F466989

General Info

Members Datasets Scaffolds Average Seq Length
590 334 571 90

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0680897|Ga0451853_0680897_310_624
Length 104
Sequence MSTISDTRTAPENTMTRTVHCIKLGRDAEGLAFVPWPGELGKRVFESVSKEAWSQWLAHQTMLINENRLSPLDPKHRAFLQAEMEKYFFGEGSAAPAGYVAPDA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221720 Lysobacter sp. Root916 Isolate Unclassified
7 2643221728 Lysobacter sp. Root983 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
12 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
13 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
14 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
15 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
16 2919085039 Luteibacter sp. 1214 Isolate Unclassified
17 2919404418 Luteibacter sp. 3190 Isolate Unclassified
18 2941471342 Luteibacter sp. 621 Isolate Unclassified
19 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
20 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
205 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
212 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
215 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
216 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
224 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
227 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
228 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
321 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 1.36
Isolates 3.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 0
Rhizoplane 4.58
Rhizosphere 78.47
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1029647 3300001904 Bacteria 846
2 JGI25162J39368_1020736 3300002737 Bacteria 616
3 JGI25152J39213_1049024 3300002773 Bacteria 558
4 JGI25165J46597_1008854 3300003214 Bacteria 1549
5 rootH1_10017453 3300003316 Bacteria 6082
6 rootH1_10017453 3300003323 Bacteria 1575
7 rootH1_10088254 3300003323 Bacteria 1738
8 Ga0006562J51391_1099466 3300003578 Bacteria 9300
9 Ga0058692_1005461 3300003856 Bacteria 3621
10 Ga0055543_1011606 3300004625 Bacteria 1796
11 Ga0058859_11615505 3300004798 Bacteria 550
12 Ga0058860_12100890 3300004801 Bacteria 566
13 Ga0065165_1000260 3300005262 Bacteria 90953
14 Ga0070658_10240707 3300005327 Bacteria 1534
15 Ga0070658_10413787 3300005327 Bacteria 1159
16 Ga0070658_11268747 3300005327 Bacteria 640
17 Ga0070676_10466687 3300005328 Bacteria 890
18 Ga0070670_100197512 3300005331 Bacteria 1748
19 Ga0068869_100267896 3300005334 Bacteria 1369
20 Ga0068869_100629881 3300005334 Bacteria 909
21 Ga0068869_101005301 3300005334 Bacteria 726
22 Ga0070666_10000742 3300005335 Bacteria 19747
23 Ga0070666_10072315 3300005335 Bacteria 2348
24 Ga0070666_10195517 3300005335 Bacteria 1422
25 Ga0068868_101308476 3300005338 Bacteria 673
26 Ga0068868_102145478 3300005338 Bacteria 532
27 Ga0070689_100917237 3300005340 Bacteria 776
28 Ga0070687_101018642 3300005343 Bacteria 601
29 Ga0070661_100089903 3300005344 Bacteria 2274
30 Ga0070661_100364863 3300005344 Bacteria 1136
31 Ga0070668_100125371 3300005347 Bacteria 2056
32 Ga0070668_100297059 3300005347 Bacteria 1354
33 Ga0070668_101039478 3300005347 Unclassified 737
34 Ga0070669_100280726 3300005353 Bacteria 1334
35 Ga0070675_100276276 3300005354 Bacteria 1475
36 Ga0070671_100829822 3300005355 Bacteria 806
37 Ga0070674_102081129 3300005356 Bacteria 518
38 Ga0070673_100187164 3300005364 Bacteria 1776
39 Ga0070688_100094178 3300005365 Bacteria 1963
40 Ga0070667_100855423 3300005367 Bacteria 845
41 Ga0070667_101146090 3300005367 Unclassified 727
42 Ga0070667_101815184 3300005367 Bacteria 574
43 Ga0070700_100997334 3300005441 Bacteria 688
44 Ga0070663_100527976 3300005455 Bacteria 983
45 Ga0070663_100656638 3300005455 Bacteria 887
46 Ga0070663_100811358 3300005455 Bacteria 803
47 Ga0070678_100412452 3300005456 Bacteria 1176
48 Ga0070662_100094370 3300005457 Bacteria 2252
49 Ga0070662_100107522 3300005457 Bacteria 2120
50 Ga0068867_100282825 3300005459 Bacteria 1361
51 Ga0068867_100468820 3300005459 Bacteria 1076
52 Ga0068867_100557629 3300005459 Bacteria 993
53 Ga0070685_10000205 3300005466 Bacteria 39689
54 Ga0070685_10025649 3300005466 Bacteria 3245
55 Ga0070685_10527167 3300005466 Bacteria 840
56 Ga0070697_100522567 3300005536 Bacteria 1039
57 Ga0068853_100036621 3300005539 Bacteria 4174
58 Ga0070693_100001735 3300005547 Bacteria 9913
59 Ga0070665_100000326 3300005548 Bacteria 73416
60 Ga0070665_102168627 3300005548 Bacteria 560
61 Ga0068855_100000078 3300005563 Bacteria 117458
62 Ga0068855_100024697 3300005563 Bacteria 7189
63 Ga0068855_100311355 3300005563 Bacteria 1742
64 Ga0068857_100824830 3300005577 Bacteria 886
65 Ga0068857_100870366 3300005577 Bacteria 863
66 Ga0068854_100025225 3300005578 Bacteria 4079
67 Ga0068856_100010035 3300005614 Bacteria 9197
68 Ga0068856_100134763 3300005614 Bacteria 2475
69 Ga0070702_100135199 3300005615 Bacteria 1563
70 Ga0068852_100017329 3300005616 Bacteria 5649
71 Ga0068852_100168879 3300005616 Bacteria 2049
72 Ga0068852_100201958 3300005616 Bacteria 1881
73 Ga0068852_100238973 3300005616 Bacteria 1735
74 Ga0068852_100340245 3300005616 Bacteria 1462
75 Ga0068852_100359881 3300005616 Bacteria 1423
76 Ga0068852_101432808 3300005616 Bacteria 713
77 Ga0068859_100138341 3300005617 Bacteria 2509
78 Ga0068859_100215218 3300005617 Bacteria 2008
79 Ga0068864_101236888 3300005618 Bacteria 746
80 Ga0068864_102640006 3300005618 Bacteria 508
81 Ga0068851_10003057 3300005834 Bacteria 7400
82 Ga0068851_10513861 3300005834 Bacteria 720
83 Ga0068870_10198846 3300005840 Bacteria 1214
84 Ga0068870_10503358 3300005840 Bacteria 808
85 Ga0068863_100027548 3300005841 Bacteria 5421
86 Ga0068863_101491569 3300005841 Bacteria 685
87 Ga0068858_100001013 3300005842 Bacteria 28969
88 Ga0068858_100320312 3300005842 Bacteria 1482
89 Ga0068860_100533507 3300005843 Bacteria 1174
90 Ga0070717_10269813 3300006028 Bacteria 1507
91 Ga0075363_100109275 3300006048 Bacteria 1536
92 Ga0075369_10029070 3300006186 Bacteria 2320
93 Ga0075369_10069143 3300006186 Bacteria 1553
94 Ga0075366_10017805 3300006195 Bacteria 4096
95 Ga0097621_100122229 3300006237 Bacteria 2209
96 Ga0097621_100189583 3300006237 Bacteria 1780
97 Ga0097621_100547377 3300006237 Bacteria 1053
98 Ga0097621_101714959 3300006237 Bacteria 598
99 Ga0068871_100042692 3300006358 Bacteria 3642
100 Ga0068871_100081029 3300006358 Bacteria 2688
101 Ga0068871_100173286 3300006358 Bacteria 1851
102 Ga0068871_100443409 3300006358 Bacteria 1162
103 Ga0068865_100004902 3300006881 Bacteria 8091
104 Ga0068865_100210062 3300006881 Bacteria 1516
105 Ga0068865_100857375 3300006881 Bacteria 787
106 Ga0097620_100138346 3300006931 Bacteria 2509
107 Ga0097620_100215215 3300006931 Bacteria 2008
108 Ga0105240_10000669 3300009093 Bacteria 62916
109 Ga0105240_10483933 3300009093 Bacteria 1379
110 Ga0105240_11016058 3300009093 Bacteria 886
111 Ga0111539_10737058 3300009094 Bacteria 1147
112 Ga0111539_12511916 3300009094 Unclassified 597
113 Ga0105245_10260673 3300009098 Bacteria 1687
114 Ga0105245_10974587 3300009098 Bacteria 892
115 Ga0105247_10069032 3300009101 Bacteria 2204
116 Ga0105243_11047576 3300009148 Bacteria 821
117 Ga0105241_10011914 3300009174 Bacteria 6388
118 Ga0105241_10304357 3300009174 Bacteria 1369
119 Ga0105242_10119069 3300009176 Bacteria 2263
120 Ga0105242_10740788 3300009176 Bacteria 966
121 Ga0105242_11655181 3300009176 Bacteria 675
122 Ga0105248_11677650 3300009177 Bacteria 720
123 Ga0105237_10196553 3300009545 Bacteria 2017
124 Ga0105237_10344685 3300009545 Bacteria 1494
125 Ga0105237_10488869 3300009545 Bacteria 1237
126 Ga0105237_11036382 3300009545 Bacteria 827
127 Ga0105237_11831889 3300009545 Bacteria 614
128 Ga0105238_10015295 3300009551 Bacteria 7772
129 Ga0105238_10035481 3300009551 Bacteria 5070
130 Ga0105238_10083466 3300009551 Bacteria 3184
131 Ga0105238_10335484 3300009551 Bacteria 1499
132 Ga0105238_10658459 3300009551 Bacteria 1057
133 Ga0105238_11385265 3300009551 Bacteria 730
134 Ga0105238_12484495 3300009551 Bacteria 554
135 Ga0105238_12951911 3300009551 Bacteria 511
136 Ga0105249_10011129 3300009553 Bacteria 7905
137 Ga0105239_10018464 3300010375 Bacteria 7703
138 Ga0105239_10180374 3300010375 Bacteria 2363
139 Ga0105239_10405167 3300010375 Bacteria 1544
140 Ga0105239_10942375 3300010375 Bacteria 991
141 Ga0105246_12594422 3300011119 Bacteria 500
142 Ga0157370_10026574 3300013104 Bacteria 5713
143 Ga0157370_10116048 3300013104 Bacteria 2501
144 Ga0157370_10153048 3300013104 Bacteria 2146
145 Ga0157370_10182816 3300013104 Bacteria 1948
146 Ga0157370_10455417 3300013104 Bacteria 1176
147 Ga0157369_10022557 3300013105 Bacteria 7022
148 Ga0157369_10110918 3300013105 Bacteria 2916
149 Ga0157374_10146969 3300013296 Bacteria 2290
150 Ga0157374_11060161 3300013296 Bacteria 830
151 Ga0157378_10000158 3300013297 Bacteria 64291
152 Ga0157378_10043597 3300013297 Bacteria 3984
153 Ga0157378_10918393 3300013297 Bacteria 907
154 Ga0163162_10206003 3300013306 Bacteria 2096
155 Ga0157372_10121872 3300013307 Bacteria 2996
156 Ga0157375_10014871 3300013308 Bacteria 6955
157 Ga0157375_10389301 3300013308 Bacteria 1561
158 Ga0157375_10535464 3300013308 Bacteria 1334
159 Ga0163163_10000415 3300014325 Bacteria 39754
160 Ga0163163_11517169 3300014325 Bacteria 731
161 Ga0157380_10128383 3300014326 Bacteria 2159
162 Ga0157380_12909621 3300014326 Bacteria 545
163 Ga0182008_10001870 3300014497 Bacteria 13704
164 Ga0182008_10007165 3300014497 Bacteria 6173
165 Ga0182008_10538076 3300014497 Bacteria 647
166 Ga0157379_11566227 3300014968 Bacteria 643
167 Ga0157376_10007397 3300014969 Bacteria 7835
168 Ga0157376_10013837 3300014969 Bacteria 6033
169 Ga0157376_10049620 3300014969 Bacteria 3477
170 Ga0157376_10220949 3300014969 Bacteria 1754
171 Ga0182006_1000148 3300015261 Bacteria 74813
172 Ga0182006_1000764 3300015261 Bacteria 21872
173 Ga0182007_10022089 3300015262 Bacteria 2251
174 Ga0182007_10149377 3300015262 Bacteria 794
175 Ga0182005_1000138 3300015265 Bacteria 51894
176 Ga0182005_1000821 3300015265 Bacteria 13994
177 Ga0182005_1013927 3300015265 Bacteria 2257
178 Ga0163161_10013899 3300017792 Bacteria 5607
179 Ga0206352_10691753 3300020078 Bacteria 760
180 Ga0206353_10323706 3300020082 Bacteria 946
181 Ga0213876_10370448 3300021384 Bacteria 762
182 Ga0213876_10437183 3300021384 Bacteria 696
183 Ga0209674_100762 3300025226 Bacteria 10916
184 Ga0209148_1001376 3300025254 Bacteria 12658
185 Ga0209129_1002303 3300025258 Bacteria 9488
186 Ga0209233_1006128 3300025261 Bacteria 3909
187 Ga0209256_1011917 3300025299 Bacteria 3407
188 Ga0209051_1033416 3300025303 Bacteria 1946
189 Ga0209257_1004136 3300025304 Bacteria 11562
190 Ga0207656_10006516 3300025321 Bacteria 4203
191 Ga0207656_10217105 3300025321 Bacteria 928
192 Ga0207710_10034219 3300025900 Bacteria 2232
193 Ga0207710_10216258 3300025900 Bacteria 950
194 Ga0207680_10008110 3300025903 Bacteria 5147
195 Ga0207680_10028578 3300025903 Bacteria 3121
196 Ga0207680_10033449 3300025903 Bacteria 2933
197 Ga0207680_10342538 3300025903 Bacteria 1049
198 Ga0207647_10000008 3300025904 Bacteria 192602
199 Ga0207647_10002496 3300025904 Bacteria 13931
200 Ga0207645_10021426 3300025907 Bacteria 4214
201 Ga0207643_10227401 3300025908 Bacteria 1143
202 Ga0207643_10534763 3300025908 Bacteria 751
203 Ga0207705_10287724 3300025909 Bacteria 1259
204 Ga0207705_11472947 3300025909 Bacteria 516
205 Ga0207654_10152482 3300025911 Bacteria 1485
206 Ga0207654_11086175 3300025911 Bacteria 583
207 Ga0207695_10000014 3300025913 Bacteria 812599
208 Ga0207695_10002028 3300025913 Bacteria 31095
209 Ga0207695_10762853 3300025913 Bacteria 847
210 Ga0207649_10126540 3300025920 Bacteria 1730
211 Ga0207649_10241097 3300025920 Bacteria 1298
212 Ga0207649_11121452 3300025920 Bacteria 621
213 Ga0207681_10238971 3300025923 Bacteria 1413
214 Ga0207694_10005098 3300025924 Bacteria 10153
215 Ga0207694_10007511 3300025924 Bacteria 8263
216 Ga0207694_10092650 3300025924 Bacteria 2385
217 Ga0207694_10123407 3300025924 Bacteria 2070
218 Ga0207694_10582258 3300025924 Bacteria 941
219 Ga0207650_10040621 3300025925 Bacteria 3405
220 Ga0207650_11740392 3300025925 Bacteria 528
221 Ga0207659_10297963 3300025926 Bacteria 1323
222 Ga0207644_10477187 3300025931 Bacteria 1027
223 Ga0207644_11349213 3300025931 Bacteria 599
224 Ga0207690_11007956 3300025932 Bacteria 693
225 Ga0207706_10006474 3300025933 Bacteria 10872
226 Ga0207706_10288932 3300025933 Bacteria 1430
227 Ga0207686_10032376 3300025934 Bacteria 3111
228 Ga0207686_11567228 3300025934 Bacteria 544
229 Ga0207709_10324791 3300025935 Bacteria 1153
230 Ga0207670_10182421 3300025936 Bacteria 1582
231 Ga0207704_10015776 3300025938 Bacteria 3861
232 Ga0207704_10050293 3300025938 Bacteria 2513
233 Ga0207704_10092087 3300025938 Bacteria 1994
234 Ga0207704_11869776 3300025938 Bacteria 516
235 Ga0207691_11470612 3300025940 Bacteria 558
236 Ga0207711_10829711 3300025941 Unclassified 861
237 Ga0207711_11222579 3300025941 Bacteria 693
238 Ga0207689_10148749 3300025942 Bacteria 1930
239 Ga0207689_10175680 3300025942 Bacteria 1766
240 Ga0207689_10407809 3300025942 Bacteria 1133
241 Ga0207689_10568554 3300025942 Bacteria 953
242 Ga0207679_11754773 3300025945 Bacteria 567
243 Ga0207667_10000124 3300025949 Bacteria 118199
244 Ga0207667_10089902 3300025949 Bacteria 3173
245 Ga0207667_10233666 3300025949 Bacteria 1882
246 Ga0207712_10007905 3300025961 Bacteria 6719
247 Ga0207668_10443731 3300025972 Bacteria 1106
248 Ga0207668_10569931 3300025972 Unclassified 983
249 Ga0207640_10207846 3300025981 Bacteria 1489
250 Ga0207640_10908364 3300025981 Bacteria 769
251 Ga0207640_11436509 3300025981 Bacteria 619
252 Ga0207658_10145265 3300025986 Bacteria 1925
253 Ga0207658_10146137 3300025986 Bacteria 1920
254 Ga0207658_10181618 3300025986 Bacteria 1742
255 Ga0207658_11293452 3300025986 Bacteria 667
256 Ga0207677_10306264 3300026023 Bacteria 1314
257 Ga0207677_10639727 3300026023 Bacteria 937
258 Ga0207677_10667596 3300026023 Bacteria 919
259 Ga0207703_10002988 3300026035 Bacteria 14340
260 Ga0207703_10265457 3300026035 Bacteria 1553
261 Ga0207639_10000398 3300026041 Bacteria 29968
262 Ga0207639_11699959 3300026041 Bacteria 591
263 Ga0207639_11962518 3300026041 Bacteria 546
264 Ga0207678_10140849 3300026067 Bacteria 2058
265 Ga0207678_10244971 3300026067 Bacteria 1535
266 Ga0207678_11792618 3300026067 Bacteria 537
267 Ga0207702_10016655 3300026078 Bacteria 6085
268 Ga0207702_10022797 3300026078 Bacteria 5193
269 Ga0207702_10942821 3300026078 Bacteria 856
270 Ga0207702_11865032 3300026078 Bacteria 593
271 Ga0207641_10064699 3300026088 Bacteria 3126
272 Ga0207648_10078882 3300026089 Bacteria 2873
273 Ga0207648_10142765 3300026089 Bacteria 2111
274 Ga0207648_10158841 3300026089 Bacteria 1996
275 Ga0207676_10756685 3300026095 Bacteria 945
276 Ga0207676_11196605 3300026095 Bacteria 753
277 Ga0207676_12464087 3300026095 Unclassified 517
278 Ga0207674_10149424 3300026116 Bacteria 2294
279 Ga0207698_10015225 3300026142 Bacteria 5146
280 Ga0207698_10095932 3300026142 Bacteria 2443
281 Ga0207698_10502424 3300026142 Bacteria 1180
282 Ga0207698_10532968 3300026142 Bacteria 1148
283 Ga0207698_11409804 3300026142 Bacteria 712
284 Ga0207698_11435345 3300026142 Bacteria 705
285 Ga0207698_11794506 3300026142 Bacteria 629
286 Ga0268266_10000013 3300028379 Bacteria 649715
287 Ga0268266_10993599 3300028379 Bacteria 812
288 Ga0268265_11649230 3300028380 Bacteria 647
289 Ga0268264_10319828 3300028381 Bacteria 1467
290 Ga0307515_10624505 3300028794 Bacteria 689
291 Ga0265324_10060839 3300029957 Bacteria 1291
292 Ga0265328_10280302 3300031239 Bacteria 641
293 Ga0265339_10000061 3300031249 Bacteria 96584
294 Ga0265331_10586799 3300031250 Bacteria 503
295 Ga0265316_10000396 3300031344 Bacteria 49712
296 Ga0307509_10148769 3300031507 Bacteria 2262
297 Ga0307408_100520887 3300031548 Bacteria 1044
298 Ga0307408_101447585 3300031548 Bacteria 648
299 Ga0307508_10230769 3300031616 Bacteria 1449
300 Ga0307508_10390884 3300031616 Bacteria 982
301 Ga0307508_10608490 3300031616 Bacteria 695
302 Ga0316575_10013285 3300031665 Bacteria 3073
303 Ga0316579_10017166 3300031691 Bacteria 3172
304 Ga0316579_10297809 3300031691 Bacteria 780
305 Ga0265314_10000011 3300031711 Bacteria 445050
306 Ga0316576_10152582 3300031727 Bacteria 1741
307 Ga0316578_10040118 3300031728 Bacteria 2705
308 Ga0307516_10002273 3300031730 Bacteria 25900
309 Ga0307516_10016196 3300031730 Bacteria 7809
310 Ga0307405_10376174 3300031731 Bacteria 1104
311 Ga0307405_10979663 3300031731 Bacteria 720
312 Ga0316577_10007159 3300031733 Bacteria 5934
313 Ga0316577_10106903 3300031733 Bacteria 1570
314 Ga0316577_10738316 3300031733 Bacteria 559
315 Ga0307413_10303509 3300031824 Bacteria 1212
316 Ga0307518_10434202 3300031838 Bacteria 712
317 Ga0307410_10959805 3300031852 Bacteria 735
318 Ga0307410_10996593 3300031852 Bacteria 722
319 Ga0307406_10365892 3300031901 Bacteria 1132
320 Ga0307412_10000549 3300031911 Bacteria 22324
321 Ga0307412_10041548 3300031911 Bacteria 2981
322 Ga0307412_10425233 3300031911 Bacteria 1087
323 Ga0307416_100116106 3300032002 Bacteria 2372
324 Ga0307414_10814963 3300032004 Bacteria 852
325 Ga0307414_12252793 3300032004 Bacteria 509
326 Ga0307411_10964652 3300032005 Bacteria 761
327 Ga0307411_10999197 3300032005 Bacteria 749
328 Ga0316585_10028239 3300032137 Bacteria 1754
329 Ga0316580_10035081 3300032139 Bacteria 1552
330 Ga0307507_10167251 3300033179 Bacteria 1608
331 Ga0316592_1106644 3300033524 Bacteria 646
332 Ga0316596_1157217 3300033541 Bacteria 625
333 Ga0373934_0020125 3300035086 Bacteria 2565
334 Ga0373944_0313865 3300035089 Bacteria 590
335 Ga0373936_0056676 3300035113 Bacteria 1593
336 Ga0373954_0003745 3300035118 Bacteria 6484
337 Ga0373954_0223316 3300035118 Bacteria 927
338 Ga0373957_0036748 3300035120 Bacteria 1826
339 Ga0373943_0841500 3300035170 Bacteria 547
340 Ga0373955_0017110 3300035172 Bacteria 3581
341 Ga0373955_0133076 3300035172 Bacteria 1453
342 Ga0316574_0458075 3300035398 Bacteria 798
343 Ga0316574_0605156 3300035398 Unclassified 677
344 Ga0316574_0791465 3300035398 Bacteria 578
345 Ga0373924_0006176 3300035410 Bacteria 4283
346 Ga0373927_0238871 3300035695 Unclassified 1194
347 Ga0373927_0806139 3300035695 Unclassified 620
348 Ga0373933_0068067 3300035724 Bacteria 2162
349 Ga0373937_0015132 3300036401 Bacteria 6817
350 Ga0373937_0123959 3300036401 Bacteria 2409
351 Ga0373937_0515358 3300036401 Bacteria 1136
352 Ga0316582_0047091 3300036647 Bacteria 2721
353 Ga0316582_0092634 3300036647 Bacteria 1992
354 Ga0316582_0607769 3300036647 Unclassified 752
355 Ga0316581_0013021 3300037588 Bacteria 2353
356 Ga0400483_107877 3300039062 Bacteria 9585
357 Ga0436365_1211373 3300039437 Bacteria 3093
358 Ga0436365_1692091 3300039437 Bacteria 971
359 Ga0436360_0925588 3300039438 Bacteria 1473
360 Ga0436361_0753834 3300039447 Bacteria 2542
361 Ga0439436_0000022 3300041404 Bacteria 60408
362 Ga0439436_0050823 3300041404 Bacteria 1172
363 Ga0439465_0015525 3300041413 Bacteria 2376
364 Ga0451789_0620140 3300041443 Bacteria 1373
365 Ga0451789_0715167 3300041443 Bacteria 621
366 Ga0451791_0387075 3300041451 Bacteria 672
367 Ga0451793_1461656 3300041452 Unclassified 540
368 Ga0451797_0315433 3300041453 Bacteria 1440
369 Ga0451797_0358766 3300041453 Bacteria 638
370 Ga0451797_0951503 3300041453 Bacteria 660
371 Ga0451797_1369500 3300041453 Bacteria 652
372 Ga0451798_0562695 3300041458 Bacteria 720
373 Ga0451800_1434890 3300041459 Bacteria 1412
374 Ga0451802_0188506 3300041460 Bacteria 1664
375 Ga0451802_0760078 3300041460 Bacteria 516
376 Ga0451807_0115392 3300041486 Bacteria 4855
377 Ga0451807_0549023 3300041486 Bacteria 531
378 Ga0451807_2006261 3300041486 Bacteria 510
379 Ga0451807_2382850 3300041486 Bacteria 519
380 Ga0451807_2603317 3300041486 Bacteria 619
381 Ga0451833_1442070 3300041491 Bacteria 724
382 Ga0451837_0932555 3300041494 Bacteria 3555
383 Ga0451837_0937759 3300041494 Bacteria 840
384 Ga0451841_0133503 3300041498 Bacteria 558
385 Ga0451851_0246198 3300041507 Bacteria 756
386 Ga0451843_1635939 3300041509 Bacteria 569
387 Ga0451855_1120302 3300041511 Bacteria 667
388 Ga0451853_0680897 3300041512 Bacteria 841
389 Ga0451853_1187429 3300041512 Bacteria 693
390 Ga0451853_3841156 3300041512 Bacteria 575
391 Ga0450894_029594 3300042131 Bacteria 760
392 Ga0450908_000075 3300042184 Bacteria 19743
393 Ga0466982_0000037 3300044672 Bacteria 42622
394 Ga0466957_0066841 3300044842 Bacteria 2217
395 Ga0466960_0052483 3300044901 Bacteria 1973
396 Ga0466967_1660326 3300045976 Bacteria 636
397 Ga0495617_000420 3300046452 Bacteria 23121
398 Ga0495617_003578 3300046452 Bacteria 5811
399 Ga0495603_0209503 3300046455 Bacteria 1126
400 Ga0495591_002496 3300046458 Bacteria 10186
401 Ga0495629_0594455 3300046459 Bacteria 740
402 Ga0495638_0003699 3300046460 Bacteria 11903
403 Ga0495638_0531330 3300046460 Bacteria 588
404 Ga0495650_0000008 3300046471 Bacteria 688246
405 Ga0495650_0000562 3300046471 Bacteria 52583
406 Ga0495650_0058735 3300046471 Bacteria 1551
407 Ga0495582_0064794 3300046473 Bacteria 2018
408 Ga0495605_0027185 3300046474 Bacteria 2966
409 Ga0495639_0240454 3300046475 Bacteria 893
410 Ga0495584_0001715 3300046491 Bacteria 12832
411 Ga0495584_0010788 3300046491 Bacteria 4690
412 Ga0495585_0000200 3300046492 Bacteria 62445
413 Ga0495585_0001731 3300046492 Bacteria 16612
414 Ga0495607_0000178 3300046501 Bacteria 67386
415 Ga0495607_0000256 3300046501 Bacteria 57167
416 Ga0495607_0003984 3300046501 Bacteria 11101
417 Ga0495607_0009540 3300046501 Bacteria 6560
418 Ga0495607_0189857 3300046501 Bacteria 1024
419 Ga0495607_0313983 3300046501 Bacteria 733
420 Ga0495583_0002800 3300046506 Bacteria 14317
421 Ga0495606_0001619 3300046507 Bacteria 29382
422 Ga0495606_0001846 3300046507 Bacteria 26681
423 Ga0495606_0002611 3300046507 Bacteria 20602
424 Ga0495606_0019940 3300046507 Bacteria 4964
425 Ga0495606_0054526 3300046507 Bacteria 2589
426 Ga0495606_0120977 3300046507 Bacteria 1567
427 Ga0495610_0000341 3300046512 Bacteria 49154
428 Ga0495616_0000357 3300046513 Bacteria 35877
429 Ga0495616_0013102 3300046513 Bacteria 4688
430 Ga0495616_0022311 3300046513 Bacteria 3418
431 Ga0495620_0000150 3300046515 Bacteria 56486
432 Ga0495620_0000287 3300046515 Bacteria 36247
433 Ga0495631_0000257 3300046518 Bacteria 36879
434 Ga0495631_0000664 3300046518 Bacteria 22221
435 Ga0495631_0099291 3300046518 Bacteria 1253
436 Ga0495631_0245714 3300046518 Bacteria 763
437 Ga0495632_0000016 3300046519 Bacteria 232022
438 Ga0495632_0012122 3300046519 Bacteria 4986
439 Ga0495632_0331260 3300046519 Bacteria 671
440 Ga0495637_0006974 3300046520 Bacteria 5628
441 Ga0495643_0076134 3300046522 Bacteria 1755
442 Ga0495644_0040994 3300046523 Bacteria 1744
443 Ga0495648_0001786 3300046524 Bacteria 20692
444 Ga0495648_0013340 3300046524 Bacteria 6082
445 Ga0495648_0014184 3300046524 Bacteria 5846
446 Ga0495654_0000467 3300046530 Bacteria 33780
447 Ga0495587_0305599 3300046536 Bacteria 889
448 Ga0495609_0003864 3300046538 Bacteria 8418
449 Ga0495645_0062462 3300046543 Bacteria 2698
450 Ga0495668_0692630 3300046616 Bacteria 564
451 Ga0495611_0000001 3300046648 Bacteria 2628469
452 Ga0495611_0000044 3300046648 Bacteria 92551
453 Ga0495625_0000041 3300046660 Bacteria 206598
454 Ga0495625_0008315 3300046660 Bacteria 8864
455 Ga0495625_0069375 3300046660 Bacteria 2476
456 Ga0495635_0622866 3300046663 Bacteria 703
457 Ga0495661_0012895 3300046665 Bacteria 5632
458 Ga0495657_0749146 3300046675 Unclassified 560
459 Ga0495646_0460651 3300046680 Bacteria 656
460 Ga0495647_0017738 3300046681 Bacteria 2523
461 Ga0495658_0001223 3300046683 Bacteria 13482
462 Ga0495624_0338918 3300046690 Bacteria 905
463 Ga0495670_0003155 3300046691 Bacteria 8123
464 Ga0495670_0006364 3300046691 Bacteria 5799
465 Ga0495670_0176182 3300046691 Bacteria 1127
466 Ga0495671_0000303 3300046692 Bacteria 41634
467 Ga0495671_0009568 3300046692 Bacteria 5409
468 Ga0495649_0074074 3300046694 Bacteria 1824
469 Ga0495589_0000008 3300046794 Bacteria 266071
470 Ga0495589_0047433 3300046794 Bacteria 2129
471 Ga0495660_0000019 3300046810 Bacteria 311047
472 Ga0495660_0000231 3300046810 Bacteria 54997
473 Ga0495660_0004058 3300046810 Bacteria 8941
474 Ga0495604_0084443 3300047317 Bacteria 2371
475 Ga0495674_0535174 3300047319 Bacteria 934
476 Ga0495672_0000003 3300047320 Bacteria 728845
477 Ga0495672_0211098 3300047320 Bacteria 964
478 Ga0495676_0806357 3300047321 Bacteria 604
479 Ga0495680_0362925 3300047322 Bacteria 1006
480 Ga0495683_0000643 3300047323 Bacteria 25972
481 Ga0495683_0060141 3300047323 Bacteria 1883
482 Ga0495675_0798694 3300047444 Bacteria 522
483 Ga0495679_000004 3300047446 Bacteria 748056
484 Ga0495673_0000004 3300047469 Bacteria 1354526
485 Ga0495673_0000011 3300047469 Bacteria 674140
486 Ga0495673_0000041 3300047469 Bacteria 296723
487 Ga0495673_0005506 3300047469 Bacteria 7643
488 Ga0495681_0096407 3300047470 Bacteria 1299
489 Ga0495684_0350836 3300047471 Bacteria 1047
490 Ga0495686_0000108 3300047472 Bacteria 173579
491 Ga0495686_0004535 3300047472 Bacteria 11381
492 Ga0495686_0016087 3300047472 Bacteria 5083
493 Ga0495686_0171282 3300047472 Bacteria 1262
494 Ga0495686_0364558 3300047472 Bacteria 782
495 Ga0496102_0067734 3300048905 Bacteria 3275
496 Ga0496102_0290429 3300048905 Bacteria 1541
497 Ga0496103_0334375 3300048906 Bacteria 974
498 Ga0496104_0000058 3300048907 Bacteria 118768
499 Ga0496105_0000021 3300048908 Bacteria 164255
500 Ga0496106_0001787 3300048909 Bacteria 16065
501 Ga0496109_0641755 3300048912 Bacteria 999
502 Ga0496113_0845195 3300048916 Bacteria 726
503 Ga0496115_0000387 3300048918 Bacteria 36211
504 Ga0496116_0171293 3300048919 Bacteria 1176
505 Ga0496116_0240461 3300048919 Bacteria 910
506 Ga0496117_0015847 3300048920 Bacteria 6394
507 Ga0496117_0102518 3300048920 Bacteria 1806
508 Ga0496117_0158699 3300048920 Bacteria 1328
509 Ga0496118_0000169 3300048921 Bacteria 118190
510 Ga0496118_0003233 3300048921 Bacteria 20771
511 Ga0496118_0014200 3300048921 Bacteria 7469
512 Ga0496118_0025248 3300048921 Bacteria 5102
513 Ga0496118_0315544 3300048921 Bacteria 851
514 Ga0496119_0047913 3300048922 Bacteria 2654
515 Ga0496121_0000148 3300048924 Bacteria 154021
516 Ga0496121_0002094 3300048924 Bacteria 31439
517 Ga0496121_0004100 3300048924 Bacteria 19992
518 Ga0496121_0013648 3300048924 Bacteria 8709
519 Ga0496122_0023158 3300048925 Bacteria 5487
520 Ga0496122_0044436 3300048925 Bacteria 3467
521 Ga0496123_0016094 3300048926 Bacteria 6094
522 Ga0496123_0025676 3300048926 Bacteria 4433
523 Ga0496123_0038725 3300048926 Bacteria 3346
524 Ga0496124_0001854 3300048927 Bacteria 29197
525 Ga0496124_0014877 3300048927 Bacteria 7495
526 Ga0496124_0218364 3300048927 Bacteria 1436
527 Ga0496124_0285030 3300048927 Bacteria 1202
528 Ga0496126_0000835 3300048929 Bacteria 54796
529 Ga0496126_0392579 3300048929 Bacteria 1127
530 Ga0496126_0582909 3300048929 Bacteria 883
531 Ga0495678_000158 3300049459 Bacteria 81058
532 Ga0495678_000479 3300049459 Bacteria 39762
533 Ga0495682_0000006 3300049460 Bacteria 316373
534 Ga0495682_0002224 3300049460 Bacteria 9371
535 Ga0495682_0012087 3300049460 Bacteria 3317
536 Ga0501034_0340064 3300049571 Bacteria 1431
537 Ga0501047_0087722 3300049581 Bacteria 2989
538 Ga0501047_0522885 3300049581 Unclassified 1012
539 Ga0501067_0126310 3300049583 Bacteria 1423
540 Ga0501070_0375392 3300049586 Bacteria 1152
541 Ga0501071_0072307 3300049587 Unclassified 2515
542 Ga0501071_0877408 3300049587 Bacteria 692
543 Ga0501073_0018182 3300049589 Bacteria 5080
544 Ga0501073_0722615 3300049589 Bacteria 687
545 Ga0501075_0815359 3300049591 Unclassified 710
546 Ga0501077_0377743 3300049593 Bacteria 905
547 Ga0501080_0109945 3300049742 Bacteria 2554
548 Ga0501080_0280904 3300049742 Bacteria 1514
549 Ga0501083_0497734 3300049744 Unclassified 793
550 Ga0501035_0113464 3300049822 Bacteria 2374
551 Ga0501035_0200628 3300049822 Bacteria 1711
552 nmdc:mga03683_655392_c1 3300050489 Unclassified 517
553 nmdc:mga00v17_610761_c1 3300050491 Bacteria 703
554 nmdc:mga0k408_9218_c1 3300050493 Bacteria 5317
555 nmdc:mga09592_971813_c1 3300050508 Bacteria 711
556 nmdc:mga0sz30_5002_c1 3300050516 Bacteria 4525
557 Ga0500610_0013793 3300053079 Bacteria 3775
558 Ga0495595_0332093 3300053084 Bacteria 766
559 Ga0500643_000103 3300053087 Bacteria 87887
560 Ga0500566_0214342 3300053094 Bacteria 962
561 Ga0500555_000995 3300053103 Bacteria 9699
562 Ga0500614_026914 3300053123 Bacteria 1378
563 Ga0500621_000004 3300053126 Bacteria 485792
564 Ga0500652_152208 3300053131 Bacteria 959
565 Ga0500588_0225040 3300053146 Unclassified 700
566 Ga0500645_000741 3300053730 Bacteria 20060
567 Ga0501084_0274242 3300054114 Bacteria 1424
568 Ga0501084_1760045 3300054114 Unclassified 517
569 Ga0587072_149826 3300059643 Unclassified 562
570 Ga0466962_0656767 3300061719 Unclassified 536
571 Ga0530510_1150002 3300061734 Unclassified 595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0791465 Ga0316574_0791465_123_383 85
2 3300036647 Ga0316582_0607769 Ga0316582_0607769_416_676 85
3 3300037588 Ga0316581_0013021 Ga0316581_0013021_1720_1980 85
4 iso_pu_bacteria 2747842501 2748016456 85
5 3300026095 Ga0207676_12464087 Ga0207676_124640871 86
6 3300029957 Ga0265324_10060839 Ga0265324_100608392 86
7 3300031239 Ga0265328_10280302 Ga0265328_102803021 86
8 3300039438 Ga0436360_0925588 Ga0436360_0925588_450_713 86
9 3300039447 Ga0436361_0753834 Ga0436361_0753834_1721_1984 86
10 iso_pu_bacteria 2524614729 2525557115 86
11 iso_pu_bacteria 2593339238 2595447099 86
12 iso_pu_bacteria 2593339239 2595449857 86
13 iso_pu_bacteria 2627854209 2630648711 86
14 iso_pu_bacteria 2643221573 2643881643 86
15 iso_pu_bacteria 2643221720 2644662732 86
16 iso_pu_bacteria 2643221728 2644698314 86
17 iso_pu_bacteria 2718218334 2721026241 86
18 iso_pu_bacteria 2734482264 2735833783 86
19 iso_pu_bacteria 2818991440 2819564242 86
20 iso_pu_bacteria 2842914999 2842918127 86
21 iso_pu_bacteria 2842918807 2842920155 86
22 iso_pu_bacteria 2884338543 2884341771 86
23 iso_pu_bacteria 2904463128 2904464882 86
24 iso_pu_bacteria 2919085039 2919087477 86
25 iso_pu_bacteria 2919404418 2919406391 86
26 iso_pu_bacteria 2941471342 2941475461 86
27 iso_pu_bacteria 2953994433 2953995446 86
28 3300035086 Ga0373934_0020125 Ga0373934_0020125_944_1210 87
29 3300035118 Ga0373954_0003745 Ga0373954_0003745_1206_1472 87
30 3300035120 Ga0373957_0036748 Ga0373957_0036748_1442_1708 87
31 3300035172 Ga0373955_0017110 Ga0373955_0017110_1480_1746 87
32 3300035398 Ga0316574_0605156 Ga0316574_0605156_147_410 87
33 3300035410 Ga0373924_0006176 Ga0373924_0006176_1850_2116 87
34 3300035724 Ga0373933_0068067 Ga0373933_0068067_1057_1323 87
35 3300036401 Ga0373937_0015132 Ga0373937_0015132_1620_1886 87
36 3300036401 Ga0373937_0515358 Ga0373937_0515358_210_476 87
37 3300036647 Ga0316582_0092634 Ga0316582_0092634_18_281 87
38 3300046458 Ga0495591_002496 Ga0495591_002496_5058_5321 87
39 3300046491 Ga0495584_0010788 Ga0495584_0010788_614_877 87
40 3300046501 Ga0495607_0009540 Ga0495607_0009540_3737_4000 87
41 3300046501 Ga0495607_0189857 Ga0495607_0189857_433_702 87
42 3300046507 Ga0495606_0001619 Ga0495606_0001619_13805_14068 87
43 3300046507 Ga0495606_0001846 Ga0495606_0001846_23041_23310 87
44 3300046513 Ga0495616_0013102 Ga0495616_0013102_2495_2758 87
45 3300046518 Ga0495631_0099291 Ga0495631_0099291_134_403 87
46 3300046518 Ga0495631_0245714 Ga0495631_0245714_41_304 87
47 3300046522 Ga0495643_0076134 Ga0495643_0076134_1137_1400 87
48 3300046524 Ga0495648_0014184 Ga0495648_0014184_923_1186 87
49 3300046660 Ga0495625_0008315 Ga0495625_0008315_3785_4054 87
50 3300046675 Ga0495657_0749146 Ga0495657_0749146_96_362 87
51 3300046692 Ga0495671_0009568 Ga0495671_0009568_2583_2846 87
52 3300046794 Ga0495589_0047433 Ga0495589_0047433_889_1152 87
53 3300046810 Ga0495660_0000019 Ga0495660_0000019_62583_62846 87
54 3300047321 Ga0495676_0806357 Ga0495676_0806357_152_415 87
55 3300047323 Ga0495683_0060141 Ga0495683_0060141_682_945 87
56 3300047469 Ga0495673_0000011 Ga0495673_0000011_424944_425207 87
57 3300047472 Ga0495686_0364558 Ga0495686_0364558_134_403 87
58 3300048924 Ga0496121_0013648 Ga0496121_0013648_3021_3290 87
59 3300049459 Ga0495678_000479 Ga0495678_000479_25483_25746 87
60 3300049460 Ga0495682_0000006 Ga0495682_0000006_15782_16045 87
61 3300049581 Ga0501047_0522885 Ga0501047_0522885_261_524 87
62 3300053084 Ga0495595_0332093 Ga0495595_0332093_238_504 87
63 3300053126 Ga0500621_000004 Ga0500621_000004_236135_236398 87
64 3300003323 rootH1_10088254 rootH1_100882542 88
65 3300005367 Ga0070667_101146090 Ga0070667_1011460902 88
66 3300005563 Ga0068855_100311355 Ga0068855_1003113553 88
67 3300005617 Ga0068859_100138341 Ga0068859_1001383412 88
68 3300006931 Ga0097620_100138346 Ga0097620_1001383462 88
69 3300031616 Ga0307508_10230769 Ga0307508_102307693 88
70 3300031665 Ga0316575_10013285 Ga0316575_100132854 88
71 3300031691 Ga0316579_10017166 Ga0316579_100171662 88
72 3300031691 Ga0316579_10297809 Ga0316579_102978091 88
73 3300031727 Ga0316576_10152582 Ga0316576_101525822 88
74 3300031728 Ga0316578_10040118 Ga0316578_100401182 88
75 3300031730 Ga0307516_10002273 Ga0307516_1000227317 88
76 3300031733 Ga0316577_10007159 Ga0316577_100071594 88
77 3300032004 Ga0307414_10814963 Ga0307414_108149632 88
78 3300032137 Ga0316585_10028239 Ga0316585_100282393 88
79 3300032139 Ga0316580_10035081 Ga0316580_100350812 88
80 3300033524 Ga0316592_1106644 Ga0316592_11066442 88
81 3300033541 Ga0316596_1157217 Ga0316596_11572172 88
82 3300036647 Ga0316582_0047091 Ga0316582_0047091_1697_1966 88
83 3300039062 Ga0400483_107877 Ga0400483_107877_144_413 88
84 3300041443 Ga0451789_0620140 Ga0451789_0620140_895_1161 88
85 3300041453 Ga0451797_0315433 Ga0451797_0315433_833_1099 88
86 3300041453 Ga0451797_1369500 Ga0451797_1369500_16_282 88
87 3300041459 Ga0451800_1434890 Ga0451800_1434890_73_339 88
88 3300041460 Ga0451802_0188506 Ga0451802_0188506_321_587 88
89 3300041486 Ga0451807_0115392 Ga0451807_0115392_4258_4524 88
90 3300041491 Ga0451833_1442070 Ga0451833_1442070_141_407 88
91 3300041511 Ga0451855_1120302 Ga0451855_1120302_32_298 88
92 3300044901 Ga0466960_0052483 Ga0466960_0052483_443_709 88
93 3300049583 Ga0501067_0126310 Ga0501067_0126310_1004_1309 88
94 3300049589 Ga0501073_0722615 Ga0501073_0722615_362_628 88
95 3300049742 Ga0501080_0280904 Ga0501080_0280904_1178_1444 88
96 3300061719 Ga0466962_0656767 Ga0466962_0656767_232_522 88
97 3300003323 rootH1_10017453 rootH1_100174533 89
98 3300004798 Ga0058859_11615505 Ga0058859_116155051 89
99 3300004801 Ga0058860_12100890 Ga0058860_121008901 89
100 3300005338 Ga0068868_101308476 Ga0068868_1013084762 89
101 3300005343 Ga0070687_101018642 Ga0070687_1010186422 89
102 3300005441 Ga0070700_100997334 Ga0070700_1009973342 89
103 3300005459 Ga0068867_100557629 Ga0068867_1005576291 89
104 3300005466 Ga0070685_10025649 Ga0070685_100256493 89
105 3300005563 Ga0068855_100000078 Ga0068855_10000007858 89
106 3300005615 Ga0070702_100135199 Ga0070702_1001351993 89
107 3300005618 Ga0068864_102640006 Ga0068864_1026400061 89
108 3300005840 Ga0068870_10198846 Ga0068870_101988462 89
109 3300005841 Ga0068863_101491569 Ga0068863_1014915691 89
110 3300006048 Ga0075363_100109275 Ga0075363_1001092751 89
111 3300006195 Ga0075366_10017805 Ga0075366_100178055 89
112 3300006237 Ga0097621_100122229 Ga0097621_1001222293 89
113 3300006881 Ga0068865_100210062 Ga0068865_1002100622 89
114 3300009094 Ga0111539_10737058 Ga0111539_107370581 89
115 3300009094 Ga0111539_12511916 Ga0111539_125119162 89
116 3300009551 Ga0105238_12484495 Ga0105238_124844952 89
117 3300014969 Ga0157376_10049620 Ga0157376_100496205 89
118 3300020078 Ga0206352_10691753 Ga0206352_106917532 89
119 3300021384 Ga0213876_10437183 Ga0213876_104371832 89
120 3300025908 Ga0207643_10227401 Ga0207643_102274012 89
121 3300025941 Ga0207711_10829711 Ga0207711_108297112 89
122 3300025942 Ga0207689_10568554 Ga0207689_105685542 89
123 3300025949 Ga0207667_10000124 Ga0207667_1000012485 89
124 3300025981 Ga0207640_11436509 Ga0207640_114365092 89
125 3300026023 Ga0207677_10306264 Ga0207677_103062642 89
126 3300026095 Ga0207676_10756685 Ga0207676_107566851 89
127 3300028380 Ga0268265_11649230 Ga0268265_116492302 89
128 3300028794 Ga0307515_10624505 Ga0307515_106245051 89
129 3300031249 Ga0265339_10000061 Ga0265339_1000006166 89
130 3300031250 Ga0265331_10586799 Ga0265331_105867992 89
131 3300031344 Ga0265316_10000396 Ga0265316_1000039619 89
132 3300031548 Ga0307408_101447585 Ga0307408_1014475851 89
133 3300031711 Ga0265314_10000011 Ga0265314_10000011157 89
134 3300031731 Ga0307405_10979663 Ga0307405_109796631 89
135 3300031852 Ga0307410_10959805 Ga0307410_109598052 89
136 3300039437 Ga0436365_1211373 Ga0436365_1211373_1686_1955 89
137 3300041451 Ga0451791_0387075 Ga0451791_0387075_153_422 89
138 3300041452 Ga0451793_1461656 Ga0451793_1461656_187_456 89
139 3300041453 Ga0451797_0358766 Ga0451797_0358766_134_403 89
140 3300041453 Ga0451797_1369500 Ga0451797_1369500_369_638 89
141 3300041458 Ga0451798_0562695 Ga0451798_0562695_412_681 89
142 3300041486 Ga0451807_0549023 Ga0451807_0549023_142_411 89
143 3300041486 Ga0451807_2382850 Ga0451807_2382850_19_288 89
144 3300041494 Ga0451837_0937759 Ga0451837_0937759_133_402 89
145 3300041507 Ga0451851_0246198 Ga0451851_0246198_418_687 89
146 3300041509 Ga0451843_1635939 Ga0451843_1635939_196_465 89
147 3300041512 Ga0451853_1187429 Ga0451853_1187429_89_358 89
148 3300041512 Ga0451853_3841156 Ga0451853_3841156_97_366 89
149 3300047320 Ga0495672_0211098 Ga0495672_0211098_426_695 89
150 3300048918 Ga0496115_0000387 Ga0496115_0000387_7063_7332 89
151 3300048929 Ga0496126_0000835 Ga0496126_0000835_21413_21682 89
152 3300049581 Ga0501047_0087722 Ga0501047_0087722_1152_1460 89
153 3300049586 Ga0501070_0375392 Ga0501070_0375392_270_578 89
154 3300049587 Ga0501071_0072307 Ga0501071_0072307_215_484 89
155 3300049589 Ga0501073_0018182 Ga0501073_0018182_1283_1576 89
156 3300049591 Ga0501075_0815359 Ga0501075_0815359_11_280 89
157 3300049593 Ga0501077_0377743 Ga0501077_0377743_347_640 89
158 3300049742 Ga0501080_0109945 Ga0501080_0109945_2215_2484 89
159 3300049744 Ga0501083_0497734 Ga0501083_0497734_55_324 89
160 3300049822 Ga0501035_0113464 Ga0501035_0113464_1352_1621 89
161 3300050489 nmdc:mga03683_655392_c1 nmdc:mga03683_655392_c1_37_306 89
162 3300050491 nmdc:mga00v17_610761_c1 nmdc:mga00v17_610761_c1_364_633 89
163 3300050493 nmdc:mga0k408_9218_c1 nmdc:mga0k408_9218_c1_1338_1607 89
164 3300050508 nmdc:mga09592_971813_c1 nmdc:mga09592_971813_c1_332_601 89
165 3300053146 Ga0500588_0225040 Ga0500588_0225040_300_569 89
166 3300054114 Ga0501084_0274242 Ga0501084_0274242_1004_1273 89
167 3300054114 Ga0501084_1760045 Ga0501084_1760045_107_376 89
168 3300059643 Ga0587072_149826 Ga0587072_149826_245_514 89
169 3300001904 JGI24736J21556_1029647 JGI24736J21556_10296472 90
170 3300002737 JGI25162J39368_1020736 JGI25162J39368_10207361 90
171 3300002773 JGI25152J39213_1049024 JGI25152J39213_10490242 90
172 3300003214 JGI25165J46597_1008854 JGI25165J46597_10088542 90
173 3300003578 Ga0006562J51391_1099466 Ga0006562J51391_10994661 90
174 3300003856 Ga0058692_1005461 Ga0058692_10054612 90
175 3300004625 Ga0055543_1011606 Ga0055543_10116062 90
176 3300005262 Ga0065165_1000260 Ga0065165_100026015 90
177 3300005327 Ga0070658_10240707 Ga0070658_102407071 90
178 3300005327 Ga0070658_10413787 Ga0070658_104137872 90
179 3300005327 Ga0070658_11268747 Ga0070658_112687471 90
180 3300005328 Ga0070676_10466687 Ga0070676_104666872 90
181 3300005331 Ga0070670_100197512 Ga0070670_1001975122 90
182 3300005334 Ga0068869_100267896 Ga0068869_1002678962 90
183 3300005334 Ga0068869_100629881 Ga0068869_1006298812 90
184 3300005334 Ga0068869_101005301 Ga0068869_1010053012 90
185 3300005335 Ga0070666_10000742 Ga0070666_100007422 90
186 3300005335 Ga0070666_10072315 Ga0070666_100723152 90
187 3300005335 Ga0070666_10195517 Ga0070666_101955172 90
188 3300005338 Ga0068868_102145478 Ga0068868_1021454782 90
189 3300005340 Ga0070689_100917237 Ga0070689_1009172372 90
190 3300005344 Ga0070661_100089903 Ga0070661_1000899033 90
191 3300005344 Ga0070661_100364863 Ga0070661_1003648632 90
192 3300005347 Ga0070668_100125371 Ga0070668_1001253713 90
193 3300005347 Ga0070668_100297059 Ga0070668_1002970594 90
194 3300005347 Ga0070668_101039478 Ga0070668_1010394782 90
195 3300005353 Ga0070669_100280726 Ga0070669_1002807263 90
196 3300005354 Ga0070675_100276276 Ga0070675_1002762761 90
197 3300005355 Ga0070671_100829822 Ga0070671_1008298222 90
198 3300005356 Ga0070674_102081129 Ga0070674_1020811292 90
199 3300005364 Ga0070673_100187164 Ga0070673_1001871643 90
200 3300005365 Ga0070688_100094178 Ga0070688_1000941782 90
201 3300005367 Ga0070667_100855423 Ga0070667_1008554231 90
202 3300005367 Ga0070667_101815184 Ga0070667_1018151842 90
203 3300005455 Ga0070663_100527976 Ga0070663_1005279762 90
204 3300005455 Ga0070663_100656638 Ga0070663_1006566382 90
205 3300005455 Ga0070663_100811358 Ga0070663_1008113582 90
206 3300005456 Ga0070678_100412452 Ga0070678_1004124522 90
207 3300005457 Ga0070662_100094370 Ga0070662_1000943702 90
208 3300005457 Ga0070662_100107522 Ga0070662_1001075225 90
209 3300005459 Ga0068867_100282825 Ga0068867_1002828252 90
210 3300005459 Ga0068867_100468820 Ga0068867_1004688202 90
211 3300005466 Ga0070685_10000205 Ga0070685_1000020529 90
212 3300005466 Ga0070685_10527167 Ga0070685_105271672 90
213 3300005536 Ga0070697_100522567 Ga0070697_1005225672 90
214 3300005539 Ga0068853_100036621 Ga0068853_1000366211 90
215 3300005547 Ga0070693_100001735 Ga0070693_1000017355 90
216 3300005548 Ga0070665_100000326 Ga0070665_10000032653 90
217 3300005548 Ga0070665_102168627 Ga0070665_1021686271 90
218 3300005563 Ga0068855_100024697 Ga0068855_1000246974 90
219 3300005577 Ga0068857_100824830 Ga0068857_1008248302 90
220 3300005577 Ga0068857_100870366 Ga0068857_1008703662 90
221 3300005578 Ga0068854_100025225 Ga0068854_1000252252 90
222 3300005614 Ga0068856_100010035 Ga0068856_1000100358 90
223 3300005614 Ga0068856_100134763 Ga0068856_1001347632 90
224 3300005616 Ga0068852_100017329 Ga0068852_1000173292 90
225 3300005616 Ga0068852_100168879 Ga0068852_1001688792 90
226 3300005616 Ga0068852_100201958 Ga0068852_1002019582 90
227 3300005616 Ga0068852_100238973 Ga0068852_1002389732 90
228 3300005616 Ga0068852_100340245 Ga0068852_1003402452 90
229 3300005616 Ga0068852_100359881 Ga0068852_1003598812 90
230 3300005616 Ga0068852_101432808 Ga0068852_1014328082 90
231 3300005617 Ga0068859_100215218 Ga0068859_1002152183 90
232 3300005618 Ga0068864_101236888 Ga0068864_1012368882 90
233 3300005834 Ga0068851_10003057 Ga0068851_1000305710 90
234 3300005834 Ga0068851_10513861 Ga0068851_105138611 90
235 3300005840 Ga0068870_10503358 Ga0068870_105033582 90
236 3300005841 Ga0068863_100027548 Ga0068863_1000275487 90
237 3300005842 Ga0068858_100001013 Ga0068858_1000010139 90
238 3300005842 Ga0068858_100320312 Ga0068858_1003203122 90
239 3300005843 Ga0068860_100533507 Ga0068860_1005335072 90
240 3300006028 Ga0070717_10269813 Ga0070717_102698132 90
241 3300006186 Ga0075369_10029070 Ga0075369_100290702 90
242 3300006186 Ga0075369_10069143 Ga0075369_100691431 90
243 3300006237 Ga0097621_100189583 Ga0097621_1001895832 90
244 3300006237 Ga0097621_100547377 Ga0097621_1005473772 90
245 3300006237 Ga0097621_101714959 Ga0097621_1017149591 90
246 3300006358 Ga0068871_100042692 Ga0068871_1000426923 90
247 3300006358 Ga0068871_100081029 Ga0068871_1000810292 90
248 3300006358 Ga0068871_100173286 Ga0068871_1001732862 90
249 3300006358 Ga0068871_100443409 Ga0068871_1004434092 90
250 3300006881 Ga0068865_100004902 Ga0068865_1000049028 90
251 3300006881 Ga0068865_100857375 Ga0068865_1008573753 90
252 3300006931 Ga0097620_100215215 Ga0097620_1002152152 90
253 3300009093 Ga0105240_10000669 Ga0105240_1000066964 90
254 3300009093 Ga0105240_10483933 Ga0105240_104839332 90
255 3300009093 Ga0105240_11016058 Ga0105240_110160582 90
256 3300009098 Ga0105245_10260673 Ga0105245_102606732 90
257 3300009098 Ga0105245_10974587 Ga0105245_109745872 90
258 3300009101 Ga0105247_10069032 Ga0105247_100690325 90
259 3300009148 Ga0105243_11047576 Ga0105243_110475762 90
260 3300009174 Ga0105241_10011914 Ga0105241_100119144 90
261 3300009174 Ga0105241_10304357 Ga0105241_103043572 90
262 3300009176 Ga0105242_10119069 Ga0105242_101190692 90
263 3300009176 Ga0105242_10740788 Ga0105242_107407882 90
264 3300009176 Ga0105242_11655181 Ga0105242_116551812 90
265 3300009177 Ga0105248_11677650 Ga0105248_116776502 90
266 3300009545 Ga0105237_10196553 Ga0105237_101965532 90
267 3300009545 Ga0105237_10344685 Ga0105237_103446852 90
268 3300009545 Ga0105237_10488869 Ga0105237_104888692 90
269 3300009545 Ga0105237_11036382 Ga0105237_110363822 90
270 3300009545 Ga0105237_11831889 Ga0105237_118318891 90
271 3300009551 Ga0105238_10015295 Ga0105238_100152952 90
272 3300009551 Ga0105238_10035481 Ga0105238_100354816 90
273 3300009551 Ga0105238_10083466 Ga0105238_100834663 90
274 3300009551 Ga0105238_10335484 Ga0105238_103354842 90
275 3300009551 Ga0105238_10658459 Ga0105238_106584592 90
276 3300009551 Ga0105238_11385265 Ga0105238_113852651 90
277 3300009551 Ga0105238_12951911 Ga0105238_129519112 90
278 3300009553 Ga0105249_10011129 Ga0105249_100111292 90
279 3300010375 Ga0105239_10018464 Ga0105239_100184647 90
280 3300010375 Ga0105239_10180374 Ga0105239_101803742 90
281 3300010375 Ga0105239_10405167 Ga0105239_104051673 90
282 3300010375 Ga0105239_10942375 Ga0105239_109423751 90
283 3300011119 Ga0105246_12594422 Ga0105246_125944221 90
284 3300013104 Ga0157370_10026574 Ga0157370_100265744 90
285 3300013104 Ga0157370_10116048 Ga0157370_101160485 90
286 3300013104 Ga0157370_10153048 Ga0157370_101530483 90
287 3300013104 Ga0157370_10182816 Ga0157370_101828165 90
288 3300013104 Ga0157370_10455417 Ga0157370_104554172 90
289 3300013105 Ga0157369_10022557 Ga0157369_100225574 90
290 3300013105 Ga0157369_10110918 Ga0157369_101109184 90
291 3300013296 Ga0157374_10146969 Ga0157374_101469692 90
292 3300013296 Ga0157374_11060161 Ga0157374_110601612 90
293 3300013297 Ga0157378_10000158 Ga0157378_1000015830 90
294 3300013297 Ga0157378_10043597 Ga0157378_100435974 90
295 3300013297 Ga0157378_10918393 Ga0157378_109183932 90
296 3300013306 Ga0163162_10206003 Ga0163162_102060032 90
297 3300013307 Ga0157372_10121872 Ga0157372_101218722 90
298 3300013308 Ga0157375_10014871 Ga0157375_100148717 90
299 3300013308 Ga0157375_10389301 Ga0157375_103893012 90
300 3300013308 Ga0157375_10535464 Ga0157375_105354642 90
301 3300014325 Ga0163163_10000415 Ga0163163_1000041510 90
302 3300014325 Ga0163163_11517169 Ga0163163_115171692 90
303 3300014326 Ga0157380_10128383 Ga0157380_101283832 90
304 3300014326 Ga0157380_12909621 Ga0157380_129096212 90
305 3300014497 Ga0182008_10001870 Ga0182008_1000187010 90
306 3300014497 Ga0182008_10007165 Ga0182008_100071652 90
307 3300014497 Ga0182008_10538076 Ga0182008_105380762 90
308 3300014968 Ga0157379_11566227 Ga0157379_115662272 90
309 3300014969 Ga0157376_10007397 Ga0157376_100073975 90
310 3300014969 Ga0157376_10013837 Ga0157376_100138373 90
311 3300014969 Ga0157376_10220949 Ga0157376_102209492 90
312 3300015261 Ga0182006_1000148 Ga0182006_100014817 90
313 3300015261 Ga0182006_1000764 Ga0182006_100076418 90
314 3300015262 Ga0182007_10022089 Ga0182007_100220893 90
315 3300015262 Ga0182007_10149377 Ga0182007_101493772 90
316 3300015265 Ga0182005_1000138 Ga0182005_100013830 90
317 3300015265 Ga0182005_1000821 Ga0182005_10008212 90
318 3300015265 Ga0182005_1013927 Ga0182005_10139273 90
319 3300017792 Ga0163161_10013899 Ga0163161_100138996 90
320 3300020082 Ga0206353_10323706 Ga0206353_103237062 90
321 3300021384 Ga0213876_10370448 Ga0213876_103704482 90
322 3300025226 Ga0209674_100762 Ga0209674_1007625 90
323 3300025254 Ga0209148_1001376 Ga0209148_100137611 90
324 3300025258 Ga0209129_1002303 Ga0209129_10023033 90
325 3300025261 Ga0209233_1006128 Ga0209233_10061282 90
326 3300025299 Ga0209256_1011917 Ga0209256_10119173 90
327 3300025303 Ga0209051_1033416 Ga0209051_10334163 90
328 3300025304 Ga0209257_1004136 Ga0209257_10041364 90
329 3300025321 Ga0207656_10006516 Ga0207656_100065163 90
330 3300025321 Ga0207656_10217105 Ga0207656_102171052 90
331 3300025900 Ga0207710_10034219 Ga0207710_100342192 90
332 3300025900 Ga0207710_10216258 Ga0207710_102162582 90
333 3300025903 Ga0207680_10008110 Ga0207680_100081108 90
334 3300025903 Ga0207680_10028578 Ga0207680_100285784 90
335 3300025903 Ga0207680_10033449 Ga0207680_100334492 90
336 3300025903 Ga0207680_10342538 Ga0207680_103425382 90
337 3300025904 Ga0207647_10000008 Ga0207647_10000008107 90
338 3300025904 Ga0207647_10002496 Ga0207647_1000249610 90
339 3300025907 Ga0207645_10021426 Ga0207645_100214266 90
340 3300025908 Ga0207643_10534763 Ga0207643_105347631 90
341 3300025909 Ga0207705_10287724 Ga0207705_102877242 90
342 3300025909 Ga0207705_11472947 Ga0207705_114729471 90
343 3300025911 Ga0207654_10152482 Ga0207654_101524822 90
344 3300025911 Ga0207654_11086175 Ga0207654_110861752 90
345 3300025913 Ga0207695_10000014 Ga0207695_10000014322 90
346 3300025913 Ga0207695_10002028 Ga0207695_1000202822 90
347 3300025913 Ga0207695_10762853 Ga0207695_107628532 90
348 3300025920 Ga0207649_10126540 Ga0207649_101265403 90
349 3300025920 Ga0207649_10241097 Ga0207649_102410972 90
350 3300025920 Ga0207649_11121452 Ga0207649_111214522 90
351 3300025923 Ga0207681_10238971 Ga0207681_102389712 90
352 3300025924 Ga0207694_10005098 Ga0207694_1000509815 90
353 3300025924 Ga0207694_10007511 Ga0207694_100075118 90
354 3300025924 Ga0207694_10092650 Ga0207694_100926502 90
355 3300025924 Ga0207694_10123407 Ga0207694_101234071 90
356 3300025924 Ga0207694_10582258 Ga0207694_105822582 90
357 3300025925 Ga0207650_10040621 Ga0207650_100406214 90
358 3300025925 Ga0207650_11740392 Ga0207650_117403921 90
359 3300025926 Ga0207659_10297963 Ga0207659_102979632 90
360 3300025931 Ga0207644_10477187 Ga0207644_104771872 90
361 3300025931 Ga0207644_11349213 Ga0207644_113492131 90
362 3300025932 Ga0207690_11007956 Ga0207690_110079561 90
363 3300025933 Ga0207706_10006474 Ga0207706_100064748 90
364 3300025933 Ga0207706_10288932 Ga0207706_102889323 90
365 3300025934 Ga0207686_10032376 Ga0207686_100323761 90
366 3300025934 Ga0207686_11567228 Ga0207686_115672282 90
367 3300025935 Ga0207709_10324791 Ga0207709_103247914 90
368 3300025936 Ga0207670_10182421 Ga0207670_101824213 90
369 3300025938 Ga0207704_10015776 Ga0207704_100157762 90
370 3300025938 Ga0207704_10050293 Ga0207704_100502933 90
371 3300025938 Ga0207704_10092087 Ga0207704_100920872 90
372 3300025938 Ga0207704_11869776 Ga0207704_118697762 90
373 3300025940 Ga0207691_11470612 Ga0207691_114706122 90
374 3300025941 Ga0207711_11222579 Ga0207711_112225792 90
375 3300025942 Ga0207689_10148749 Ga0207689_101487492 90
376 3300025942 Ga0207689_10175680 Ga0207689_101756802 90
377 3300025942 Ga0207689_10407809 Ga0207689_104078092 90
378 3300025945 Ga0207679_11754773 Ga0207679_117547732 90
379 3300025949 Ga0207667_10089902 Ga0207667_100899024 90
380 3300025949 Ga0207667_10233666 Ga0207667_102336663 90
381 3300025961 Ga0207712_10007905 Ga0207712_100079057 90
382 3300025972 Ga0207668_10443731 Ga0207668_104437312 90
383 3300025972 Ga0207668_10569931 Ga0207668_105699313 90
384 3300025981 Ga0207640_10207846 Ga0207640_102078462 90
385 3300025981 Ga0207640_10908364 Ga0207640_109083642 90
386 3300025986 Ga0207658_10145265 Ga0207658_101452652 90
387 3300025986 Ga0207658_10146137 Ga0207658_101461372 90
388 3300025986 Ga0207658_10181618 Ga0207658_101816184 90
389 3300025986 Ga0207658_11293452 Ga0207658_112934521 90
390 3300026023 Ga0207677_10639727 Ga0207677_106397272 90
391 3300026023 Ga0207677_10667596 Ga0207677_106675962 90
392 3300026035 Ga0207703_10002988 Ga0207703_100029889 90
393 3300026035 Ga0207703_10265457 Ga0207703_102654572 90
394 3300026041 Ga0207639_10000398 Ga0207639_1000039817 90
395 3300026041 Ga0207639_11699959 Ga0207639_116999592 90
396 3300026041 Ga0207639_11962518 Ga0207639_119625181 90
397 3300026067 Ga0207678_10140849 Ga0207678_101408492 90
398 3300026067 Ga0207678_10244971 Ga0207678_102449712 90
399 3300026067 Ga0207678_11792618 Ga0207678_117926181 90
400 3300026078 Ga0207702_10016655 Ga0207702_100166553 90
401 3300026078 Ga0207702_10022797 Ga0207702_100227974 90
402 3300026078 Ga0207702_10942821 Ga0207702_109428212 90
403 3300026078 Ga0207702_11865032 Ga0207702_118650322 90
404 3300026088 Ga0207641_10064699 Ga0207641_100646993 90
405 3300026089 Ga0207648_10078882 Ga0207648_100788823 90
406 3300026089 Ga0207648_10142765 Ga0207648_101427652 90
407 3300026089 Ga0207648_10158841 Ga0207648_101588412 90
408 3300026095 Ga0207676_11196605 Ga0207676_111966052 90
409 3300026116 Ga0207674_10149424 Ga0207674_101494242 90
410 3300026142 Ga0207698_10015225 Ga0207698_100152252 90
411 3300026142 Ga0207698_10095932 Ga0207698_100959322 90
412 3300026142 Ga0207698_10502424 Ga0207698_105024242 90
413 3300026142 Ga0207698_10532968 Ga0207698_105329682 90
414 3300026142 Ga0207698_11409804 Ga0207698_114098041 90
415 3300026142 Ga0207698_11435345 Ga0207698_114353452 90
416 3300026142 Ga0207698_11794506 Ga0207698_117945061 90
417 3300028379 Ga0268266_10000013 Ga0268266_1000001359 90
418 3300028379 Ga0268266_10993599 Ga0268266_109935992 90
419 3300028381 Ga0268264_10319828 Ga0268264_103198283 90
420 3300031507 Ga0307509_10148769 Ga0307509_101487693 90
421 3300031548 Ga0307408_100520887 Ga0307408_1005208872 90
422 3300031616 Ga0307508_10390884 Ga0307508_103908842 90
423 3300031616 Ga0307508_10608490 Ga0307508_106084902 90
424 3300031730 Ga0307516_10016196 Ga0307516_100161962 90
425 3300031731 Ga0307405_10376174 Ga0307405_103761742 90
426 3300031733 Ga0316577_10106903 Ga0316577_101069032 90
427 3300031733 Ga0316577_10738316 Ga0316577_107383162 90
428 3300031824 Ga0307413_10303509 Ga0307413_103035092 90
429 3300031838 Ga0307518_10434202 Ga0307518_104342022 90
430 3300031852 Ga0307410_10996593 Ga0307410_109965932 90
431 3300031901 Ga0307406_10365892 Ga0307406_103658922 90
432 3300031911 Ga0307412_10000549 Ga0307412_100005493 90
433 3300031911 Ga0307412_10041548 Ga0307412_100415484 90
434 3300031911 Ga0307412_10425233 Ga0307412_104252332 90
435 3300032002 Ga0307416_100116106 Ga0307416_1001161063 90
436 3300032004 Ga0307414_12252793 Ga0307414_122527932 90
437 3300032005 Ga0307411_10964652 Ga0307411_109646522 90
438 3300032005 Ga0307411_10999197 Ga0307411_109991972 90
439 3300033179 Ga0307507_10167251 Ga0307507_101672512 90
440 3300035089 Ga0373944_0313865 Ga0373944_0313865_85_357 90
441 3300035113 Ga0373936_0056676 Ga0373936_0056676_669_941 90
442 3300035118 Ga0373954_0223316 Ga0373954_0223316_493_765 90
443 3300035170 Ga0373943_0841500 Ga0373943_0841500_20_292 90
444 3300035172 Ga0373955_0133076 Ga0373955_0133076_675_947 90
445 3300035398 Ga0316574_0458075 Ga0316574_0458075_109_381 90
446 3300035695 Ga0373927_0238871 Ga0373927_0238871_325_597 90
447 3300035695 Ga0373927_0806139 Ga0373927_0806139_150_425 90
448 3300036401 Ga0373937_0123959 Ga0373937_0123959_784_1056 90
449 3300039437 Ga0436365_1692091 Ga0436365_1692091_305_577 90
450 3300041404 Ga0439436_0000022 Ga0439436_0000022_5283_5561 90
451 3300041404 Ga0439436_0050823 Ga0439436_0050823_108_386 90
452 3300041413 Ga0439465_0015525 Ga0439465_0015525_353_631 90
453 3300041443 Ga0451789_0715167 Ga0451789_0715167_209_481 90
454 3300041453 Ga0451797_0951503 Ga0451797_0951503_323_598 90
455 3300041460 Ga0451802_0760078 Ga0451802_0760078_113_385 90
456 3300041486 Ga0451807_2006261 Ga0451807_2006261_109_381 90
457 3300041486 Ga0451807_2603317 Ga0451807_2603317_50_355 90
458 3300041494 Ga0451837_0932555 Ga0451837_0932555_3116_3391 90
459 3300041498 Ga0451841_0133503 Ga0451841_0133503_212_487 90
460 3300041512 Ga0451853_0680897 Ga0451853_0680897_310_624 90
461 3300042131 Ga0450894_029594 Ga0450894_029594_301_579 90
462 3300042184 Ga0450908_000075 Ga0450908_000075_10801_11079 90
463 3300044672 Ga0466982_0000037 Ga0466982_0000037_41742_42020 90
464 3300044842 Ga0466957_0066841 Ga0466957_0066841_497_775 90
465 3300045976 Ga0466967_1660326 Ga0466967_1660326_180_452 90
466 3300046452 Ga0495617_000420 Ga0495617_000420_5326_5604 90
467 3300046452 Ga0495617_003578 Ga0495617_003578_153_431 90
468 3300046455 Ga0495603_0209503 Ga0495603_0209503_193_465 90
469 3300046459 Ga0495629_0594455 Ga0495629_0594455_100_372 90
470 3300046460 Ga0495638_0003699 Ga0495638_0003699_6039_6317 90
471 3300046460 Ga0495638_0531330 Ga0495638_0531330_36_314 90
472 3300046471 Ga0495650_0000008 Ga0495650_0000008_438907_439179 90
473 3300046471 Ga0495650_0000562 Ga0495650_0000562_26721_26999 90
474 3300046471 Ga0495650_0058735 Ga0495650_0058735_356_634 90
475 3300046473 Ga0495582_0064794 Ga0495582_0064794_1449_1721 90
476 3300046474 Ga0495605_0027185 Ga0495605_0027185_254_532 90
477 3300046475 Ga0495639_0240454 Ga0495639_0240454_142_414 90
478 3300046491 Ga0495584_0001715 Ga0495584_0001715_4678_4956 90
479 3300046492 Ga0495585_0000200 Ga0495585_0000200_5219_5497 90
480 3300046492 Ga0495585_0001731 Ga0495585_0001731_3415_3693 90
481 3300046501 Ga0495607_0000178 Ga0495607_0000178_17588_17866 90
482 3300046501 Ga0495607_0000256 Ga0495607_0000256_40348_40626 90
483 3300046501 Ga0495607_0003984 Ga0495607_0003984_2202_2480 90
484 3300046501 Ga0495607_0313983 Ga0495607_0313983_422_700 90
485 3300046506 Ga0495583_0002800 Ga0495583_0002800_344_622 90
486 3300046507 Ga0495606_0002611 Ga0495606_0002611_3339_3617 90
487 3300046507 Ga0495606_0019940 Ga0495606_0019940_2149_2427 90
488 3300046507 Ga0495606_0054526 Ga0495606_0054526_209_487 90
489 3300046507 Ga0495606_0120977 Ga0495606_0120977_220_498 90
490 3300046512 Ga0495610_0000341 Ga0495610_0000341_25334_25612 90
491 3300046513 Ga0495616_0000357 Ga0495616_0000357_18588_18866 90
492 3300046513 Ga0495616_0022311 Ga0495616_0022311_2033_2311 90
493 3300046515 Ga0495620_0000150 Ga0495620_0000150_47133_47411 90
494 3300046515 Ga0495620_0000287 Ga0495620_0000287_17249_17527 90
495 3300046518 Ga0495631_0000257 Ga0495631_0000257_18075_18353 90
496 3300046518 Ga0495631_0000664 Ga0495631_0000664_5888_6166 90
497 3300046519 Ga0495632_0000016 Ga0495632_0000016_172861_173139 90
498 3300046519 Ga0495632_0012122 Ga0495632_0012122_292_570 90
499 3300046519 Ga0495632_0331260 Ga0495632_0331260_248_526 90
500 3300046520 Ga0495637_0006974 Ga0495637_0006974_194_472 90
501 3300046523 Ga0495644_0040994 Ga0495644_0040994_1269_1541 90
502 3300046524 Ga0495648_0001786 Ga0495648_0001786_5069_5347 90
503 3300046524 Ga0495648_0013340 Ga0495648_0013340_632_910 90
504 3300046530 Ga0495654_0000467 Ga0495654_0000467_33245_33517 90
505 3300046536 Ga0495587_0305599 Ga0495587_0305599_198_470 90
506 3300046538 Ga0495609_0003864 Ga0495609_0003864_5074_5352 90
507 3300046543 Ga0495645_0062462 Ga0495645_0062462_1758_2030 90
508 3300046616 Ga0495668_0692630 Ga0495668_0692630_229_507 90
509 3300046648 Ga0495611_0000001 Ga0495611_0000001_2493058_2493336 90
510 3300046648 Ga0495611_0000044 Ga0495611_0000044_5872_6150 90
511 3300046660 Ga0495625_0000041 Ga0495625_0000041_166558_166836 90
512 3300046660 Ga0495625_0069375 Ga0495625_0069375_1851_2129 90
513 3300046663 Ga0495635_0622866 Ga0495635_0622866_380_652 90
514 3300046665 Ga0495661_0012895 Ga0495661_0012895_110_388 90
515 3300046680 Ga0495646_0460651 Ga0495646_0460651_124_396 90
516 3300046681 Ga0495647_0017738 Ga0495647_0017738_1286_1558 90
517 3300046683 Ga0495658_0001223 Ga0495658_0001223_1475_1747 90
518 3300046690 Ga0495624_0338918 Ga0495624_0338918_445_717 90
519 3300046691 Ga0495670_0003155 Ga0495670_0003155_5196_5474 90
520 3300046691 Ga0495670_0006364 Ga0495670_0006364_2218_2496 90
521 3300046691 Ga0495670_0176182 Ga0495670_0176182_214_492 90
522 3300046692 Ga0495671_0000303 Ga0495671_0000303_35736_36014 90
523 3300046694 Ga0495649_0074074 Ga0495649_0074074_845_1123 90
524 3300046794 Ga0495589_0000008 Ga0495589_0000008_134590_134868 90
525 3300046810 Ga0495660_0000231 Ga0495660_0000231_48724_49002 90
526 3300046810 Ga0495660_0004058 Ga0495660_0004058_4237_4515 90
527 3300047317 Ga0495604_0084443 Ga0495604_0084443_587_859 90
528 3300047319 Ga0495674_0535174 Ga0495674_0535174_50_322 90
529 3300047320 Ga0495672_0000003 Ga0495672_0000003_281001_281273 90
530 3300047322 Ga0495680_0362925 Ga0495680_0362925_343_615 90
531 3300047323 Ga0495683_0000643 Ga0495683_0000643_6856_7134 90
532 3300047444 Ga0495675_0798694 Ga0495675_0798694_198_470 90
533 3300047446 Ga0495679_000004 Ga0495679_000004_603830_604108 90
534 3300047469 Ga0495673_0000004 Ga0495673_0000004_429255_429533 90
535 3300047469 Ga0495673_0000041 Ga0495673_0000041_40467_40745 90
536 3300047469 Ga0495673_0005506 Ga0495673_0005506_2305_2583 90
537 3300047470 Ga0495681_0096407 Ga0495681_0096407_69_347 90
538 3300047471 Ga0495684_0350836 Ga0495684_0350836_583_855 90
539 3300047472 Ga0495686_0000108 Ga0495686_0000108_96824_97102 90
540 3300047472 Ga0495686_0004535 Ga0495686_0004535_4442_4720 90
541 3300047472 Ga0495686_0016087 Ga0495686_0016087_308_586 90
542 3300047472 Ga0495686_0171282 Ga0495686_0171282_221_499 90
543 3300048905 Ga0496102_0067734 Ga0496102_0067734_921_1193 90
544 3300048905 Ga0496102_0290429 Ga0496102_0290429_1064_1342 90
545 3300048906 Ga0496103_0334375 Ga0496103_0334375_232_504 90
546 3300048907 Ga0496104_0000058 Ga0496104_0000058_61109_61381 90
547 3300048908 Ga0496105_0000021 Ga0496105_0000021_4183_4455 90
548 3300048909 Ga0496106_0001787 Ga0496106_0001787_15050_15328 90
549 3300048912 Ga0496109_0641755 Ga0496109_0641755_533_811 90
550 3300048916 Ga0496113_0845195 Ga0496113_0845195_366_644 90
551 3300048919 Ga0496116_0171293 Ga0496116_0171293_856_1134 90
552 3300048919 Ga0496116_0240461 Ga0496116_0240461_283_561 90
553 3300048920 Ga0496117_0015847 Ga0496117_0015847_4540_4818 90
554 3300048920 Ga0496117_0102518 Ga0496117_0102518_817_1095 90
555 3300048920 Ga0496117_0158699 Ga0496117_0158699_870_1145 90
556 3300048921 Ga0496118_0000169 Ga0496118_0000169_31670_31948 90
557 3300048921 Ga0496118_0003233 Ga0496118_0003233_4514_4792 90
558 3300048921 Ga0496118_0014200 Ga0496118_0014200_2088_2360 90
559 3300048921 Ga0496118_0025248 Ga0496118_0025248_1049_1324 90
560 3300048921 Ga0496118_0315544 Ga0496118_0315544_515_793 90
561 3300048922 Ga0496119_0047913 Ga0496119_0047913_12_290 90
562 3300048924 Ga0496121_0000148 Ga0496121_0000148_113602_113880 90
563 3300048924 Ga0496121_0002094 Ga0496121_0002094_26684_26962 90
564 3300048924 Ga0496121_0004100 Ga0496121_0004100_3997_4275 90
565 3300048925 Ga0496122_0023158 Ga0496122_0023158_1928_2206 90
566 3300048925 Ga0496122_0044436 Ga0496122_0044436_753_1031 90
567 3300048926 Ga0496123_0016094 Ga0496123_0016094_4608_4886 90
568 3300048926 Ga0496123_0025676 Ga0496123_0025676_3003_3281 90
569 3300048926 Ga0496123_0038725 Ga0496123_0038725_3000_3278 90
570 3300048927 Ga0496124_0001854 Ga0496124_0001854_4589_4867 90
571 3300048927 Ga0496124_0014877 Ga0496124_0014877_4607_4885 90
572 3300048927 Ga0496124_0218364 Ga0496124_0218364_1094_1372 90
573 3300048927 Ga0496124_0285030 Ga0496124_0285030_178_456 90
574 3300048929 Ga0496126_0392579 Ga0496126_0392579_174_452 90
575 3300048929 Ga0496126_0582909 Ga0496126_0582909_365_643 90
576 3300049459 Ga0495678_000158 Ga0495678_000158_5213_5491 90
577 3300049460 Ga0495682_0002224 Ga0495682_0002224_4658_4936 90
578 3300049460 Ga0495682_0012087 Ga0495682_0012087_1035_1313 90
579 3300049571 Ga0501034_0340064 Ga0501034_0340064_510_785 90
580 3300049587 Ga0501071_0877408 Ga0501071_0877408_238_510 90
581 3300049822 Ga0501035_0200628 Ga0501035_0200628_440_715 90
582 3300050516 nmdc:mga0sz30_5002_c1 nmdc:mga0sz30_5002_c1_2836_3114 90
583 3300053079 Ga0500610_0013793 Ga0500610_0013793_56_328 90
584 3300053087 Ga0500643_000103 Ga0500643_000103_79332_79610 90
585 3300053094 Ga0500566_0214342 Ga0500566_0214342_236_508 90
586 3300053103 Ga0500555_000995 Ga0500555_000995_1183_1461 90
587 3300053123 Ga0500614_026914 Ga0500614_026914_303_575 90
588 3300053131 Ga0500652_152208 Ga0500652_152208_40_318 90
589 3300053730 Ga0500645_000741 Ga0500645_000741_1118_1396 90
590 3300061734 Ga0530510_1150002 Ga0530510_1150002_235_507 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04362

Iron_traffic

Bacterial Fe(2+) trafficking

15

102

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t07-assembly1.cif.gz_A crystal structure of conserved protein of unknown function pa5148 from pseudomonas aeruginosa 0.8888 1 76
1t07-assembly1.cif.gz_A crystal structure of conserved protein of unknown function pa5148 from pseudomonas aeruginosa 0.8295 1 76
1yhd-assembly1.cif.gz_A the solution structure of yggx from escherichia coli 0.7882 2 89
1yhd-assembly1.cif.gz_A the solution structure of yggx from escherichia coli 0.7643 2 89
1xs8-assembly1.cif.gz_A solution structure of yggx protein of salmonella enterica 0.7396 1 89
ID Description Score Start End Superfamily
1yhdA01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8994 2 73 1.10.3880.10
1t07A00 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8928 2 76 1.10.3880.10
1yhdA01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8561 2 73 1.10.3880.10
1xs8A01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8448 1 75 1.10.3880.10
1xs8A01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.835 1 75 1.10.3880.10
ID Description Score Start End GO Terms
AF-A0A1G0CTM2-F1-model_v4 Oxidative damage protection protein 0.9972 1 55 GO:0005506
GO:0005829
GO:0034599
AF-A0A2V9Z5R6-F1-model_v4 Oxidative damage protection protein 0.9963 2 49 GO:0005506
GO:0005829
GO:0034599
AF-A0A357N4F9-F1-model_v4 Oxidative damage protection protein 0.9958 1 50 GO:0005506
GO:0005829
GO:0034599
AF-A0A356IL84-F1-model_v4 Oxidative damage protection protein 0.995 1 50 GO:0005506
GO:0005829
GO:0034599
AF-A0A7V5PHP1-F1-model_v4 Oxidative damage protection protein 0.9948 1 39 GO:0005506
GO:0005829
GO:0034599

Feature Viewer

pLDDT pTM Quality
80.55 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map