| 108 | Ga0157369_10735323 | 3300013105 | Bacteria | 1015 |
| 109 | Ga0157374_10333883 | 3300013296 | Bacteria | 1504 |
| 110 | Ga0163162_10887496 | 3300013306 | Bacteria | 1005 |
| 111 | Ga0157372_10441502 | 3300013307 | Bacteria | 1517 |
| 112 | Ga0157375_10452768 | 3300013308 | Bacteria | 1449 |
| 113 | Ga0157375_10577400 | 3300013308 | Bacteria | 1285 |
| 114 | Ga0157375_10872147 | 3300013308 | Bacteria | 1045 |
| 115 | Ga0163163_10253062 | 3300014325 | Bacteria | 1812 |
| 116 | Ga0163163_10995208 | 3300014325 | Bacteria | 902 |
| 117 | Ga0157380_10232400 | 3300014326 | Bacteria | 1657 |
| 118 | Ga0157380_10812587 | 3300014326 | Bacteria | 953 |
| 119 | Ga0157379_10213370 | 3300014968 | Bacteria | 1748 |
| 120 | Ga0157379_11500084 | 3300014968 | Bacteria | 656 |
| 121 | Ga0157376_10030809 | 3300014969 | Bacteria | 4288 |
| 122 | Ga0163161_10658713 | 3300017792 | Bacteria | 868 |
| 123 | Ga0197907_10086055 | 3300020069 | Bacteria | 1597 |
| 124 | Ga0197907_10178928 | 3300020069 | Bacteria | 1415 |
| 125 | Ga0197907_11096209 | 3300020069 | Bacteria | 1773 |
| 126 | Ga0197907_11127221 | 3300020069 | Bacteria | 602 |
| 127 | Ga0197907_11401217 | 3300020069 | Bacteria | 1157 |
| 128 | Ga0197907_11442931 | 3300020069 | Bacteria | 2172 |
| 129 | Ga0206356_10889118 | 3300020070 | Bacteria | 1469 |
| 130 | Ga0206356_11126787 | 3300020070 | Bacteria | 1550 |
| 131 | Ga0206349_1149084 | 3300020075 | Bacteria | 708 |
| 132 | Ga0206349_1615072 | 3300020075 | Bacteria | 673 |
| 133 | Ga0206349_1761265 | 3300020075 | Bacteria | 615 |
| 134 | Ga0206355_1548352 | 3300020076 | Bacteria | 1112 |
| 135 | Ga0206355_1614130 | 3300020076 | Bacteria | 748 |
| 136 | Ga0206351_10024129 | 3300020077 | Bacteria | 1614 |
| 137 | Ga0206352_10882461 | 3300020078 | Bacteria | 1355 |
| 138 | Ga0206350_10233564 | 3300020080 | Bacteria | 951 |
| 139 | Ga0206350_10260939 | 3300020080 | Bacteria | 859 |
| 140 | Ga0206350_10694190 | 3300020080 | Bacteria | 678 |
| 141 | Ga0206350_10999973 | 3300020080 | Bacteria | 1616 |
| 142 | Ga0206350_11122083 | 3300020080 | Bacteria | 1205 |
| 143 | Ga0206350_11303434 | 3300020080 | Bacteria | 1136 |
| 144 | Ga0206350_11565754 | 3300020080 | Unclassified | 635 |
| 145 | Ga0206354_10204561 | 3300020081 | Bacteria | 930 |
| 146 | Ga0206354_10740676 | 3300020081 | Bacteria | 1518 |
| 147 | Ga0206353_10752160 | 3300020082 | Bacteria | 1209 |
| 148 | Ga0154015_1616732 | 3300020610 | Bacteria | 886 |
| 149 | Ga0213876_10031079 | 3300021384 | Bacteria | 2819 |
| 150 | Ga0213876_10156836 | 3300021384 | Bacteria | 1211 |
| 151 | Ga0213875_10001681 | 3300021388 | Bacteria | 13934 |
| 152 | Ga0213875_10146747 | 3300021388 | Bacteria | 1105 |
| 153 | Ga0224712_10007328 | 3300022467 | Bacteria | 3207 |
| 154 | Ga0224712_10016623 | 3300022467 | Bacteria | 2422 |
| 155 | Ga0224712_10029936 | 3300022467 | Bacteria | 1960 |
| 156 | Ga0224712_10050345 | 3300022467 | Bacteria | 1618 |
| 157 | Ga0224712_10053952 | 3300022467 | Bacteria | 1576 |
| 158 | Ga0224712_10187834 | 3300022467 | Bacteria | 934 |
| 159 | Ga0224712_10285643 | 3300022467 | Bacteria | 769 |
| 160 | Ga0224712_10424345 | 3300022467 | Bacteria | 636 |
| 161 | Ga0224712_10464196 | 3300022467 | Bacteria | 609 |
| 162 | Ga0224712_10482934 | 3300022467 | Bacteria | 597 |
| 163 | Ga0256744_151210 | 3300023309 | Bacteria | 919 |
| 164 | Ga0256743_102384 | 3300023436 | Unclassified | 1011 |
| 165 | Ga0207426_1001457 | 3300025302 | Bacteria | 19586 |
| 166 | Ga0207713_1050987 | 3300025735 | Bacteria | 1648 |
| 167 | Ga0207692_10044810 | 3300025898 | Bacteria | 2209 |
| 168 | Ga0207692_10085260 | 3300025898 | Bacteria | 1699 |
| 169 | Ga0207692_10141843 | 3300025898 | Bacteria | 1367 |
| 170 | Ga0207642_10095462 | 3300025899 | Bacteria | 1480 |
| 171 | Ga0207710_10000064 | 3300025900 | Bacteria | 162498 |
| 172 | Ga0207710_10051326 | 3300025900 | Bacteria | 1852 |
| 173 | Ga0207710_10147737 | 3300025900 | Unclassified | 1138 |
| 174 | Ga0207688_10480726 | 3300025901 | Bacteria | 776 |
| 175 | Ga0207680_10227495 | 3300025903 | Bacteria | 1281 |
| 176 | Ga0207699_10004168 | 3300025906 | Bacteria | 6924 |
| 177 | Ga0207699_10004397 | 3300025906 | Bacteria | 6740 |
| 178 | Ga0207699_10057446 | 3300025906 | Bacteria | 2323 |
| 179 | Ga0207699_10059550 | 3300025906 | Bacteria | 2289 |
| 180 | Ga0207699_10264188 | 3300025906 | Bacteria | 1190 |
| 181 | Ga0207707_10087974 | 3300025912 | Bacteria | 2714 |
| 182 | Ga0207695_10023759 | 3300025913 | Bacteria | 6918 |
| 183 | Ga0207671_10792909 | 3300025914 | Bacteria | 751 |
| 184 | Ga0207693_10013495 | 3300025915 | Bacteria | 6585 |
| 185 | Ga0207693_10047634 | 3300025915 | Bacteria | 3367 |
| 186 | Ga0207693_10124138 | 3300025915 | Bacteria | 2028 |
| 187 | Ga0207693_10135899 | 3300025915 | Bacteria | 1933 |
| 188 | Ga0207693_10139457 | 3300025915 | Bacteria | 1907 |
| 189 | Ga0207663_10079277 | 3300025916 | Bacteria | 2144 |
| 190 | Ga0207663_10189056 | 3300025916 | Bacteria | 1477 |
| 191 | Ga0207663_10308338 | 3300025916 | Bacteria | 1185 |
| 192 | Ga0207663_10354951 | 3300025916 | Bacteria | 1111 |
| 193 | Ga0207663_10451676 | 3300025916 | Bacteria | 991 |
| 194 | Ga0207660_10059322 | 3300025917 | Bacteria | 2746 |
| 195 | Ga0207660_10687692 | 3300025917 | Bacteria | 834 |
| 196 | Ga0207662_10364602 | 3300025918 | Bacteria | 973 |
| 197 | Ga0207657_10279991 | 3300025919 | Bacteria | 1324 |
| 198 | Ga0207657_10790813 | 3300025919 | Bacteria | 734 |
| 199 | Ga0207652_10141118 | 3300025921 | Bacteria | 2154 |
| 200 | Ga0207687_10236705 | 3300025927 | Bacteria | 1445 |
| 201 | Ga0207687_10497667 | 3300025927 | Bacteria | 1017 |
| 202 | Ga0207700_10011627 | 3300025928 | Bacteria | 5624 |
| 203 | Ga0207700_10036458 | 3300025928 | Bacteria | 3552 |
| 204 | Ga0207700_10489711 | 3300025928 | Bacteria | 1087 |
| 205 | Ga0207664_10007842 | 3300025929 | Bacteria | 7417 |
| 206 | Ga0207664_10016099 | 3300025929 | Bacteria | 5447 |
| 207 | Ga0207664_10063634 | 3300025929 | Bacteria | 2948 |
| 208 | Ga0207664_10065693 | 3300025929 | Bacteria | 2905 |
| 209 | Ga0207664_10101021 | 3300025929 | Bacteria | 2382 |
| 210 | Ga0207644_10354776 | 3300025931 | Bacteria | 1192 |
| 211 | Ga0207690_10095124 | 3300025932 | Bacteria | 2116 |
| 212 | Ga0207704_10100550 | 3300025938 | Bacteria | 1926 |
| 213 | Ga0207665_10007521 | 3300025939 | Bacteria | 7201 |
| 214 | Ga0207665_10009742 | 3300025939 | Bacteria | 6308 |
| 215 | Ga0207665_10072912 | 3300025939 | Bacteria | 2347 |
| 216 | Ga0207711_10075760 | 3300025941 | Bacteria | 2929 |
| 217 | Ga0207689_10081438 | 3300025942 | Bacteria | 2661 |
| 218 | Ga0207661_10151716 | 3300025944 | Bacteria | 2003 |
| 219 | Ga0207640_10041191 | 3300025981 | Bacteria | 2936 |
| 220 | Ga0207640_10100645 | 3300025981 | Bacteria | 2026 |
| 221 | Ga0207640_10732354 | 3300025981 | Bacteria | 851 |
| 222 | Ga0207677_10980072 | 3300026023 | Bacteria | 766 |
| 223 | Ga0207708_10003460 | 3300026075 | Bacteria | 11636 |
| 224 | Ga0207708_10004679 | 3300026075 | Bacteria | 10067 |
| 225 | Ga0207708_10021807 | 3300026075 | Bacteria | 4833 |
| 226 | Ga0207702_10022140 | 3300026078 | Bacteria | 5267 |
| 227 | Ga0207702_10071037 | 3300026078 | Bacteria | 2996 |
| 228 | Ga0207702_10497884 | 3300026078 | Bacteria | 1188 |
| 229 | Ga0207648_10287513 | 3300026089 | Bacteria | 1471 |
| 230 | Ga0207676_10227052 | 3300026095 | Bacteria | 1667 |
| 231 | Ga0207674_10151499 | 3300026116 | Bacteria | 2276 |
| 232 | Ga0207675_100068423 | 3300026118 | Bacteria | 3318 |
| 233 | Ga0207698_10170666 | 3300026142 | Bacteria | 1915 |
| 234 | Ga0207698_10327602 | 3300026142 | Bacteria | 1437 |
| 235 | Ga0210000_1032451 | 3300027462 | Bacteria | 819 |
| 236 | Ga0207428_10185844 | 3300027907 | Bacteria | 1568 |
| 237 | Ga0207428_10468242 | 3300027907 | Bacteria | 917 |
| 238 | Ga0268266_10039924 | 3300028379 | Bacteria | 3998 |
| 239 | Ga0268266_11087802 | 3300028379 | Bacteria | 774 |
| 240 | Ga0307517_10002470 | 3300028786 | Bacteria | 29566 |
| 241 | Ga0307515_10001437 | 3300028794 | Bacteria | 53784 |
| 242 | Ga0307515_10192604 | 3300028794 | Bacteria | 1943 |
| 243 | Ga0307515_10337868 | 3300028794 | Bacteria | 1160 |
| 244 | Ga0311001_1064471 | 3300029277 | Unclassified | 918 |
| 245 | Ga0307511_10097416 | 3300030521 | Bacteria | 1953 |
| 246 | Ga0307512_10031781 | 3300030522 | Bacteria | 4566 |
| 247 | Ga0307408_100254992 | 3300031548 | Bacteria | 1449 |
| 248 | Ga0307508_10083830 | 3300031616 | Bacteria | 2770 |
| 249 | Ga0307514_10124636 | 3300031649 | Bacteria | 1788 |
| 250 | Ga0307514_10198102 | 3300031649 | Bacteria | 1267 |
| 251 | Ga0307516_10033191 | 3300031730 | Bacteria | 5194 |
| 252 | Ga0307405_10536379 | 3300031731 | Bacteria | 944 |
| 253 | Ga0307413_10104148 | 3300031824 | Bacteria | 1883 |
| 254 | Ga0307413_10306653 | 3300031824 | Bacteria | 1206 |
| 255 | Ga0307518_10055967 | 3300031838 | Bacteria | 2866 |
| 256 | Ga0307410_10033289 | 3300031852 | Bacteria | 3326 |
| 257 | Ga0307406_10183033 | 3300031901 | Bacteria | 1527 |
| 258 | Ga0307407_10361358 | 3300031903 | Bacteria | 1031 |
| 259 | Ga0307412_10121678 | 3300031911 | Bacteria | 1880 |
| 260 | Ga0307409_100041481 | 3300031995 | Bacteria | 3438 |
| 261 | Ga0307416_100024731 | 3300032002 | Bacteria | 4390 |
| 262 | Ga0307416_100637936 | 3300032002 | Bacteria | 1149 |
| 263 | Ga0307416_100850769 | 3300032002 | Bacteria | 1010 |
| 264 | Ga0307416_102217934 | 3300032002 | Bacteria | 650 |
| 265 | Ga0307414_10023024 | 3300032004 | Bacteria | 3941 |
| 266 | Ga0307411_10170800 | 3300032005 | Bacteria | 1639 |
| 267 | Ga0307415_100099069 | 3300032126 | Bacteria | 2132 |
| 268 | Ga0307415_100211585 | 3300032126 | Bacteria | 1547 |
| 269 | Ga0307415_100285196 | 3300032126 | Bacteria | 1360 |
| 270 | Ga0307415_100442696 | 3300032126 | Bacteria | 1121 |
| 271 | Ga0307415_100553120 | 3300032126 | Bacteria | 1016 |
| 272 | Ga0307507_10011220 | 3300033179 | Bacteria | 11365 |
| 273 | Ga0373926_0003247 | 3300035083 | Bacteria | 5224 |
| 274 | Ga0373926_0003471 | 3300035083 | Bacteria | 5091 |
| 275 | Ga0373944_0001489 | 3300035089 | Bacteria | 5920 |
| 276 | Ga0373944_0001715 | 3300035089 | Bacteria | 5546 |
| 277 | Ga0373923_0010331 | 3300035111 | Bacteria | 3394 |
| 278 | Ga0373923_0027654 | 3300035111 | Bacteria | 2263 |
| 279 | Ga0373936_0001869 | 3300035113 | Bacteria | 7766 |
| 280 | Ga0373936_0005507 | 3300035113 | Bacteria | 4776 |
| 281 | Ga0373945_0004046 | 3300035116 | Bacteria | 4639 |
| 282 | Ga0373945_0011963 | 3300035116 | Bacteria | 2875 |
| 283 | Ga0373943_0004349 | 3300035170 | Bacteria | 6427 |
| 284 | Ga0373943_0005188 | 3300035170 | Bacteria | 5863 |
| 285 | Ga0373946_0000042 | 3300035171 | Bacteria | 32829 |
| 286 | Ga0373946_0000575 | 3300035171 | Bacteria | 12112 |
| 287 | Ga0373955_0049025 | 3300035172 | Bacteria | 2292 |
| 288 | Ga0373955_0106106 | 3300035172 | Bacteria | 1619 |
| 289 | Ga0373924_0028123 | 3300035410 | Bacteria | 2239 |
| 290 | Ga0373935_0001080 | 3300035692 | Bacteria | 14884 |
| 291 | Ga0373935_0026219 | 3300035692 | Bacteria | 3595 |
| 292 | Ga0373927_0003836 | 3300035695 | Bacteria | 10678 |
| 293 | Ga0373927_0010216 | 3300035695 | Bacteria | 6270 |
| 294 | Ga0373947_0001186 | 3300035725 | Bacteria | 16041 |
| 295 | Ga0373947_0194236 | 3300035725 | Bacteria | 1325 |
| 296 | Ga0373937_0245754 | 3300036401 | Bacteria | 1686 |
| 297 | Ga0373937_0705843 | 3300036401 | Bacteria | 955 |
| 298 | Ga0373925_0012878 | 3300037068 | Bacteria | 6058 |
| 299 | Ga0373925_0069162 | 3300037068 | Bacteria | 2666 |
| 300 | Ga0395899_0087104 | 3300037312 | Bacteria | 2267 |
| 301 | Ga0395900_0074446 | 3300037418 | Bacteria | 3491 |
| 302 | Ga0395900_0119581 | 3300037418 | Bacteria | 2704 |
| 303 | Ga0395898_0168569 | 3300037466 | Bacteria | 2093 |
| 304 | Ga0395898_0769268 | 3300037466 | Bacteria | 904 |
| 305 | Ga0436364_0861475 | 3300037853 | Bacteria | 1250 |
| 306 | Ga0436364_1025760 | 3300037853 | Bacteria | 46353 |
| 307 | Ga0395901_0056160 | 3300038443 | Bacteria | 4096 |
| 308 | Ga0395901_0110634 | 3300038443 | Bacteria | 2884 |
| 309 | Ga0395901_0583896 | 3300038443 | Bacteria | 1129 |
| 310 | Ga0436365_0327584 | 3300039437 | Bacteria | 17350 |
| 311 | Ga0436365_0933082 | 3300039437 | Bacteria | 737 |
| 312 | Ga0436362_0068107 | 3300039453 | Bacteria | 1776 |
| 313 | Ga0466969_0000554 | 3300044656 | Bacteria | 20536 |
| 314 | Ga0466969_0015397 | 3300044656 | Bacteria | 4009 |
| 315 | Ga0466969_0019537 | 3300044656 | Bacteria | 3520 |
| 316 | Ga0466969_0055878 | 3300044656 | Bacteria | 1929 |
| 317 | Ga0466969_0180769 | 3300044656 | Bacteria | 965 |
| 318 | Ga0466965_0017743 | 3300044683 | Bacteria | 3404 |
| 319 | Ga0466965_0082631 | 3300044683 | Bacteria | 1625 |
| 320 | Ga0466966_0012056 | 3300044684 | Bacteria | 5728 |
| 321 | Ga0466966_0020874 | 3300044684 | Bacteria | 4306 |
| 322 | Ga0466966_0193614 | 3300044684 | Bacteria | 1231 |
| 323 | Ga0466966_0295896 | 3300044684 | Bacteria | 973 |
| 324 | Ga0466961_0009301 | 3300044693 | Bacteria | 6256 |
| 325 | Ga0466961_0157929 | 3300044693 | Bacteria | 1414 |
| 326 | Ga0466961_0336565 | 3300044693 | Bacteria | 919 |
| 327 | Ga0466963_0008564 | 3300044694 | Bacteria | 6139 |
| 328 | Ga0466963_0012536 | 3300044694 | Bacteria | 5192 |
| 329 | Ga0466963_0015382 | 3300044694 | Bacteria | 4736 |
| 330 | Ga0466963_0038565 | 3300044694 | Bacteria | 3125 |
| 331 | Ga0466963_0062782 | 3300044694 | Bacteria | 2485 |
| 332 | Ga0466963_0139724 | 3300044694 | Bacteria | 1677 |
| 333 | Ga0466963_0141357 | 3300044694 | Bacteria | 1668 |
| 334 | Ga0466964_0359420 | 3300044706 | Bacteria | 750 |
| 335 | Ga0466971_0158743 | 3300044719 | Bacteria | 1058 |
| 336 | Ga0466970_0019622 | 3300044765 | Bacteria | 3506 |
| 337 | Ga0466970_0044326 | 3300044765 | Bacteria | 2368 |
| 338 | Ga0466970_0326065 | 3300044765 | Bacteria | 869 |
| 339 | Ga0466970_0643493 | 3300044765 | Bacteria | 616 |
| 340 | Ga0466957_0028287 | 3300044842 | Bacteria | 3337 |
| 341 | Ga0466957_0049792 | 3300044842 | Unclassified | 2548 |
| 342 | Ga0466957_0075535 | 3300044842 | Bacteria | 2091 |
| 343 | Ga0466960_0146762 | 3300044901 | Bacteria | 1257 |
| 344 | Ga0466960_0150196 | 3300044901 | Bacteria | 1244 |
| 345 | Ga0466959_0152767 | 3300045049 | Bacteria | 1626 |
| 346 | Ga0466959_0250298 | 3300045049 | Bacteria | 1222 |
| 347 | Ga0466959_0298550 | 3300045049 | Bacteria | 1103 |
| 348 | Ga0466959_0472641 | 3300045049 | Bacteria | 849 |
| 349 | Ga0466958_0013798 | 3300045836 | Bacteria | 4606 |
| 350 | Ga0466958_0088615 | 3300045836 | Bacteria | 1912 |
| 351 | Ga0466958_0097265 | 3300045836 | Bacteria | 1827 |
| 352 | Ga0466958_0189382 | 3300045836 | Bacteria | 1307 |
| 353 | Ga0466958_0351855 | 3300045836 | Bacteria | 948 |
| 354 | Ga0466958_0699421 | 3300045836 | Bacteria | 660 |
| 355 | Ga0466967_0047896 | 3300045976 | Bacteria | 3729 |
| 356 | Ga0466967_0109999 | 3300045976 | Bacteria | 2530 |
| 357 | Ga0466967_0137775 | 3300045976 | Bacteria | 2271 |
| 358 | Ga0466967_0188082 | 3300045976 | Bacteria | 1950 |
| 359 | Ga0466967_0556818 | 3300045976 | Bacteria | 1129 |
| 360 | Ga0466967_1590455 | 3300045976 | Bacteria | 651 |
| 361 | Ga0495603_0105267 | 3300046455 | Bacteria | 1646 |
| 362 | Ga0495603_0257973 | 3300046455 | Bacteria | 1003 |
| 363 | Ga0495629_0001221 | 3300046459 | Bacteria | 20197 |
| 364 | Ga0495629_0188919 | 3300046459 | Bacteria | 1426 |
| 365 | Ga0495629_0305964 | 3300046459 | Bacteria | 1088 |
| 366 | Ga0495638_0040336 | 3300046460 | Bacteria | 2959 |
| 367 | Ga0495641_0009489 | 3300046461 | Bacteria | 5776 |
| 368 | Ga0495641_0014000 | 3300046461 | Bacteria | 4366 |
| 369 | Ga0495651_0221150 | 3300046462 | Bacteria | 1310 |
| 370 | Ga0495651_0562169 | 3300046462 | Bacteria | 723 |
| 371 | Ga0495653_0019372 | 3300046463 | Bacteria | 5519 |
| 372 | Ga0495653_0025616 | 3300046463 | Bacteria | 4736 |
| 373 | Ga0495582_0006701 | 3300046473 | Bacteria | 6399 |
| 374 | Ga0495582_0019118 | 3300046473 | Bacteria | 3749 |
| 375 | Ga0495639_0033051 | 3300046475 | Bacteria | 2309 |
| 376 | Ga0495662_0010934 | 3300046476 | Bacteria | 4439 |
| 377 | Ga0495662_0118063 | 3300046476 | Bacteria | 1301 |
| 378 | Ga0495664_0006698 | 3300046477 | Bacteria | 6371 |
| 379 | Ga0495664_0058322 | 3300046477 | Bacteria | 2296 |
| 380 | Ga0495583_0221059 | 3300046506 | Bacteria | 765 |
| 381 | Ga0495606_0037138 | 3300046507 | Bacteria | 3310 |
| 382 | Ga0495608_0036336 | 3300046511 | Bacteria | 3317 |
| 383 | Ga0495608_0143016 | 3300046511 | Bacteria | 1526 |
| 384 | Ga0495618_0010834 | 3300046514 | Bacteria | 5521 |
| 385 | Ga0495618_0084824 | 3300046514 | Bacteria | 2024 |
| 386 | Ga0495620_0149522 | 3300046515 | Bacteria | 911 |
| 387 | Ga0495628_0503793 | 3300046516 | Bacteria | 874 |
| 388 | Ga0495630_0006044 | 3300046517 | Bacteria | 8574 |
| 389 | Ga0495630_0100745 | 3300046517 | Bacteria | 2185 |
| 390 | Ga0495648_0327024 | 3300046524 | Bacteria | 708 |
| 391 | Ga0495663_0298425 | 3300046525 | Bacteria | 580 |
| 392 | Ga0495652_0074859 | 3300046529 | Bacteria | 2815 |
| 393 | Ga0495652_0145363 | 3300046529 | Bacteria | 1859 |
| 394 | Ga0495665_0035475 | 3300046531 | Bacteria | 2664 |
| 395 | Ga0495665_0052675 | 3300046531 | Bacteria | 2154 |
| 396 | Ga0495640_0015045 | 3300046533 | Bacteria | 5830 |
| 397 | Ga0495640_0054709 | 3300046533 | Bacteria | 2732 |
| 398 | Ga0495586_0347136 | 3300046535 | Bacteria | 852 |
| 399 | Ga0495645_0204505 | 3300046543 | Bacteria | 1337 |
| 400 | Ga0495667_0001662 | 3300046559 | Bacteria | 14750 |
| 401 | Ga0495667_0006224 | 3300046559 | Bacteria | 8088 |
| 402 | Ga0495668_0023812 | 3300046616 | Bacteria | 3488 |
| 403 | Ga0495634_0040656 | 3300046642 | Bacteria | 3160 |
| 404 | Ga0495634_0046647 | 3300046642 | Bacteria | 2923 |
| 405 | Ga0495625_0044224 | 3300046660 | Bacteria | 3225 |
| 406 | Ga0495625_0053277 | 3300046660 | Bacteria | 2894 |
| 407 | Ga0495635_0001316 | 3300046663 | Bacteria | 16535 |
| 408 | Ga0495635_0006919 | 3300046663 | Bacteria | 7921 |
| 409 | Ga0495588_0053571 | 3300046674 | Bacteria | 2080 |
| 410 | Ga0495657_0007892 | 3300046675 | Bacteria | 8167 |
| 411 | Ga0495657_0041497 | 3300046675 | Bacteria | 3148 |
| 412 | Ga0495599_0040085 | 3300046678 | Bacteria | 2942 |
| 413 | Ga0495599_0209307 | 3300046678 | Bacteria | 1196 |
| 414 | Ga0495646_0453643 | 3300046680 | Bacteria | 662 |
| 415 | Ga0495624_0001128 | 3300046690 | Bacteria | 21123 |
| 416 | Ga0495624_0007519 | 3300046690 | Bacteria | 7644 |
| 417 | Ga0495671_0003734 | 3300046692 | Bacteria | 9263 |
| 418 | Ga0495600_0030565 | 3300046809 | Bacteria | 3489 |
| 419 | Ga0495600_0157577 | 3300046809 | Bacteria | 1468 |
| 420 | Ga0495581_0018592 | 3300047315 | Bacteria | 4036 |
| 421 | Ga0495581_0047696 | 3300047315 | Bacteria | 2475 |
| 422 | Ga0495636_0173090 | 3300047318 | Bacteria | 977 |
| 423 | Ga0495674_0006084 | 3300047319 | Bacteria | 11586 |
| 424 | Ga0495674_0017109 | 3300047319 | Bacteria | 6753 |
| 425 | Ga0495676_0002527 | 3300047321 | Bacteria | 16280 |
| 426 | Ga0495676_0006548 | 3300047321 | Bacteria | 10732 |
| 427 | Ga0495676_0021662 | 3300047321 | Bacteria | 5607 |
| 428 | Ga0495676_0153041 | 3300047321 | Bacteria | 1639 |
| 429 | Ga0495680_0095280 | 3300047322 | Bacteria | 2225 |
| 430 | Ga0495680_0109069 | 3300047322 | Bacteria | 2053 |
| 431 | Ga0495687_014300 | 3300047443 | Bacteria | 4091 |
| 432 | Ga0495681_0004493 | 3300047470 | Bacteria | 9521 |
| 433 | Ga0495684_0024834 | 3300047471 | Bacteria | 4609 |
| 434 | Ga0495684_0050902 | 3300047471 | Bacteria | 3161 |
| 435 | Ga0495686_0074433 | 3300047472 | Bacteria | 2084 |
| 436 | Ga0495686_0106455 | 3300047472 | Bacteria | 1686 |
| 437 | Ga0495593_0031800 | 3300047673 | Bacteria | 2880 |
| 438 | Ga0495614_0001620 | 3300048089 | Bacteria | 9807 |
| 439 | Ga0496100_0000479 | 3300048903 | Bacteria | 19190 |
| 440 | Ga0496101_0000401 | 3300048904 | Bacteria | 28366 |
| 441 | Ga0496101_0098336 | 3300048904 | Bacteria | 2186 |
| 442 | Ga0496101_0175318 | 3300048904 | Bacteria | 1649 |
| 443 | Ga0496101_0282930 | 3300048904 | Bacteria | 1296 |
| 444 | Ga0496102_0000557 | 3300048905 | Bacteria | 39916 |
| 445 | Ga0496102_0334658 | 3300048905 | Bacteria | 1426 |
| 446 | Ga0496103_0000434 | 3300048906 | Bacteria | 36328 |
| 447 | Ga0496104_0040702 | 3300048907 | Bacteria | 4357 |
| 448 | Ga0496107_0043780 | 3300048910 | Bacteria | 3217 |
| 449 | Ga0496108_0098842 | 3300048911 | Bacteria | 2487 |
| 450 | Ga0496108_0128669 | 3300048911 | Bacteria | 2176 |
| 451 | Ga0496109_0448158 | 3300048912 | Bacteria | 1219 |
| 452 | Ga0496109_0822914 | 3300048912 | Bacteria | 866 |
| 453 | Ga0496110_0126931 | 3300048913 | Bacteria | 2302 |
| 454 | Ga0496110_0235544 | 3300048913 | Bacteria | 1666 |
| 455 | Ga0496110_0924269 | 3300048913 | Bacteria | 779 |
| 456 | Ga0496111_0477931 | 3300048914 | Bacteria | 918 |
| 457 | Ga0496112_0511387 | 3300048915 | Bacteria | 1136 |
| 458 | Ga0496114_0061213 | 3300048917 | Bacteria | 3148 |
| 459 | Ga0496114_0134739 | 3300048917 | Bacteria | 2135 |
| 460 | Ga0496114_0577177 | 3300048917 | Bacteria | 992 |
| 461 | Ga0496114_0603422 | 3300048917 | Bacteria | 968 |
| 462 | Ga0496117_0208051 | 3300048920 | Bacteria | 1099 |
| 463 | Ga0496118_0004525 | 3300048921 | Bacteria | 16428 |
| 464 | Ga0496119_0000215 | 3300048922 | Bacteria | 82231 |
| 465 | Ga0496119_0043024 | 3300048922 | Bacteria | 2858 |
| 466 | Ga0496120_0000264 | 3300048923 | Bacteria | 87474 |
| 467 | Ga0496120_0011220 | 3300048923 | Bacteria | 6179 |
| 468 | Ga0496120_0205285 | 3300048923 | Bacteria | 951 |
| 469 | Ga0496121_0039957 | 3300048924 | Bacteria | 4124 |
| 470 | Ga0496122_0013255 | 3300048925 | Bacteria | 8083 |
| 471 | Ga0496123_0001649 | 3300048926 | Bacteria | 29965 |
| 472 | Ga0496124_0418713 | 3300048927 | Bacteria | 924 |
| 473 | Ga0496126_0104917 | 3300048929 | Bacteria | 2469 |
| 474 | Ga0501031_0147995 | 3300049568 | Bacteria | 1534 |
| 475 | Ga0501032_0059003 | 3300049569 | Bacteria | 2575 |
| 476 | Ga0501032_0068889 | 3300049569 | Bacteria | 2361 |
| 477 | Ga0501034_0141695 | 3300049571 | Bacteria | 2383 |
| 478 | Ga0501036_0031995 | 3300049572 | Bacteria | 4444 |
| 479 | Ga0501036_0075937 | 3300049572 | Bacteria | 2842 |
| 480 | Ga0501036_0119708 | 3300049572 | Bacteria | 2223 |
| 481 | Ga0501037_0077633 | 3300049573 | Bacteria | 2410 |
| 482 | Ga0501037_0185668 | 3300049573 | Bacteria | 1474 |
| 483 | Ga0501038_0090351 | 3300049574 | Bacteria | 2567 |
| 484 | Ga0501038_0236878 | 3300049574 | Bacteria | 1450 |
| 485 | Ga0501039_0026838 | 3300049575 | Bacteria | 4426 |
| 486 | Ga0501040_0013175 | 3300049576 | Bacteria | 5438 |
| 487 | Ga0501041_0039656 | 3300049577 | Bacteria | 2858 |
| 488 | Ga0501042_0007133 | 3300049578 | Bacteria | 7309 |
| 489 | Ga0501043_0023462 | 3300049579 | Bacteria | 4838 |
| 490 | Ga0501043_0131725 | 3300049579 | Bacteria | 1959 |
| 491 | Ga0501043_0281710 | 3300049579 | Bacteria | 1274 |
| 492 | Ga0501046_0089609 | 3300049580 | Bacteria | 2367 |
| 493 | Ga0501046_0289578 | 3300049580 | Bacteria | 1198 |
| 494 | Ga0501047_0003949 | 3300049581 | Bacteria | 13939 |
| 495 | Ga0501047_0129446 | 3300049581 | Bacteria | 2404 |
| 496 | Ga0501048_0049156 | 3300049582 | Bacteria | 3006 |
| 497 | Ga0501067_0000062 | 3300049583 | Bacteria | 61908 |
| 498 | Ga0501067_0364935 | 3300049583 | Bacteria | 805 |
| 499 | Ga0501068_0000016 | 3300049584 | Bacteria | 62571 |
| 500 | Ga0501069_0001293 | 3300049585 | Bacteria | 12281 |
| 501 | Ga0501069_0052000 | 3300049585 | Bacteria | 2281 |
| 502 | Ga0501069_0140503 | 3300049585 | Bacteria | 1385 |
| 503 | Ga0501069_0176405 | 3300049585 | Bacteria | 1234 |
| 504 | Ga0501070_0231293 | 3300049586 | Bacteria | 1514 |
| 505 | Ga0501070_0253779 | 3300049586 | Bacteria | 1438 |
| 506 | Ga0501070_0272336 | 3300049586 | Bacteria | 1382 |
| 507 | Ga0501071_0012857 | 3300049587 | Bacteria | 5692 |
| 508 | Ga0501071_0311096 | 3300049587 | Bacteria | 1195 |
| 509 | Ga0501071_0324691 | 3300049587 | Bacteria | 1169 |
| 510 | Ga0501072_0003348 | 3300049588 | Bacteria | 12058 |
| 511 | Ga0501072_0625109 | 3300049588 | Bacteria | 848 |
| 512 | Ga0501073_0117360 | 3300049589 | Bacteria | 1844 |
| 513 | Ga0501074_0033898 | 3300049590 | Bacteria | 3702 |
| 514 | Ga0501075_0032114 | 3300049591 | Bacteria | 3899 |
| 515 | Ga0501076_0005562 | 3300049592 | Bacteria | 9079 |
| 516 | Ga0501077_0015745 | 3300049593 | Bacteria | 4762 |
| 517 | Ga0501077_0340251 | 3300049593 | Bacteria | 957 |
| 518 | Ga0501079_0076624 | 3300049741 | Bacteria | 2586 |
| 519 | Ga0501080_0078578 | 3300049742 | Bacteria | 3068 |
| 520 | Ga0501080_0272108 | 3300049742 | Bacteria | 1541 |
| 521 | Ga0501080_1111979 | 3300049742 | Bacteria | 682 |
| 522 | Ga0501081_0005277 | 3300049743 | Bacteria | 8330 |
| 523 | Ga0501083_0054986 | 3300049744 | Bacteria | 2670 |
| 524 | Ga0501083_0259953 | 3300049744 | Bacteria | 1130 |
| 525 | Ga0501035_0065337 | 3300049822 | Bacteria | 3231 |
| 526 | Ga0501035_0097254 | 3300049822 | Bacteria | 2586 |
| 527 | Ga0501035_0114922 | 3300049822 | Bacteria | 2356 |
| 528 | Ga0501035_1098636 | 3300049822 | Bacteria | 621 |
| 529 | Ga0501035_1288944 | 3300049822 | Bacteria | 564 |
| 530 | Ga0501044_0051074 | 3300049823 | Bacteria | 4264 |
| 531 | Ga0501044_0070812 | 3300049823 | Bacteria | 3546 |
| 532 | Ga0501044_0127177 | 3300049823 | Bacteria | 2545 |
| 533 | Ga0501045_0629570 | 3300049824 | Bacteria | 793 |
| 534 | nmdc:mga03683_143183_c1 | 3300050489 | Bacteria | 1075 |
| 535 | nmdc:mga0qj67_6664_c1 | 3300050509 | Bacteria | 8482 |
| 536 | nmdc:mga0qj67_766199_c1 | 3300050509 | Bacteria | 765 |
| 537 | nmdc:mga06r32_13212_c1 | 3300050510 | Bacteria | 7478 |
| 538 | nmdc:mga08y16_1169989_c1 | 3300050511 | Bacteria | 741 |
| 539 | nmdc:mga08y16_298933_c1 | 3300050511 | Bacteria | 1659 |
| 540 | nmdc:mga0n895_34628_c1 | 3300050512 | Bacteria | 4863 |
| 541 | nmdc:mga08x19_309992_c1 | 3300050514 | Bacteria | 1097 |
| 542 | Ga0495612_0033699 | 3300053078 | Bacteria | 2073 |
| 543 | Ga0495612_0284934 | 3300053078 | Bacteria | 739 |
| 544 | Ga0495595_0444073 | 3300053084 | Bacteria | 659 |
| 545 | Ga0500646_0200547 | 3300053090 | Bacteria | 684 |
| 546 | Ga0500583_0076223 | 3300053092 | Bacteria | 1613 |
| 547 | Ga0500650_0125896 | 3300053098 | Bacteria | 1193 |
| 548 | Ga0500560_049518 | 3300053107 | Bacteria | 1344 |
| 549 | Ga0500652_317883 | 3300053131 | Bacteria | 597 |
| 550 | Ga0500658_0066438 | 3300053134 | Bacteria | 1513 |
| 551 | Ga0500616_0175245 | 3300053153 | Bacteria | 970 |
| 552 | Ga0500634_0034221 | 3300053161 | Bacteria | 2768 |
| 553 | Ga0500609_004997 | 3300053731 | Bacteria | 1815 |
| 554 | Ga0501084_0013456 | 3300054114 | Bacteria | 6772 |
| 555 | Ga0587070_021502 | 3300059491 | Bacteria | 1090 |
| 556 | Ga0587073_0003126 | 3300059492 | Bacteria | 2233 |
| 557 | Ga0587077_017953 | 3300059493 | Bacteria | 1212 |
| 558 | Ga0587080_021416 | 3300059503 | Bacteria | 1063 |
| 559 | Ga0587082_021406 | 3300059504 | Bacteria | 1056 |
| 560 | Ga0587091_041506 | 3300059511 | Bacteria | 909 |
| 561 | Ga0587094_023955 | 3300059513 | Bacteria | 906 |
| 562 | Ga0587101_008211 | 3300059623 | Bacteria | 1255 |
| 563 | Ga0587109_021926 | 3300059624 | Bacteria | 1146 |
| 564 | Ga0587115_016917 | 3300059626 | Bacteria | 980 |
| 565 | Ga0587067_023966 | 3300059640 | Bacteria | 1074 |
| 566 | Ga0587069_029239 | 3300059642 | Bacteria | 880 |
| 567 | Ga0587072_026550 | 3300059643 | Bacteria | 1058 |
| 568 | Ga0587075_088623 | 3300059644 | Bacteria | 601 |
| 569 | Ga0587076_032215 | 3300059645 | Bacteria | 936 |
| 570 | Ga0587079_043964 | 3300059647 | Bacteria | 913 |
| 571 | Ga0587107_017295 | 3300059652 | Bacteria | 963 |
| 572 | Ga0501082_0010220 | 3300060353 | Bacteria | 8080 |
| 573 | Ga0466962_0004800 | 3300061719 | Bacteria | 6506 |
| 574 | Ga0466962_0009699 | 3300061719 | Bacteria | 4619 |
| 575 | Ga0466962_0188366 | 3300061719 | Bacteria | 1006 |
| 576 | Ga0466962_0298176 | 3300061719 | Bacteria | 797 |
| 577 | Ga0530510_0018053 | 3300061734 | Bacteria | 5001 |
| 578 | Ga0530510_0050654 | 3300061734 | Bacteria | 2999 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049744 | Ga0501083_0259953 | Ga0501083_0259953_548_1033 | 149 |
| 2 | 3300009176 | Ga0105242_10391854 | Ga0105242_103918543 | 150 |
| 3 | 3300049585 | Ga0501069_0176405 | Ga0501069_0176405_23_475 | 150 |
| 4 | 3300046525 | Ga0495663_0298425 | Ga0495663_0298425_104_565 | 152 |
| 5 | 3300009148 | Ga0105243_10336043 | Ga0105243_103360432 | 159 |
| 6 | 3300050509 | nmdc:mga0qj67_766199_c1 | nmdc:mga0qj67_766199_c1_217_753 | 162 |
| 7 | 3300014326 | Ga0157380_10812587 | Ga0157380_108125871 | 164 |
| 8 | 3300049822 | Ga0501035_1288944 | Ga0501035_1288944_43_546 | 165 |
| 9 | 3300053153 | Ga0500616_0175245 | Ga0500616_0175245_215_802 | 169 |
| 10 | 3300046616 | Ga0495668_0023812 | Ga0495668_0023812_1053_1604 | 171 |
| 11 | 3300047472 | Ga0495686_0074433 | Ga0495686_0074433_923_1471 | 171 |
| 12 | 3300044694 | Ga0466963_0008564 | Ga0466963_0008564_3706_4275 | 172 |
| 13 | 3300044842 | Ga0466957_0049792 | Ga0466957_0049792_331_900 | 172 |
| 14 | 3300049573 | Ga0501037_0077633 | Ga0501037_0077633_640_1200 | 172 |
| 15 | 3300049574 | Ga0501038_0236878 | Ga0501038_0236878_871_1431 | 172 |
| 16 | iso_pu_bacteria | 2808606359 | 2808845034 | 173 |
| 17 | iso_pu_bacteria | 2954002825 | 2954009887 | 173 |
| 18 | iso_pu_bacteria | 3006493962 | 3006494255 | 173 |
| 19 | iso_pu_bacteria | 8033684223 | 8033687185 | 173 |
| 20 | 3300005614 | Ga0068856_100772159 | Ga0068856_1007721591 | 175 |
| 21 | 3300014325 | Ga0163163_10995208 | Ga0163163_109952083 | 175 |
| 22 | iso_pu_bacteria | 2747842501 | 2748018204 | 175 |
| 23 | iso_pu_bacteria | 2832004796 | 2832010471 | 175 |
| 24 | iso_pu_bacteria | 2839989709 | 2839990316 | 175 |
| 25 | iso_pu_bacteria | 2866065130 | 2866071195 | 175 |
| 26 | iso_pu_bacteria | 2928972540 | 2928973099 | 175 |
| 27 | iso_pu_bacteria | 2977240413 | 2977242877 | 175 |
| 28 | 3300028379 | Ga0268266_10039924 | Ga0268266_100399245 | 176 |
| 29 | iso_pu_bacteria | 2582580736 | 2583149250 | 176 |
| 30 | iso_pu_bacteria | 2675903060 | 2676489712 | 176 |
| 31 | 3300025302 | Ga0207426_1001457 | Ga0207426_10014579 | 177 |
| 32 | 3300028786 | Ga0307517_10002470 | Ga0307517_100024702 | 177 |
| 33 | 3300028794 | Ga0307515_10001437 | Ga0307515_100014373 | 177 |
| 34 | 3300028794 | Ga0307515_10337868 | Ga0307515_103378681 | 177 |
| 35 | 3300030521 | Ga0307511_10097416 | Ga0307511_100974162 | 177 |
| 36 | 3300030522 | Ga0307512_10031781 | Ga0307512_100317816 | 177 |
| 37 | 3300031616 | Ga0307508_10083830 | Ga0307508_100838303 | 177 |
| 38 | 3300031649 | Ga0307514_10124636 | Ga0307514_101246363 | 177 |
| 39 | 3300031649 | Ga0307514_10198102 | Ga0307514_101981021 | 177 |
| 40 | 3300031730 | Ga0307516_10033191 | Ga0307516_100331916 | 177 |
| 41 | 3300031838 | Ga0307518_10055967 | Ga0307518_100559676 | 177 |
| 42 | 3300033179 | Ga0307507_10011220 | Ga0307507_100112204 | 177 |
| 43 | 3300046455 | Ga0495603_0257973 | Ga0495603_0257973_135_677 | 177 |
| 44 | 3300046459 | Ga0495629_0001221 | Ga0495629_0001221_16686_17234 | 177 |
| 45 | 3300046460 | Ga0495638_0040336 | Ga0495638_0040336_1061_1609 | 177 |
| 46 | 3300046473 | Ga0495582_0019118 | Ga0495582_0019118_1592_2134 | 177 |
| 47 | 3300046506 | Ga0495583_0221059 | Ga0495583_0221059_73_621 | 177 |
| 48 | 3300046660 | Ga0495625_0044224 | Ga0495625_0044224_2479_3018 | 177 |
| 49 | 3300046660 | Ga0495625_0053277 | Ga0495625_0053277_241_789 | 177 |
| 50 | 3300046674 | Ga0495588_0053571 | Ga0495588_0053571_1420_1968 | 177 |
| 51 | 3300046680 | Ga0495646_0453643 | Ga0495646_0453643_48_596 | 177 |
| 52 | 3300046692 | Ga0495671_0003734 | Ga0495671_0003734_1344_1892 | 177 |
| 53 | 3300047318 | Ga0495636_0173090 | Ga0495636_0173090_258_806 | 177 |
| 54 | 3300047321 | Ga0495676_0153041 | Ga0495676_0153041_36_584 | 177 |
| 55 | 3300047443 | Ga0495687_014300 | Ga0495687_014300_2591_3139 | 177 |
| 56 | 3300047470 | Ga0495681_0004493 | Ga0495681_0004493_2432_2980 | 177 |
| 57 | 3300047472 | Ga0495686_0106455 | Ga0495686_0106455_848_1396 | 177 |
| 58 | 3300048089 | Ga0495614_0001620 | Ga0495614_0001620_7700_8248 | 177 |
| 59 | 3300049568 | Ga0501031_0147995 | Ga0501031_0147995_383_931 | 177 |
| 60 | 3300049571 | Ga0501034_0141695 | Ga0501034_0141695_944_1492 | 177 |
| 61 | 3300049572 | Ga0501036_0075937 | Ga0501036_0075937_731_1279 | 177 |
| 62 | 3300049573 | Ga0501037_0185668 | Ga0501037_0185668_44_592 | 177 |
| 63 | 3300049574 | Ga0501038_0090351 | Ga0501038_0090351_645_1193 | 177 |
| 64 | 3300049579 | Ga0501043_0023462 | Ga0501043_0023462_1513_2061 | 177 |
| 65 | 3300049580 | Ga0501046_0289578 | Ga0501046_0289578_189_737 | 177 |
| 66 | 3300049581 | Ga0501047_0003949 | Ga0501047_0003949_3941_4489 | 177 |
| 67 | 3300049586 | Ga0501070_0272336 | Ga0501070_0272336_647_1195 | 177 |
| 68 | 3300049822 | Ga0501035_0065337 | Ga0501035_0065337_542_1090 | 177 |
| 69 | 3300049823 | Ga0501044_0051074 | Ga0501044_0051074_1447_1995 | 177 |
| 70 | 3300049824 | Ga0501045_0629570 | Ga0501045_0629570_169_717 | 177 |
| 71 | 3300053090 | Ga0500646_0200547 | Ga0500646_0200547_69_617 | 177 |
| 72 | 3300053092 | Ga0500583_0076223 | Ga0500583_0076223_889_1437 | 177 |
| 73 | 3300053098 | Ga0500650_0125896 | Ga0500650_0125896_270_818 | 177 |
| 74 | 3300053107 | Ga0500560_049518 | Ga0500560_049518_548_1096 | 177 |
| 75 | 3300053131 | Ga0500652_317883 | Ga0500652_317883_36_584 | 177 |
| 76 | 3300053161 | Ga0500634_0034221 | Ga0500634_0034221_2138_2689 | 177 |
| 77 | 3300005434 | Ga0070709_10056492 | Ga0070709_100564924 | 178 |
| 78 | 3300005457 | Ga0070662_100031723 | Ga0070662_1000317232 | 178 |
| 79 | 3300005564 | Ga0070664_100017823 | Ga0070664_1000178234 | 178 |
| 80 | 3300020070 | Ga0206356_11126787 | Ga0206356_111267871 | 178 |
| 81 | 3300022467 | Ga0224712_10424345 | Ga0224712_104243451 | 178 |
| 82 | 3300023309 | Ga0256744_151210 | Ga0256744_1512101 | 178 |
| 83 | 3300023436 | Ga0256743_102384 | Ga0256743_1023842 | 178 |
| 84 | 3300026075 | Ga0207708_10021807 | Ga0207708_100218071 | 178 |
| 85 | 3300026118 | Ga0207675_100068423 | Ga0207675_1000684233 | 178 |
| 86 | 3300029277 | Ga0311001_1064471 | Ga0311001_10644711 | 178 |
| 87 | 3300031548 | Ga0307408_100254992 | Ga0307408_1002549922 | 178 |
| 88 | 3300031824 | Ga0307413_10104148 | Ga0307413_101041481 | 178 |
| 89 | 3300031903 | Ga0307407_10361358 | Ga0307407_103613581 | 178 |
| 90 | 3300031995 | Ga0307409_100041481 | Ga0307409_1000414814 | 178 |
| 91 | 3300032002 | Ga0307416_100637936 | Ga0307416_1006379362 | 178 |
| 92 | 3300032004 | Ga0307414_10023024 | Ga0307414_100230241 | 178 |
| 93 | 3300032126 | Ga0307415_100285196 | Ga0307415_1002851962 | 178 |
| 94 | 3300050511 | nmdc:mga08y16_1169989_c1 | nmdc:mga08y16_1169989_c1_152_688 | 178 |
| 95 | 3300003373 | JGI25407J50210_10025243 | JGI25407J50210_100252432 | 179 |
| 96 | 3300003373 | JGI25407J50210_10026802 | JGI25407J50210_100268022 | 179 |
| 97 | 3300003578 | Ga0006562J51391_1027212 | Ga0006562J51391_10272123 | 179 |
| 98 | 3300005329 | Ga0070683_100075218 | Ga0070683_1000752182 | 179 |
| 99 | 3300005334 | Ga0068869_100071045 | Ga0068869_1000710452 | 179 |
| 100 | 3300005336 | Ga0070680_100100332 | Ga0070680_1001003322 | 179 |
| 101 | 3300005337 | Ga0070682_100150451 | Ga0070682_1001504512 | 179 |
| 102 | 3300005338 | Ga0068868_100185162 | Ga0068868_1001851622 | 179 |
| 103 | 3300005345 | Ga0070692_10051859 | Ga0070692_100518592 | 179 |
| 104 | 3300005355 | Ga0070671_100291495 | Ga0070671_1002914952 | 179 |
| 105 | 3300005406 | Ga0070703_10097025 | Ga0070703_100970251 | 179 |
| 106 | 3300005434 | Ga0070709_10004861 | Ga0070709_100048616 | 179 |
| 107 | 3300005435 | Ga0070714_100003734 | Ga0070714_1000037348 | 179 |
| 108 | 3300005435 | Ga0070714_100045045 | Ga0070714_1000450453 | 179 |
| 109 | 3300005436 | Ga0070713_100116333 | Ga0070713_1001163332 | 179 |
| 110 | 3300005437 | Ga0070710_10067015 | Ga0070710_100670152 | 179 |
| 111 | 3300005438 | Ga0070701_10020718 | Ga0070701_100207182 | 179 |
| 112 | 3300005438 | Ga0070701_10067689 | Ga0070701_100676892 | 179 |
| 113 | 3300005439 | Ga0070711_100001344 | Ga0070711_10000134417 | 179 |
| 114 | 3300005444 | Ga0070694_100329355 | Ga0070694_1003293551 | 179 |
| 115 | 3300005444 | Ga0070694_101238766 | Ga0070694_1012387661 | 179 |
| 116 | 3300005458 | Ga0070681_10441018 | Ga0070681_104410182 | 179 |
| 117 | 3300005459 | Ga0068867_100893430 | Ga0068867_1008934301 | 179 |
| 118 | 3300005466 | Ga0070685_10092536 | Ga0070685_100925361 | 179 |
| 119 | 3300005535 | Ga0070684_100032346 | Ga0070684_1000323464 | 179 |
| 120 | 3300005545 | Ga0070695_100485194 | Ga0070695_1004851942 | 179 |
| 121 | 3300005546 | Ga0070696_100189369 | Ga0070696_1001893691 | 179 |
| 122 | 3300005577 | Ga0068857_100199910 | Ga0068857_1001999102 | 179 |
| 123 | 3300005578 | Ga0068854_100181392 | Ga0068854_1001813922 | 179 |
| 124 | 3300005614 | Ga0068856_100031483 | Ga0068856_1000314833 | 179 |
| 125 | 3300005614 | Ga0068856_100404548 | Ga0068856_1004045482 | 179 |
| 126 | 3300005616 | Ga0068852_100106717 | Ga0068852_1001067172 | 179 |
| 127 | 3300005617 | Ga0068859_100075074 | Ga0068859_1000750742 | 179 |
| 128 | 3300005617 | Ga0068859_101889324 | Ga0068859_1018893241 | 179 |
| 129 | 3300005719 | Ga0068861_100018401 | Ga0068861_1000184013 | 179 |
| 130 | 3300005843 | Ga0068860_101172375 | Ga0068860_1011723751 | 179 |
| 131 | 3300005844 | Ga0068862_100271597 | Ga0068862_1002715972 | 179 |
| 132 | 3300005981 | Ga0081538_10000113 | Ga0081538_1000011333 | 179 |
| 133 | 3300005981 | Ga0081538_10000358 | Ga0081538_1000035830 | 179 |
| 134 | 3300005985 | Ga0081539_10007485 | Ga0081539_1000748511 | 179 |
| 135 | 3300006028 | Ga0070717_10000010 | Ga0070717_10000010239 | 179 |
| 136 | 3300006173 | Ga0070716_100003762 | Ga0070716_1000037628 | 179 |
| 137 | 3300006175 | Ga0070712_100041266 | Ga0070712_1000412663 | 179 |
| 138 | 3300006175 | Ga0070712_100150672 | Ga0070712_1001506724 | 179 |
| 139 | 3300006844 | Ga0075428_100034195 | Ga0075428_1000341952 | 179 |
| 140 | 3300006844 | Ga0075428_100067932 | Ga0075428_1000679322 | 179 |
| 141 | 3300006846 | Ga0075430_100002361 | Ga0075430_10000236117 | 179 |
| 142 | 3300006846 | Ga0075430_100065028 | Ga0075430_1000650284 | 179 |
| 143 | 3300006847 | Ga0075431_100057829 | Ga0075431_1000578293 | 179 |
| 144 | 3300006871 | Ga0075434_100028417 | Ga0075434_1000284173 | 179 |
| 145 | 3300006914 | Ga0075436_100145047 | Ga0075436_1001450472 | 179 |
| 146 | 3300006931 | Ga0097620_100075074 | Ga0097620_1000750742 | 179 |
| 147 | 3300006931 | Ga0097620_101888639 | Ga0097620_1018886391 | 179 |
| 148 | 3300009098 | Ga0105245_10109368 | Ga0105245_101093682 | 179 |
| 149 | 3300009101 | Ga0105247_10272944 | Ga0105247_102729442 | 179 |
| 150 | 3300009148 | Ga0105243_10135150 | Ga0105243_101351503 | 179 |
| 151 | 3300009148 | Ga0105243_11303627 | Ga0105243_113036271 | 179 |
| 152 | 3300009174 | Ga0105241_10140018 | Ga0105241_101400182 | 179 |
| 153 | 3300009177 | Ga0105248_10495602 | Ga0105248_104956021 | 179 |
| 154 | 3300009545 | Ga0105237_10318260 | Ga0105237_103182602 | 179 |
| 155 | 3300009545 | Ga0105237_10443481 | Ga0105237_104434812 | 179 |
| 156 | 3300009551 | Ga0105238_10103489 | Ga0105238_101034894 | 179 |
| 157 | 3300009553 | Ga0105249_10418848 | Ga0105249_104188482 | 179 |
| 158 | 3300009553 | Ga0105249_10881733 | Ga0105249_108817332 | 179 |
| 159 | 3300010375 | Ga0105239_10406304 | Ga0105239_104063043 | 179 |
| 160 | 3300013104 | Ga0157370_10017021 | Ga0157370_100170213 | 179 |
| 161 | 3300013105 | Ga0157369_10023921 | Ga0157369_100239212 | 179 |
| 162 | 3300013105 | Ga0157369_10735323 | Ga0157369_107353232 | 179 |
| 163 | 3300013296 | Ga0157374_10333883 | Ga0157374_103338832 | 179 |
| 164 | 3300013306 | Ga0163162_10887496 | Ga0163162_108874962 | 179 |
| 165 | 3300013308 | Ga0157375_10452768 | Ga0157375_104527682 | 179 |
| 166 | 3300013308 | Ga0157375_10577400 | Ga0157375_105774002 | 179 |
| 167 | 3300013308 | Ga0157375_10872147 | Ga0157375_108721472 | 179 |
| 168 | 3300014326 | Ga0157380_10232400 | Ga0157380_102324002 | 179 |
| 169 | 3300014968 | Ga0157379_10213370 | Ga0157379_102133702 | 179 |
| 170 | 3300014968 | Ga0157379_11500084 | Ga0157379_115000841 | 179 |
| 171 | 3300014969 | Ga0157376_10030809 | Ga0157376_100308094 | 179 |
| 172 | 3300017792 | Ga0163161_10658713 | Ga0163161_106587132 | 179 |
| 173 | 3300020069 | Ga0197907_10086055 | Ga0197907_100860553 | 179 |
| 174 | 3300020069 | Ga0197907_10178928 | Ga0197907_101789282 | 179 |
| 175 | 3300020076 | Ga0206355_1614130 | Ga0206355_16141301 | 179 |
| 176 | 3300020078 | Ga0206352_10882461 | Ga0206352_108824612 | 179 |
| 177 | 3300020080 | Ga0206350_10260939 | Ga0206350_102609392 | 179 |
| 178 | 3300020080 | Ga0206350_10999973 | Ga0206350_109999732 | 179 |
| 179 | 3300020080 | Ga0206350_11122083 | Ga0206350_111220832 | 179 |
| 180 | 3300020080 | Ga0206350_11303434 | Ga0206350_113034342 | 179 |
| 181 | 3300020080 | Ga0206350_11565754 | Ga0206350_115657541 | 179 |
| 182 | 3300020081 | Ga0206354_10740676 | Ga0206354_107406761 | 179 |
| 183 | 3300020082 | Ga0206353_10752160 | Ga0206353_107521602 | 179 |
| 184 | 3300021388 | Ga0213875_10001681 | Ga0213875_100016817 | 179 |
| 185 | 3300022467 | Ga0224712_10007328 | Ga0224712_100073283 | 179 |
| 186 | 3300022467 | Ga0224712_10187834 | Ga0224712_101878342 | 179 |
| 187 | 3300025898 | Ga0207692_10044810 | Ga0207692_100448101 | 179 |
| 188 | 3300025899 | Ga0207642_10095462 | Ga0207642_100954622 | 179 |
| 189 | 3300025900 | Ga0207710_10147737 | Ga0207710_101477372 | 179 |
| 190 | 3300025901 | Ga0207688_10480726 | Ga0207688_104807261 | 179 |
| 191 | 3300025903 | Ga0207680_10227495 | Ga0207680_102274952 | 179 |
| 192 | 3300025906 | Ga0207699_10004168 | Ga0207699_100041684 | 179 |
| 193 | 3300025912 | Ga0207707_10087974 | Ga0207707_100879744 | 179 |
| 194 | 3300025914 | Ga0207671_10792909 | Ga0207671_107929091 | 179 |
| 195 | 3300025915 | Ga0207693_10124138 | Ga0207693_101241381 | 179 |
| 196 | 3300025915 | Ga0207693_10139457 | Ga0207693_101394573 | 179 |
| 197 | 3300025916 | Ga0207663_10451676 | Ga0207663_104516762 | 179 |
| 198 | 3300025917 | Ga0207660_10059322 | Ga0207660_100593222 | 179 |
| 199 | 3300025917 | Ga0207660_10687692 | Ga0207660_106876922 | 179 |
| 200 | 3300025918 | Ga0207662_10364602 | Ga0207662_103646021 | 179 |
| 201 | 3300025919 | Ga0207657_10790813 | Ga0207657_107908131 | 179 |
| 202 | 3300025927 | Ga0207687_10236705 | Ga0207687_102367051 | 179 |
| 203 | 3300025927 | Ga0207687_10497667 | Ga0207687_104976672 | 179 |
| 204 | 3300025929 | Ga0207664_10007842 | Ga0207664_100078425 | 179 |
| 205 | 3300025929 | Ga0207664_10063634 | Ga0207664_100636344 | 179 |
| 206 | 3300025931 | Ga0207644_10354776 | Ga0207644_103547762 | 179 |
| 207 | 3300025932 | Ga0207690_10095124 | Ga0207690_100951244 | 179 |
| 208 | 3300025938 | Ga0207704_10100550 | Ga0207704_101005501 | 179 |
| 209 | 3300025939 | Ga0207665_10007521 | Ga0207665_1000752110 | 179 |
| 210 | 3300025942 | Ga0207689_10081438 | Ga0207689_100814383 | 179 |
| 211 | 3300025944 | Ga0207661_10151716 | Ga0207661_101517163 | 179 |
| 212 | 3300025981 | Ga0207640_10041191 | Ga0207640_100411911 | 179 |
| 213 | 3300025981 | Ga0207640_10732354 | Ga0207640_107323542 | 179 |
| 214 | 3300026023 | Ga0207677_10980072 | Ga0207677_109800721 | 179 |
| 215 | 3300026075 | Ga0207708_10003460 | Ga0207708_100034608 | 179 |
| 216 | 3300026075 | Ga0207708_10004679 | Ga0207708_100046798 | 179 |
| 217 | 3300026078 | Ga0207702_10022140 | Ga0207702_100221405 | 179 |
| 218 | 3300026078 | Ga0207702_10071037 | Ga0207702_100710373 | 179 |
| 219 | 3300026089 | Ga0207648_10287513 | Ga0207648_102875131 | 179 |
| 220 | 3300026095 | Ga0207676_10227052 | Ga0207676_102270523 | 179 |
| 221 | 3300026116 | Ga0207674_10151499 | Ga0207674_101514992 | 179 |
| 222 | 3300026142 | Ga0207698_10170666 | Ga0207698_101706662 | 179 |
| 223 | 3300027462 | Ga0210000_1032451 | Ga0210000_10324511 | 179 |
| 224 | 3300027907 | Ga0207428_10185844 | Ga0207428_101858442 | 179 |
| 225 | 3300027907 | Ga0207428_10468242 | Ga0207428_104682421 | 179 |
| 226 | 3300028379 | Ga0268266_11087802 | Ga0268266_110878022 | 179 |
| 227 | 3300028794 | Ga0307515_10192604 | Ga0307515_101926042 | 179 |
| 228 | 3300031731 | Ga0307405_10536379 | Ga0307405_105363792 | 179 |
| 229 | 3300031824 | Ga0307413_10306653 | Ga0307413_103066531 | 179 |
| 230 | 3300031852 | Ga0307410_10033289 | Ga0307410_100332893 | 179 |
| 231 | 3300031901 | Ga0307406_10183033 | Ga0307406_101830331 | 179 |
| 232 | 3300031911 | Ga0307412_10121678 | Ga0307412_101216782 | 179 |
| 233 | 3300032002 | Ga0307416_100024731 | Ga0307416_1000247315 | 179 |
| 234 | 3300032002 | Ga0307416_102217934 | Ga0307416_1022179341 | 179 |
| 235 | 3300032005 | Ga0307411_10170800 | Ga0307411_101708002 | 179 |
| 236 | 3300032126 | Ga0307415_100099069 | Ga0307415_1000990692 | 179 |
| 237 | 3300032126 | Ga0307415_100211585 | Ga0307415_1002115852 | 179 |
| 238 | 3300032126 | Ga0307415_100442696 | Ga0307415_1004426962 | 179 |
| 239 | 3300037312 | Ga0395899_0087104 | Ga0395899_0087104_1069_1629 | 179 |
| 240 | 3300037418 | Ga0395900_0119581 | Ga0395900_0119581_485_1075 | 179 |
| 241 | 3300037466 | Ga0395898_0168569 | Ga0395898_0168569_978_1529 | 179 |
| 242 | 3300037853 | Ga0436364_1025760 | Ga0436364_1025760_24856_25434 | 179 |
| 243 | 3300038443 | Ga0395901_0056160 | Ga0395901_0056160_1158_1748 | 179 |
| 244 | 3300038443 | Ga0395901_0583896 | Ga0395901_0583896_263_808 | 179 |
| 245 | 3300044656 | Ga0466969_0015397 | Ga0466969_0015397_962_1510 | 179 |
| 246 | 3300044683 | Ga0466965_0082631 | Ga0466965_0082631_146_721 | 179 |
| 247 | 3300044684 | Ga0466966_0193614 | Ga0466966_0193614_306_854 | 179 |
| 248 | 3300044694 | Ga0466963_0015382 | Ga0466963_0015382_125_700 | 179 |
| 249 | 3300044694 | Ga0466963_0139724 | Ga0466963_0139724_166_738 | 179 |
| 250 | 3300044765 | Ga0466970_0326065 | Ga0466970_0326065_143_709 | 179 |
| 251 | 3300044842 | Ga0466957_0028287 | Ga0466957_0028287_1510_2085 | 179 |
| 252 | 3300045049 | Ga0466959_0152767 | Ga0466959_0152767_92_640 | 179 |
| 253 | 3300045836 | Ga0466958_0088615 | Ga0466958_0088615_756_1304 | 179 |
| 254 | 3300045836 | Ga0466958_0097265 | Ga0466958_0097265_302_868 | 179 |
| 255 | 3300045976 | Ga0466967_0188082 | Ga0466967_0188082_725_1309 | 179 |
| 256 | 3300046507 | Ga0495606_0037138 | Ga0495606_0037138_662_1225 | 179 |
| 257 | 3300046524 | Ga0495648_0327024 | Ga0495648_0327024_56_607 | 179 |
| 258 | 3300048903 | Ga0496100_0000479 | Ga0496100_0000479_2672_3238 | 179 |
| 259 | 3300048904 | Ga0496101_0000401 | Ga0496101_0000401_25773_26339 | 179 |
| 260 | 3300048904 | Ga0496101_0098336 | Ga0496101_0098336_1444_2028 | 179 |
| 261 | 3300048904 | Ga0496101_0282930 | Ga0496101_0282930_599_1183 | 179 |
| 262 | 3300048905 | Ga0496102_0334658 | Ga0496102_0334658_508_1092 | 179 |
| 263 | 3300048907 | Ga0496104_0040702 | Ga0496104_0040702_382_963 | 179 |
| 264 | 3300048910 | Ga0496107_0043780 | Ga0496107_0043780_1819_2403 | 179 |
| 265 | 3300048911 | Ga0496108_0098842 | Ga0496108_0098842_1755_2339 | 179 |
| 266 | 3300048911 | Ga0496108_0128669 | Ga0496108_0128669_351_920 | 179 |
| 267 | 3300048912 | Ga0496109_0448158 | Ga0496109_0448158_559_1128 | 179 |
| 268 | 3300048912 | Ga0496109_0822914 | Ga0496109_0822914_124_708 | 179 |
| 269 | 3300048913 | Ga0496110_0126931 | Ga0496110_0126931_1073_1639 | 179 |
| 270 | 3300048913 | Ga0496110_0924269 | Ga0496110_0924269_120_704 | 179 |
| 271 | 3300048914 | Ga0496111_0477931 | Ga0496111_0477931_304_888 | 179 |
| 272 | 3300048915 | Ga0496112_0511387 | Ga0496112_0511387_159_743 | 179 |
| 273 | 3300048917 | Ga0496114_0134739 | Ga0496114_0134739_870_1454 | 179 |
| 274 | 3300048917 | Ga0496114_0577177 | Ga0496114_0577177_223_807 | 179 |
| 275 | 3300048917 | Ga0496114_0603422 | Ga0496114_0603422_116_769 | 179 |
| 276 | 3300048925 | Ga0496122_0013255 | Ga0496122_0013255_2754_3320 | 179 |
| 277 | 3300048926 | Ga0496123_0001649 | Ga0496123_0001649_16215_16781 | 179 |
| 278 | 3300048927 | Ga0496124_0418713 | Ga0496124_0418713_315_881 | 179 |
| 279 | 3300049569 | Ga0501032_0059003 | Ga0501032_0059003_1540_2106 | 179 |
| 280 | 3300049569 | Ga0501032_0068889 | Ga0501032_0068889_999_1583 | 179 |
| 281 | 3300049572 | Ga0501036_0031995 | Ga0501036_0031995_1849_2433 | 179 |
| 282 | 3300049572 | Ga0501036_0119708 | Ga0501036_0119708_464_1030 | 179 |
| 283 | 3300049575 | Ga0501039_0026838 | Ga0501039_0026838_1453_2037 | 179 |
| 284 | 3300049576 | Ga0501040_0013175 | Ga0501040_0013175_1356_1940 | 179 |
| 285 | 3300049577 | Ga0501041_0039656 | Ga0501041_0039656_913_1497 | 179 |
| 286 | 3300049578 | Ga0501042_0007133 | Ga0501042_0007133_4030_4614 | 179 |
| 287 | 3300049579 | Ga0501043_0131725 | Ga0501043_0131725_447_1013 | 179 |
| 288 | 3300049579 | Ga0501043_0281710 | Ga0501043_0281710_340_924 | 179 |
| 289 | 3300049580 | Ga0501046_0089609 | Ga0501046_0089609_1537_2103 | 179 |
| 290 | 3300049581 | Ga0501047_0129446 | Ga0501047_0129446_299_865 | 179 |
| 291 | 3300049582 | Ga0501048_0049156 | Ga0501048_0049156_1502_2086 | 179 |
| 292 | 3300049583 | Ga0501067_0000062 | Ga0501067_0000062_54373_54957 | 179 |
| 293 | 3300049583 | Ga0501067_0364935 | Ga0501067_0364935_157_741 | 179 |
| 294 | 3300049584 | Ga0501068_0000016 | Ga0501068_0000016_39856_40440 | 179 |
| 295 | 3300049585 | Ga0501069_0001293 | Ga0501069_0001293_1544_2128 | 179 |
| 296 | 3300049585 | Ga0501069_0140503 | Ga0501069_0140503_132_716 | 179 |
| 297 | 3300049586 | Ga0501070_0231293 | Ga0501070_0231293_91_654 | 179 |
| 298 | 3300049587 | Ga0501071_0012857 | Ga0501071_0012857_3483_4067 | 179 |
| 299 | 3300049587 | Ga0501071_0311096 | Ga0501071_0311096_40_624 | 179 |
| 300 | 3300049587 | Ga0501071_0324691 | Ga0501071_0324691_448_1038 | 179 |
| 301 | 3300049588 | Ga0501072_0003348 | Ga0501072_0003348_1923_2507 | 179 |
| 302 | 3300049588 | Ga0501072_0625109 | Ga0501072_0625109_16_606 | 179 |
| 303 | 3300049589 | Ga0501073_0117360 | Ga0501073_0117360_384_968 | 179 |
| 304 | 3300049590 | Ga0501074_0033898 | Ga0501074_0033898_1418_2002 | 179 |
| 305 | 3300049591 | Ga0501075_0032114 | Ga0501075_0032114_611_1195 | 179 |
| 306 | 3300049592 | Ga0501076_0005562 | Ga0501076_0005562_3649_4233 | 179 |
| 307 | 3300049593 | Ga0501077_0015745 | Ga0501077_0015745_2081_2665 | 179 |
| 308 | 3300049741 | Ga0501079_0076624 | Ga0501079_0076624_742_1326 | 179 |
| 309 | 3300049742 | Ga0501080_0272108 | Ga0501080_0272108_83_670 | 179 |
| 310 | 3300049742 | Ga0501080_1111979 | Ga0501080_1111979_50_631 | 179 |
| 311 | 3300049743 | Ga0501081_0005277 | Ga0501081_0005277_1607_2191 | 179 |
| 312 | 3300049744 | Ga0501083_0054986 | Ga0501083_0054986_1121_1705 | 179 |
| 313 | 3300049822 | Ga0501035_0097254 | Ga0501035_0097254_506_1090 | 179 |
| 314 | 3300049822 | Ga0501035_0114922 | Ga0501035_0114922_277_843 | 179 |
| 315 | 3300049822 | Ga0501035_1098636 | Ga0501035_1098636_48_602 | 179 |
| 316 | 3300049823 | Ga0501044_0070812 | Ga0501044_0070812_1443_2009 | 179 |
| 317 | 3300049823 | Ga0501044_0127177 | Ga0501044_0127177_1604_2158 | 179 |
| 318 | 3300050509 | nmdc:mga0qj67_6664_c1 | nmdc:mga0qj67_6664_c1_6006_6596 | 179 |
| 319 | 3300050510 | nmdc:mga06r32_13212_c1 | nmdc:mga06r32_13212_c1_1020_1610 | 179 |
| 320 | 3300050511 | nmdc:mga08y16_298933_c1 | nmdc:mga08y16_298933_c1_775_1434 | 179 |
| 321 | 3300050512 | nmdc:mga0n895_34628_c1 | nmdc:mga0n895_34628_c1_1636_2220 | 179 |
| 322 | 3300050514 | nmdc:mga08x19_309992_c1 | nmdc:mga08x19_309992_c1_359_922 | 179 |
| 323 | 3300053731 | Ga0500609_004997 | Ga0500609_004997_1119_1670 | 179 |
| 324 | 3300054114 | Ga0501084_0013456 | Ga0501084_0013456_1862_2446 | 179 |
| 325 | 3300059491 | Ga0587070_021502 | Ga0587070_021502_318_911 | 179 |
| 326 | 3300059492 | Ga0587073_0003126 | Ga0587073_0003126_347_940 | 179 |
| 327 | 3300059493 | Ga0587077_017953 | Ga0587077_017953_305_898 | 179 |
| 328 | 3300059503 | Ga0587080_021416 | Ga0587080_021416_291_884 | 179 |
| 329 | 3300059504 | Ga0587082_021406 | Ga0587082_021406_303_896 | 179 |
| 330 | 3300059511 | Ga0587091_041506 | Ga0587091_041506_155_748 | 179 |
| 331 | 3300059513 | Ga0587094_023955 | Ga0587094_023955_98_691 | 179 |
| 332 | 3300059623 | Ga0587101_008211 | Ga0587101_008211_159_752 | 179 |
| 333 | 3300059624 | Ga0587109_021926 | Ga0587109_021926_107_700 | 179 |
| 334 | 3300059626 | Ga0587115_016917 | Ga0587115_016917_233_826 | 179 |
| 335 | 3300059640 | Ga0587067_023966 | Ga0587067_023966_168_761 | 179 |
| 336 | 3300059642 | Ga0587069_029239 | Ga0587069_029239_146_739 | 179 |
| 337 | 3300059643 | Ga0587072_026550 | Ga0587072_026550_304_897 | 179 |
| 338 | 3300059644 | Ga0587075_088623 | Ga0587075_088623_15_584 | 179 |
| 339 | 3300059645 | Ga0587076_032215 | Ga0587076_032215_169_762 | 179 |
| 340 | 3300059647 | Ga0587079_043964 | Ga0587079_043964_160_753 | 179 |
| 341 | 3300059652 | Ga0587107_017295 | Ga0587107_017295_190_783 | 179 |
| 342 | 3300060353 | Ga0501082_0010220 | Ga0501082_0010220_1616_2200 | 179 |
| 343 | 3300061719 | Ga0466962_0009699 | Ga0466962_0009699_3144_3716 | 179 |
| 344 | 3300061719 | Ga0466962_0298176 | Ga0466962_0298176_46_594 | 179 |
| 345 | 3300061734 | Ga0530510_0018053 | Ga0530510_0018053_4384_4968 | 179 |
| 346 | 3300061734 | Ga0530510_0050654 | Ga0530510_0050654_238_822 | 179 |
| 347 | 3300005434 | Ga0070709_10030918 | Ga0070709_100309182 | 180 |
| 348 | 3300005435 | Ga0070714_100020292 | Ga0070714_1000202927 | 180 |
| 349 | 3300005436 | Ga0070713_100534013 | Ga0070713_1005340132 | 180 |
| 350 | 3300005437 | Ga0070710_10062485 | Ga0070710_100624852 | 180 |
| 351 | 3300005439 | Ga0070711_100176983 | Ga0070711_1001769831 | 180 |
| 352 | 3300005981 | Ga0081538_10005533 | Ga0081538_1000553310 | 180 |
| 353 | 3300006028 | Ga0070717_10179890 | Ga0070717_101798904 | 180 |
| 354 | 3300006173 | Ga0070716_100062657 | Ga0070716_1000626573 | 180 |
| 355 | 3300025898 | Ga0207692_10085260 | Ga0207692_100852602 | 180 |
| 356 | 3300025906 | Ga0207699_10004397 | Ga0207699_100043976 | 180 |
| 357 | 3300025915 | Ga0207693_10013495 | Ga0207693_100134952 | 180 |
| 358 | 3300025916 | Ga0207663_10079277 | Ga0207663_100792771 | 180 |
| 359 | 3300025916 | Ga0207663_10308338 | Ga0207663_103083382 | 180 |
| 360 | 3300025928 | Ga0207700_10036458 | Ga0207700_100364582 | 180 |
| 361 | 3300025929 | Ga0207664_10016099 | Ga0207664_100160993 | 180 |
| 362 | 3300025939 | Ga0207665_10072912 | Ga0207665_100729122 | 180 |
| 363 | 3300032002 | Ga0307416_100850769 | Ga0307416_1008507692 | 180 |
| 364 | 3300032126 | Ga0307415_100553120 | Ga0307415_1005531201 | 180 |
| 365 | 3300035083 | Ga0373926_0003471 | Ga0373926_0003471_1602_2153 | 180 |
| 366 | 3300035089 | Ga0373944_0001715 | Ga0373944_0001715_1026_1577 | 180 |
| 367 | 3300035111 | Ga0373923_0010331 | Ga0373923_0010331_1472_2023 | 180 |
| 368 | 3300035113 | Ga0373936_0005507 | Ga0373936_0005507_2831_3382 | 180 |
| 369 | 3300035116 | Ga0373945_0004046 | Ga0373945_0004046_1909_2460 | 180 |
| 370 | 3300035170 | Ga0373943_0005188 | Ga0373943_0005188_3971_4522 | 180 |
| 371 | 3300035171 | Ga0373946_0000575 | Ga0373946_0000575_3940_4491 | 180 |
| 372 | 3300035172 | Ga0373955_0106106 | Ga0373955_0106106_30_581 | 180 |
| 373 | 3300035410 | Ga0373924_0028123 | Ga0373924_0028123_170_721 | 180 |
| 374 | 3300035692 | Ga0373935_0026219 | Ga0373935_0026219_1519_2070 | 180 |
| 375 | 3300035695 | Ga0373927_0010216 | Ga0373927_0010216_3880_4431 | 180 |
| 376 | 3300035725 | Ga0373947_0194236 | Ga0373947_0194236_500_1051 | 180 |
| 377 | 3300036401 | Ga0373937_0245754 | Ga0373937_0245754_1029_1580 | 180 |
| 378 | 3300037068 | Ga0373925_0069162 | Ga0373925_0069162_1941_2492 | 180 |
| 379 | 3300044901 | Ga0466960_0146762 | Ga0466960_0146762_149_706 | 180 |
| 380 | 3300046459 | Ga0495629_0188919 | Ga0495629_0188919_432_983 | 180 |
| 381 | 3300046461 | Ga0495641_0009489 | Ga0495641_0009489_3744_4295 | 180 |
| 382 | 3300046462 | Ga0495651_0562169 | Ga0495651_0562169_89_640 | 180 |
| 383 | 3300046463 | Ga0495653_0019372 | Ga0495653_0019372_4420_4971 | 180 |
| 384 | 3300046476 | Ga0495662_0010934 | Ga0495662_0010934_2038_2589 | 180 |
| 385 | 3300046477 | Ga0495664_0006698 | Ga0495664_0006698_4362_4913 | 180 |
| 386 | 3300046511 | Ga0495608_0036336 | Ga0495608_0036336_1094_1645 | 180 |
| 387 | 3300046514 | Ga0495618_0084824 | Ga0495618_0084824_1343_1894 | 180 |
| 388 | 3300046516 | Ga0495628_0503793 | Ga0495628_0503793_132_683 | 180 |
| 389 | 3300046517 | Ga0495630_0100745 | Ga0495630_0100745_1365_1916 | 180 |
| 390 | 3300046529 | Ga0495652_0145363 | Ga0495652_0145363_1035_1586 | 180 |
| 391 | 3300046531 | Ga0495665_0035475 | Ga0495665_0035475_924_1475 | 180 |
| 392 | 3300046533 | Ga0495640_0054709 | Ga0495640_0054709_1099_1650 | 180 |
| 393 | 3300046559 | Ga0495667_0006224 | Ga0495667_0006224_5537_6088 | 180 |
| 394 | 3300046642 | Ga0495634_0046647 | Ga0495634_0046647_1306_1857 | 180 |
| 395 | 3300046663 | Ga0495635_0006919 | Ga0495635_0006919_5529_6080 | 180 |
| 396 | 3300046675 | Ga0495657_0041497 | Ga0495657_0041497_1184_1735 | 180 |
| 397 | 3300046678 | Ga0495599_0040085 | Ga0495599_0040085_2060_2611 | 180 |
| 398 | 3300046690 | Ga0495624_0007519 | Ga0495624_0007519_5902_6453 | 180 |
| 399 | 3300046809 | Ga0495600_0030565 | Ga0495600_0030565_2852_3403 | 180 |
| 400 | 3300047315 | Ga0495581_0047696 | Ga0495581_0047696_821_1372 | 180 |
| 401 | 3300047319 | Ga0495674_0017109 | Ga0495674_0017109_1843_2394 | 180 |
| 402 | 3300047321 | Ga0495676_0021662 | Ga0495676_0021662_4811_5362 | 180 |
| 403 | 3300047322 | Ga0495680_0109069 | Ga0495680_0109069_35_586 | 180 |
| 404 | 3300047471 | Ga0495684_0050902 | Ga0495684_0050902_1111_1662 | 180 |
| 405 | 3300047673 | Ga0495593_0031800 | Ga0495593_0031800_1206_1757 | 180 |
| 406 | 3300048922 | Ga0496119_0043024 | Ga0496119_0043024_2194_2760 | 180 |
| 407 | 3300048923 | Ga0496120_0011220 | Ga0496120_0011220_133_699 | 180 |
| 408 | 3300049593 | Ga0501077_0340251 | Ga0501077_0340251_122_703 | 180 |
| 409 | 3300044656 | Ga0466969_0055878 | Ga0466969_0055878_28_624 | 181 |
| 410 | 3300025981 | Ga0207640_10100645 | Ga0207640_101006452 | 182 |
| 411 | 3300026078 | Ga0207702_10497884 | Ga0207702_104978842 | 182 |
| 412 | 3300005563 | Ga0068855_100010026 | Ga0068855_1000100264 | 183 |
| 413 | 3300005937 | Ga0081455_10000396 | Ga0081455_1000039652 | 183 |
| 414 | 3300013104 | Ga0157370_10021704 | Ga0157370_100217043 | 183 |
| 415 | 3300013105 | Ga0157369_10029248 | Ga0157369_100292484 | 183 |
| 416 | 3300013307 | Ga0157372_10441502 | Ga0157372_104415023 | 183 |
| 417 | 3300020069 | Ga0197907_11096209 | Ga0197907_110962091 | 183 |
| 418 | 3300020069 | Ga0197907_11127221 | Ga0197907_111272211 | 183 |
| 419 | 3300020069 | Ga0197907_11442931 | Ga0197907_114429312 | 183 |
| 420 | 3300020070 | Ga0206356_10889118 | Ga0206356_108891181 | 183 |
| 421 | 3300020075 | Ga0206349_1615072 | Ga0206349_16150721 | 183 |
| 422 | 3300020077 | Ga0206351_10024129 | Ga0206351_100241291 | 183 |
| 423 | 3300020080 | Ga0206350_10694190 | Ga0206350_106941901 | 183 |
| 424 | 3300020081 | Ga0206354_10204561 | Ga0206354_102045611 | 183 |
| 425 | 3300021384 | Ga0213876_10031079 | Ga0213876_100310794 | 183 |
| 426 | 3300022467 | Ga0224712_10016623 | Ga0224712_100166233 | 183 |
| 427 | 3300022467 | Ga0224712_10029936 | Ga0224712_100299363 | 183 |
| 428 | 3300022467 | Ga0224712_10053952 | Ga0224712_100539522 | 183 |
| 429 | 3300025913 | Ga0207695_10023759 | Ga0207695_100237593 | 183 |
| 430 | 3300025919 | Ga0207657_10279991 | Ga0207657_102799911 | 183 |
| 431 | 3300025921 | Ga0207652_10141118 | Ga0207652_101411183 | 183 |
| 432 | 3300026142 | Ga0207698_10327602 | Ga0207698_103276022 | 183 |
| 433 | 3300037418 | Ga0395900_0074446 | Ga0395900_0074446_1769_2323 | 183 |
| 434 | 3300038443 | Ga0395901_0110634 | Ga0395901_0110634_2272_2826 | 183 |
| 435 | 3300044656 | Ga0466969_0019537 | Ga0466969_0019537_30_581 | 183 |
| 436 | 3300044656 | Ga0466969_0180769 | Ga0466969_0180769_168_719 | 183 |
| 437 | 3300044684 | Ga0466966_0012056 | Ga0466966_0012056_4205_4774 | 183 |
| 438 | 3300044684 | Ga0466966_0020874 | Ga0466966_0020874_3684_4235 | 183 |
| 439 | 3300044693 | Ga0466961_0009301 | Ga0466961_0009301_4119_4688 | 183 |
| 440 | 3300044765 | Ga0466970_0019622 | Ga0466970_0019622_2618_3187 | 183 |
| 441 | 3300044765 | Ga0466970_0643493 | Ga0466970_0643493_42_593 | 183 |
| 442 | 3300045049 | Ga0466959_0298550 | Ga0466959_0298550_122_673 | 183 |
| 443 | 3300045836 | Ga0466958_0699421 | Ga0466958_0699421_47_598 | 183 |
| 444 | 3300048904 | Ga0496101_0175318 | Ga0496101_0175318_907_1464 | 183 |
| 445 | 3300048917 | Ga0496114_0061213 | Ga0496114_0061213_270_827 | 183 |
| 446 | 3300061719 | Ga0466962_0004800 | Ga0466962_0004800_2583_3134 | 183 |
| 447 | 3300003373 | JGI25407J50210_10002871 | JGI25407J50210_100028714 | 184 |
| 448 | 3300005434 | Ga0070709_10085287 | Ga0070709_100852872 | 184 |
| 449 | 3300005434 | Ga0070709_10245075 | Ga0070709_102450752 | 184 |
| 450 | 3300005434 | Ga0070709_10276561 | Ga0070709_102765612 | 184 |
| 451 | 3300005436 | Ga0070713_100555422 | Ga0070713_1005554222 | 184 |
| 452 | 3300005437 | Ga0070710_10141203 | Ga0070710_101412032 | 184 |
| 453 | 3300005439 | Ga0070711_100244919 | Ga0070711_1002449192 | 184 |
| 454 | 3300005564 | Ga0070664_100500612 | Ga0070664_1005006122 | 184 |
| 455 | 3300005614 | Ga0068856_100196061 | Ga0068856_1001960611 | 184 |
| 456 | 3300005617 | Ga0068859_100001908 | Ga0068859_1000019089 | 184 |
| 457 | 3300005981 | Ga0081538_10001730 | Ga0081538_1000173013 | 184 |
| 458 | 3300005983 | Ga0081540_1000134 | Ga0081540_100013487 | 184 |
| 459 | 3300006028 | Ga0070717_10627153 | Ga0070717_106271532 | 184 |
| 460 | 3300006042 | Ga0075368_10270361 | Ga0075368_102703611 | 184 |
| 461 | 3300006048 | Ga0075363_100411037 | Ga0075363_1004110371 | 184 |
| 462 | 3300006175 | Ga0070712_100419855 | Ga0070712_1004198552 | 184 |
| 463 | 3300006175 | Ga0070712_100570304 | Ga0070712_1005703041 | 184 |
| 464 | 3300006931 | Ga0097620_100001908 | Ga0097620_10000190813 | 184 |
| 465 | 3300009101 | Ga0105247_10000043 | Ga0105247_1000004348 | 184 |
| 466 | 3300009101 | Ga0105247_10001971 | Ga0105247_100019715 | 184 |
| 467 | 3300009174 | Ga0105241_10851736 | Ga0105241_108517361 | 184 |
| 468 | 3300009177 | Ga0105248_10004160 | Ga0105248_1000416014 | 184 |
| 469 | 3300014325 | Ga0163163_10253062 | Ga0163163_102530622 | 184 |
| 470 | 3300020069 | Ga0197907_11401217 | Ga0197907_114012173 | 184 |
| 471 | 3300020075 | Ga0206349_1149084 | Ga0206349_11490841 | 184 |
| 472 | 3300020075 | Ga0206349_1761265 | Ga0206349_17612651 | 184 |
| 473 | 3300020076 | Ga0206355_1548352 | Ga0206355_15483523 | 184 |
| 474 | 3300020080 | Ga0206350_10233564 | Ga0206350_102335642 | 184 |
| 475 | 3300020610 | Ga0154015_1616732 | Ga0154015_16167322 | 184 |
| 476 | 3300021384 | Ga0213876_10156836 | Ga0213876_101568362 | 184 |
| 477 | 3300021388 | Ga0213875_10146747 | Ga0213875_101467472 | 184 |
| 478 | 3300022467 | Ga0224712_10050345 | Ga0224712_100503452 | 184 |
| 479 | 3300022467 | Ga0224712_10285643 | Ga0224712_102856431 | 184 |
| 480 | 3300022467 | Ga0224712_10464196 | Ga0224712_104641961 | 184 |
| 481 | 3300022467 | Ga0224712_10482934 | Ga0224712_104829341 | 184 |
| 482 | 3300025735 | Ga0207713_1050987 | Ga0207713_10509872 | 184 |
| 483 | 3300025898 | Ga0207692_10141843 | Ga0207692_101418432 | 184 |
| 484 | 3300025900 | Ga0207710_10000064 | Ga0207710_1000006455 | 184 |
| 485 | 3300025900 | Ga0207710_10051326 | Ga0207710_100513264 | 184 |
| 486 | 3300025906 | Ga0207699_10057446 | Ga0207699_100574462 | 184 |
| 487 | 3300025906 | Ga0207699_10059550 | Ga0207699_100595502 | 184 |
| 488 | 3300025906 | Ga0207699_10264188 | Ga0207699_102641882 | 184 |
| 489 | 3300025915 | Ga0207693_10047634 | Ga0207693_100476342 | 184 |
| 490 | 3300025915 | Ga0207693_10135899 | Ga0207693_101358992 | 184 |
| 491 | 3300025916 | Ga0207663_10189056 | Ga0207663_101890562 | 184 |
| 492 | 3300025916 | Ga0207663_10354951 | Ga0207663_103549512 | 184 |
| 493 | 3300025928 | Ga0207700_10011627 | Ga0207700_100116275 | 184 |
| 494 | 3300025928 | Ga0207700_10489711 | Ga0207700_104897112 | 184 |
| 495 | 3300025929 | Ga0207664_10065693 | Ga0207664_100656931 | 184 |
| 496 | 3300025929 | Ga0207664_10101021 | Ga0207664_101010214 | 184 |
| 497 | 3300025939 | Ga0207665_10009742 | Ga0207665_100097422 | 184 |
| 498 | 3300025941 | Ga0207711_10075760 | Ga0207711_100757603 | 184 |
| 499 | 3300035083 | Ga0373926_0003247 | Ga0373926_0003247_429_992 | 184 |
| 500 | 3300035089 | Ga0373944_0001489 | Ga0373944_0001489_2643_3206 | 184 |
| 501 | 3300035111 | Ga0373923_0027654 | Ga0373923_0027654_1036_1599 | 184 |
| 502 | 3300035113 | Ga0373936_0001869 | Ga0373936_0001869_3738_4301 | 184 |
| 503 | 3300035116 | Ga0373945_0011963 | Ga0373945_0011963_1717_2280 | 184 |
| 504 | 3300035170 | Ga0373943_0004349 | Ga0373943_0004349_816_1379 | 184 |
| 505 | 3300035171 | Ga0373946_0000042 | Ga0373946_0000042_28213_28776 | 184 |
| 506 | 3300035172 | Ga0373955_0049025 | Ga0373955_0049025_1642_2220 | 184 |
| 507 | 3300035692 | Ga0373935_0001080 | Ga0373935_0001080_10191_10754 | 184 |
| 508 | 3300035695 | Ga0373927_0003836 | Ga0373927_0003836_6406_6969 | 184 |
| 509 | 3300035725 | Ga0373947_0001186 | Ga0373947_0001186_5870_6433 | 184 |
| 510 | 3300036401 | Ga0373937_0705843 | Ga0373937_0705843_350_913 | 184 |
| 511 | 3300037068 | Ga0373925_0012878 | Ga0373925_0012878_2757_3320 | 184 |
| 512 | 3300037466 | Ga0395898_0769268 | Ga0395898_0769268_318_878 | 184 |
| 513 | 3300037853 | Ga0436364_0861475 | Ga0436364_0861475_253_822 | 184 |
| 514 | 3300039437 | Ga0436365_0327584 | Ga0436365_0327584_139_699 | 184 |
| 515 | 3300039437 | Ga0436365_0933082 | Ga0436365_0933082_33_602 | 184 |
| 516 | 3300039453 | Ga0436362_0068107 | Ga0436362_0068107_778_1338 | 184 |
| 517 | 3300044656 | Ga0466969_0000554 | Ga0466969_0000554_17569_18165 | 184 |
| 518 | 3300044683 | Ga0466965_0017743 | Ga0466965_0017743_236_799 | 184 |
| 519 | 3300044684 | Ga0466966_0295896 | Ga0466966_0295896_332_940 | 184 |
| 520 | 3300044693 | Ga0466961_0157929 | Ga0466961_0157929_817_1371 | 184 |
| 521 | 3300044693 | Ga0466961_0336565 | Ga0466961_0336565_234_809 | 184 |
| 522 | 3300044694 | Ga0466963_0012536 | Ga0466963_0012536_2807_3370 | 184 |
| 523 | 3300044694 | Ga0466963_0038565 | Ga0466963_0038565_1522_2079 | 184 |
| 524 | 3300044694 | Ga0466963_0062782 | Ga0466963_0062782_1255_1809 | 184 |
| 525 | 3300044694 | Ga0466963_0141357 | Ga0466963_0141357_802_1365 | 184 |
| 526 | 3300044706 | Ga0466964_0359420 | Ga0466964_0359420_40_603 | 184 |
| 527 | 3300044719 | Ga0466971_0158743 | Ga0466971_0158743_337_891 | 184 |
| 528 | 3300044765 | Ga0466970_0044326 | Ga0466970_0044326_757_1317 | 184 |
| 529 | 3300044842 | Ga0466957_0075535 | Ga0466957_0075535_281_841 | 184 |
| 530 | 3300044901 | Ga0466960_0150196 | Ga0466960_0150196_336_899 | 184 |
| 531 | 3300045049 | Ga0466959_0250298 | Ga0466959_0250298_402_956 | 184 |
| 532 | 3300045049 | Ga0466959_0472641 | Ga0466959_0472641_243_818 | 184 |
| 533 | 3300045836 | Ga0466958_0013798 | Ga0466958_0013798_2840_3400 | 184 |
| 534 | 3300045836 | Ga0466958_0189382 | Ga0466958_0189382_698_1273 | 184 |
| 535 | 3300045836 | Ga0466958_0351855 | Ga0466958_0351855_69_632 | 184 |
| 536 | 3300045976 | Ga0466967_0047896 | Ga0466967_0047896_1941_2504 | 184 |
| 537 | 3300045976 | Ga0466967_0109999 | Ga0466967_0109999_498_1061 | 184 |
| 538 | 3300045976 | Ga0466967_0137775 | Ga0466967_0137775_889_1443 | 184 |
| 539 | 3300045976 | Ga0466967_0556818 | Ga0466967_0556818_510_1064 | 184 |
| 540 | 3300045976 | Ga0466967_1590455 | Ga0466967_1590455_45_605 | 184 |
| 541 | 3300046455 | Ga0495603_0105267 | Ga0495603_0105267_814_1380 | 184 |
| 542 | 3300046459 | Ga0495629_0305964 | Ga0495629_0305964_246_809 | 184 |
| 543 | 3300046461 | Ga0495641_0014000 | Ga0495641_0014000_1800_2363 | 184 |
| 544 | 3300046462 | Ga0495651_0221150 | Ga0495651_0221150_464_1027 | 184 |
| 545 | 3300046463 | Ga0495653_0025616 | Ga0495653_0025616_1984_2547 | 184 |
| 546 | 3300046473 | Ga0495582_0006701 | Ga0495582_0006701_3062_3625 | 184 |
| 547 | 3300046475 | Ga0495639_0033051 | Ga0495639_0033051_1334_1897 | 184 |
| 548 | 3300046476 | Ga0495662_0118063 | Ga0495662_0118063_158_721 | 184 |
| 549 | 3300046477 | Ga0495664_0058322 | Ga0495664_0058322_264_827 | 184 |
| 550 | 3300046511 | Ga0495608_0143016 | Ga0495608_0143016_381_944 | 184 |
| 551 | 3300046514 | Ga0495618_0010834 | Ga0495618_0010834_3236_3799 | 184 |
| 552 | 3300046515 | Ga0495620_0149522 | Ga0495620_0149522_15_575 | 184 |
| 553 | 3300046517 | Ga0495630_0006044 | Ga0495630_0006044_6267_6830 | 184 |
| 554 | 3300046529 | Ga0495652_0074859 | Ga0495652_0074859_523_1086 | 184 |
| 555 | 3300046531 | Ga0495665_0052675 | Ga0495665_0052675_1233_1796 | 184 |
| 556 | 3300046533 | Ga0495640_0015045 | Ga0495640_0015045_5002_5565 | 184 |
| 557 | 3300046535 | Ga0495586_0347136 | Ga0495586_0347136_261_824 | 184 |
| 558 | 3300046543 | Ga0495645_0204505 | Ga0495645_0204505_135_698 | 184 |
| 559 | 3300046559 | Ga0495667_0001662 | Ga0495667_0001662_5155_5718 | 184 |
| 560 | 3300046642 | Ga0495634_0040656 | Ga0495634_0040656_1863_2426 | 184 |
| 561 | 3300046663 | Ga0495635_0001316 | Ga0495635_0001316_10090_10653 | 184 |
| 562 | 3300046675 | Ga0495657_0007892 | Ga0495657_0007892_1030_1593 | 184 |
| 563 | 3300046678 | Ga0495599_0209307 | Ga0495599_0209307_435_1043 | 184 |
| 564 | 3300046690 | Ga0495624_0001128 | Ga0495624_0001128_8894_9457 | 184 |
| 565 | 3300046809 | Ga0495600_0157577 | Ga0495600_0157577_563_1126 | 184 |
| 566 | 3300047315 | Ga0495581_0018592 | Ga0495581_0018592_3388_3951 | 184 |
| 567 | 3300047319 | Ga0495674_0006084 | Ga0495674_0006084_6684_7247 | 184 |
| 568 | 3300047321 | Ga0495676_0002527 | Ga0495676_0002527_4141_4704 | 184 |
| 569 | 3300047321 | Ga0495676_0006548 | Ga0495676_0006548_1281_1847 | 184 |
| 570 | 3300047322 | Ga0495680_0095280 | Ga0495680_0095280_489_1052 | 184 |
| 571 | 3300047471 | Ga0495684_0024834 | Ga0495684_0024834_3952_4515 | 184 |
| 572 | 3300048905 | Ga0496102_0000557 | Ga0496102_0000557_1111_1668 | 184 |
| 573 | 3300048906 | Ga0496103_0000434 | Ga0496103_0000434_33050_33607 | 184 |
| 574 | 3300048913 | Ga0496110_0235544 | Ga0496110_0235544_257_820 | 184 |
| 575 | 3300048920 | Ga0496117_0208051 | Ga0496117_0208051_86_643 | 184 |
| 576 | 3300048921 | Ga0496118_0004525 | Ga0496118_0004525_2706_3263 | 184 |
| 577 | 3300048922 | Ga0496119_0000215 | Ga0496119_0000215_264_845 | 184 |
| 578 | 3300048923 | Ga0496120_0000264 | Ga0496120_0000264_83678_84259 | 184 |
| 579 | 3300048923 | Ga0496120_0205285 | Ga0496120_0205285_89_646 | 184 |
| 580 | 3300048924 | Ga0496121_0039957 | Ga0496121_0039957_877_1434 | 184 |
| 581 | 3300048929 | Ga0496126_0104917 | Ga0496126_0104917_1846_2415 | 184 |
| 582 | 3300049585 | Ga0501069_0052000 | Ga0501069_0052000_1706_2266 | 184 |
| 583 | 3300049586 | Ga0501070_0253779 | Ga0501070_0253779_856_1416 | 184 |
| 584 | 3300049742 | Ga0501080_0078578 | Ga0501080_0078578_1699_2256 | 184 |
| 585 | 3300050489 | nmdc:mga03683_143183_c1 | nmdc:mga03683_143183_c1_478_1044 | 184 |
| 586 | 3300053078 | Ga0495612_0033699 | Ga0495612_0033699_1460_2038 | 184 |
| 587 | 3300053078 | Ga0495612_0284934 | Ga0495612_0284934_163_726 | 184 |
| 588 | 3300053084 | Ga0495595_0444073 | Ga0495595_0444073_28_591 | 184 |
| 589 | 3300053134 | Ga0500658_0066438 | Ga0500658_0066438_536_1090 | 184 |
| 590 | 3300061719 | Ga0466962_0188366 | Ga0466962_0188366_93_668 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vrn-assembly1.cif.gz_B | the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily | 0.9772 | 5 | 182 |
| 3l18-assembly1.cif.gz_B | ton1285, an intracellular protease from thermococcus onnurineus na1 | 0.9706 | 8 | 181 |
| 6f2f-assembly1.cif.gz_A | crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. | 0.9676 | 9 | 181 |
| 6q3t-assembly1.cif.gz_A | structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device | 0.9676 | 9 | 180 |
| 7r66-assembly1.cif.gz_A | structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution | 0.9655 | 9 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vrnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9752 | 5 | 182 | 3.40.50.880 |
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9676 | 9 | 181 | 3.40.50.880 |
| 1oi4B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9539 | 7 | 184 | 3.40.50.880 |
| 4y1eA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9489 | 8 | 184 | 3.40.50.880 |
| 6f2fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9449 | 9 | 181 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2Q4L0-F1-model_v4 | deleted | 1.005 | 92 | 181 |
|
| AF-A0A4R6WVT8-F1-model_v4 | deleted | 1.002 | 92 | 181 |
|
| AF-A0A7W9IBH6-F1-model_v4 | Protease I (EC 3.2.-.-) | 1 | 5 | 175 |
GO:0006508
GO:0008233 GO:0016798 |
| AF-A0A7K2MGU3-F1-model_v4 | Protease | 1 | 9 | 148 |
GO:0006508
GO:0008233 |
| AF-A0A2N8PBM3-F1-model_v4 | Glutamine amidotransferase | 0.9999 | 9 | 184 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar