F466989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 334 | 571 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_0680897|Ga0451853_0680897_310_624 |
| Length | 104 |
| Sequence | MSTISDTRTAPENTMTRTVHCIKLGRDAEGLAFVPWPGELGKRVFESVSKEAWSQWLAHQTMLINENRLSPLDPKHRAFLQAEMEKYFFGEGSAAPAGYVAPDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 7 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 8 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 9 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 10 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 11 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 12 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 13 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 14 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 15 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 16 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 17 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 18 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 19 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 20 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 21 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 29 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 171 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 187 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 188 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 189 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 205 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 208 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 211 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 224 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 227 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 228 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 324 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 327 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 328 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 329 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.42 |
| Metatranscriptomes | 1.36 |
| Isolates | 3.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 0 |
| Rhizoplane | 4.58 |
| Rhizosphere | 78.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1029647 | 3300001904 | Bacteria | 846 |
| 2 | JGI25162J39368_1020736 | 3300002737 | Bacteria | 616 |
| 3 | JGI25152J39213_1049024 | 3300002773 | Bacteria | 558 |
| 4 | JGI25165J46597_1008854 | 3300003214 | Bacteria | 1549 |
| 5 | rootH1_10017453 | 3300003316 | Bacteria | 6082 |
| 6 | rootH1_10017453 | 3300003323 | Bacteria | 1575 |
| 7 | rootH1_10088254 | 3300003323 | Bacteria | 1738 |
| 8 | Ga0006562J51391_1099466 | 3300003578 | Bacteria | 9300 |
| 9 | Ga0058692_1005461 | 3300003856 | Bacteria | 3621 |
| 10 | Ga0055543_1011606 | 3300004625 | Bacteria | 1796 |
| 11 | Ga0058859_11615505 | 3300004798 | Bacteria | 550 |
| 12 | Ga0058860_12100890 | 3300004801 | Bacteria | 566 |
| 13 | Ga0065165_1000260 | 3300005262 | Bacteria | 90953 |
| 14 | Ga0070658_10240707 | 3300005327 | Bacteria | 1534 |
| 15 | Ga0070658_10413787 | 3300005327 | Bacteria | 1159 |
| 16 | Ga0070658_11268747 | 3300005327 | Bacteria | 640 |
| 17 | Ga0070676_10466687 | 3300005328 | Bacteria | 890 |
| 18 | Ga0070670_100197512 | 3300005331 | Bacteria | 1748 |
| 19 | Ga0068869_100267896 | 3300005334 | Bacteria | 1369 |
| 20 | Ga0068869_100629881 | 3300005334 | Bacteria | 909 |
| 21 | Ga0068869_101005301 | 3300005334 | Bacteria | 726 |
| 22 | Ga0070666_10000742 | 3300005335 | Bacteria | 19747 |
| 23 | Ga0070666_10072315 | 3300005335 | Bacteria | 2348 |
| 24 | Ga0070666_10195517 | 3300005335 | Bacteria | 1422 |
| 25 | Ga0068868_101308476 | 3300005338 | Bacteria | 673 |
| 26 | Ga0068868_102145478 | 3300005338 | Bacteria | 532 |
| 27 | Ga0070689_100917237 | 3300005340 | Bacteria | 776 |
| 28 | Ga0070687_101018642 | 3300005343 | Bacteria | 601 |
| 29 | Ga0070661_100089903 | 3300005344 | Bacteria | 2274 |
| 30 | Ga0070661_100364863 | 3300005344 | Bacteria | 1136 |
| 31 | Ga0070668_100125371 | 3300005347 | Bacteria | 2056 |
| 32 | Ga0070668_100297059 | 3300005347 | Bacteria | 1354 |
| 33 | Ga0070668_101039478 | 3300005347 | Unclassified | 737 |
| 34 | Ga0070669_100280726 | 3300005353 | Bacteria | 1334 |
| 35 | Ga0070675_100276276 | 3300005354 | Bacteria | 1475 |
| 36 | Ga0070671_100829822 | 3300005355 | Bacteria | 806 |
| 37 | Ga0070674_102081129 | 3300005356 | Bacteria | 518 |
| 38 | Ga0070673_100187164 | 3300005364 | Bacteria | 1776 |
| 39 | Ga0070688_100094178 | 3300005365 | Bacteria | 1963 |
| 40 | Ga0070667_100855423 | 3300005367 | Bacteria | 845 |
| 41 | Ga0070667_101146090 | 3300005367 | Unclassified | 727 |
| 42 | Ga0070667_101815184 | 3300005367 | Bacteria | 574 |
| 43 | Ga0070700_100997334 | 3300005441 | Bacteria | 688 |
| 44 | Ga0070663_100527976 | 3300005455 | Bacteria | 983 |
| 45 | Ga0070663_100656638 | 3300005455 | Bacteria | 887 |
| 46 | Ga0070663_100811358 | 3300005455 | Bacteria | 803 |
| 47 | Ga0070678_100412452 | 3300005456 | Bacteria | 1176 |
| 48 | Ga0070662_100094370 | 3300005457 | Bacteria | 2252 |
| 49 | Ga0070662_100107522 | 3300005457 | Bacteria | 2120 |
| 50 | Ga0068867_100282825 | 3300005459 | Bacteria | 1361 |
| 51 | Ga0068867_100468820 | 3300005459 | Bacteria | 1076 |
| 52 | Ga0068867_100557629 | 3300005459 | Bacteria | 993 |
| 53 | Ga0070685_10000205 | 3300005466 | Bacteria | 39689 |
| 54 | Ga0070685_10025649 | 3300005466 | Bacteria | 3245 |
| 55 | Ga0070685_10527167 | 3300005466 | Bacteria | 840 |
| 56 | Ga0070697_100522567 | 3300005536 | Bacteria | 1039 |
| 57 | Ga0068853_100036621 | 3300005539 | Bacteria | 4174 |
| 58 | Ga0070693_100001735 | 3300005547 | Bacteria | 9913 |
| 59 | Ga0070665_100000326 | 3300005548 | Bacteria | 73416 |
| 60 | Ga0070665_102168627 | 3300005548 | Bacteria | 560 |
| 61 | Ga0068855_100000078 | 3300005563 | Bacteria | 117458 |
| 62 | Ga0068855_100024697 | 3300005563 | Bacteria | 7189 |
| 63 | Ga0068855_100311355 | 3300005563 | Bacteria | 1742 |
| 64 | Ga0068857_100824830 | 3300005577 | Bacteria | 886 |
| 65 | Ga0068857_100870366 | 3300005577 | Bacteria | 863 |
| 66 | Ga0068854_100025225 | 3300005578 | Bacteria | 4079 |
| 67 | Ga0068856_100010035 | 3300005614 | Bacteria | 9197 |
| 68 | Ga0068856_100134763 | 3300005614 | Bacteria | 2475 |
| 69 | Ga0070702_100135199 | 3300005615 | Bacteria | 1563 |
| 70 | Ga0068852_100017329 | 3300005616 | Bacteria | 5649 |
| 71 | Ga0068852_100168879 | 3300005616 | Bacteria | 2049 |
| 72 | Ga0068852_100201958 | 3300005616 | Bacteria | 1881 |
| 73 | Ga0068852_100238973 | 3300005616 | Bacteria | 1735 |
| 74 | Ga0068852_100340245 | 3300005616 | Bacteria | 1462 |
| 75 | Ga0068852_100359881 | 3300005616 | Bacteria | 1423 |
| 76 | Ga0068852_101432808 | 3300005616 | Bacteria | 713 |
| 77 | Ga0068859_100138341 | 3300005617 | Bacteria | 2509 |
| 78 | Ga0068859_100215218 | 3300005617 | Bacteria | 2008 |
| 79 | Ga0068864_101236888 | 3300005618 | Bacteria | 746 |
| 80 | Ga0068864_102640006 | 3300005618 | Bacteria | 508 |
| 81 | Ga0068851_10003057 | 3300005834 | Bacteria | 7400 |
| 82 | Ga0068851_10513861 | 3300005834 | Bacteria | 720 |
| 83 | Ga0068870_10198846 | 3300005840 | Bacteria | 1214 |
| 84 | Ga0068870_10503358 | 3300005840 | Bacteria | 808 |
| 85 | Ga0068863_100027548 | 3300005841 | Bacteria | 5421 |
| 86 | Ga0068863_101491569 | 3300005841 | Bacteria | 685 |
| 87 | Ga0068858_100001013 | 3300005842 | Bacteria | 28969 |
| 88 | Ga0068858_100320312 | 3300005842 | Bacteria | 1482 |
| 89 | Ga0068860_100533507 | 3300005843 | Bacteria | 1174 |
| 90 | Ga0070717_10269813 | 3300006028 | Bacteria | 1507 |
| 91 | Ga0075363_100109275 | 3300006048 | Bacteria | 1536 |
| 92 | Ga0075369_10029070 | 3300006186 | Bacteria | 2320 |
| 93 | Ga0075369_10069143 | 3300006186 | Bacteria | 1553 |
| 94 | Ga0075366_10017805 | 3300006195 | Bacteria | 4096 |
| 95 | Ga0097621_100122229 | 3300006237 | Bacteria | 2209 |
| 96 | Ga0097621_100189583 | 3300006237 | Bacteria | 1780 |
| 97 | Ga0097621_100547377 | 3300006237 | Bacteria | 1053 |
| 98 | Ga0097621_101714959 | 3300006237 | Bacteria | 598 |
| 99 | Ga0068871_100042692 | 3300006358 | Bacteria | 3642 |
| 100 | Ga0068871_100081029 | 3300006358 | Bacteria | 2688 |
| 101 | Ga0068871_100173286 | 3300006358 | Bacteria | 1851 |
| 102 | Ga0068871_100443409 | 3300006358 | Bacteria | 1162 |
| 103 | Ga0068865_100004902 | 3300006881 | Bacteria | 8091 |
| 104 | Ga0068865_100210062 | 3300006881 | Bacteria | 1516 |
| 105 | Ga0068865_100857375 | 3300006881 | Bacteria | 787 |
| 106 | Ga0097620_100138346 | 3300006931 | Bacteria | 2509 |
| 107 | Ga0097620_100215215 | 3300006931 | Bacteria | 2008 |
| 108 | Ga0105240_10000669 | 3300009093 | Bacteria | 62916 |
| 109 | Ga0105240_10483933 | 3300009093 | Bacteria | 1379 |
| 110 | Ga0105240_11016058 | 3300009093 | Bacteria | 886 |
| 111 | Ga0111539_10737058 | 3300009094 | Bacteria | 1147 |
| 112 | Ga0111539_12511916 | 3300009094 | Unclassified | 597 |
| 113 | Ga0105245_10260673 | 3300009098 | Bacteria | 1687 |
| 114 | Ga0105245_10974587 | 3300009098 | Bacteria | 892 |
| 115 | Ga0105247_10069032 | 3300009101 | Bacteria | 2204 |
| 116 | Ga0105243_11047576 | 3300009148 | Bacteria | 821 |
| 117 | Ga0105241_10011914 | 3300009174 | Bacteria | 6388 |
| 118 | Ga0105241_10304357 | 3300009174 | Bacteria | 1369 |
| 119 | Ga0105242_10119069 | 3300009176 | Bacteria | 2263 |
| 120 | Ga0105242_10740788 | 3300009176 | Bacteria | 966 |
| 121 | Ga0105242_11655181 | 3300009176 | Bacteria | 675 |
| 122 | Ga0105248_11677650 | 3300009177 | Bacteria | 720 |
| 123 | Ga0105237_10196553 | 3300009545 | Bacteria | 2017 |
| 124 | Ga0105237_10344685 | 3300009545 | Bacteria | 1494 |
| 125 | Ga0105237_10488869 | 3300009545 | Bacteria | 1237 |
| 126 | Ga0105237_11036382 | 3300009545 | Bacteria | 827 |
| 127 | Ga0105237_11831889 | 3300009545 | Bacteria | 614 |
| 128 | Ga0105238_10015295 | 3300009551 | Bacteria | 7772 |
| 129 | Ga0105238_10035481 | 3300009551 | Bacteria | 5070 |
| 130 | Ga0105238_10083466 | 3300009551 | Bacteria | 3184 |
| 131 | Ga0105238_10335484 | 3300009551 | Bacteria | 1499 |
| 132 | Ga0105238_10658459 | 3300009551 | Bacteria | 1057 |
| 133 | Ga0105238_11385265 | 3300009551 | Bacteria | 730 |
| 134 | Ga0105238_12484495 | 3300009551 | Bacteria | 554 |
| 135 | Ga0105238_12951911 | 3300009551 | Bacteria | 511 |
| 136 | Ga0105249_10011129 | 3300009553 | Bacteria | 7905 |
| 137 | Ga0105239_10018464 | 3300010375 | Bacteria | 7703 |
| 138 | Ga0105239_10180374 | 3300010375 | Bacteria | 2363 |
| 139 | Ga0105239_10405167 | 3300010375 | Bacteria | 1544 |
| 140 | Ga0105239_10942375 | 3300010375 | Bacteria | 991 |
| 141 | Ga0105246_12594422 | 3300011119 | Bacteria | 500 |
| 142 | Ga0157370_10026574 | 3300013104 | Bacteria | 5713 |
| 143 | Ga0157370_10116048 | 3300013104 | Bacteria | 2501 |
| 144 | Ga0157370_10153048 | 3300013104 | Bacteria | 2146 |
| 145 | Ga0157370_10182816 | 3300013104 | Bacteria | 1948 |
| 146 | Ga0157370_10455417 | 3300013104 | Bacteria | 1176 |
| 147 | Ga0157369_10022557 | 3300013105 | Bacteria | 7022 |
| 148 | Ga0157369_10110918 | 3300013105 | Bacteria | 2916 |
| 149 | Ga0157374_10146969 | 3300013296 | Bacteria | 2290 |
| 150 | Ga0157374_11060161 | 3300013296 | Bacteria | 830 |
| 151 | Ga0157378_10000158 | 3300013297 | Bacteria | 64291 |
| 152 | Ga0157378_10043597 | 3300013297 | Bacteria | 3984 |
| 153 | Ga0157378_10918393 | 3300013297 | Bacteria | 907 |
| 154 | Ga0163162_10206003 | 3300013306 | Bacteria | 2096 |
| 155 | Ga0157372_10121872 | 3300013307 | Bacteria | 2996 |
| 156 | Ga0157375_10014871 | 3300013308 | Bacteria | 6955 |
| 157 | Ga0157375_10389301 | 3300013308 | Bacteria | 1561 |
| 158 | Ga0157375_10535464 | 3300013308 | Bacteria | 1334 |
| 159 | Ga0163163_10000415 | 3300014325 | Bacteria | 39754 |
| 160 | Ga0163163_11517169 | 3300014325 | Bacteria | 731 |
| 161 | Ga0157380_10128383 | 3300014326 | Bacteria | 2159 |
| 162 | Ga0157380_12909621 | 3300014326 | Bacteria | 545 |
| 163 | Ga0182008_10001870 | 3300014497 | Bacteria | 13704 |
| 164 | Ga0182008_10007165 | 3300014497 | Bacteria | 6173 |
| 165 | Ga0182008_10538076 | 3300014497 | Bacteria | 647 |
| 166 | Ga0157379_11566227 | 3300014968 | Bacteria | 643 |
| 167 | Ga0157376_10007397 | 3300014969 | Bacteria | 7835 |
| 168 | Ga0157376_10013837 | 3300014969 | Bacteria | 6033 |
| 169 | Ga0157376_10049620 | 3300014969 | Bacteria | 3477 |
| 170 | Ga0157376_10220949 | 3300014969 | Bacteria | 1754 |
| 171 | Ga0182006_1000148 | 3300015261 | Bacteria | 74813 |
| 172 | Ga0182006_1000764 | 3300015261 | Bacteria | 21872 |
| 173 | Ga0182007_10022089 | 3300015262 | Bacteria | 2251 |
| 174 | Ga0182007_10149377 | 3300015262 | Bacteria | 794 |
| 175 | Ga0182005_1000138 | 3300015265 | Bacteria | 51894 |
| 176 | Ga0182005_1000821 | 3300015265 | Bacteria | 13994 |
| 177 | Ga0182005_1013927 | 3300015265 | Bacteria | 2257 |
| 178 | Ga0163161_10013899 | 3300017792 | Bacteria | 5607 |
| 179 | Ga0206352_10691753 | 3300020078 | Bacteria | 760 |
| 180 | Ga0206353_10323706 | 3300020082 | Bacteria | 946 |
| 181 | Ga0213876_10370448 | 3300021384 | Bacteria | 762 |
| 182 | Ga0213876_10437183 | 3300021384 | Bacteria | 696 |
| 183 | Ga0209674_100762 | 3300025226 | Bacteria | 10916 |
| 184 | Ga0209148_1001376 | 3300025254 | Bacteria | 12658 |
| 185 | Ga0209129_1002303 | 3300025258 | Bacteria | 9488 |
| 186 | Ga0209233_1006128 | 3300025261 | Bacteria | 3909 |
| 187 | Ga0209256_1011917 | 3300025299 | Bacteria | 3407 |
| 188 | Ga0209051_1033416 | 3300025303 | Bacteria | 1946 |
| 189 | Ga0209257_1004136 | 3300025304 | Bacteria | 11562 |
| 190 | Ga0207656_10006516 | 3300025321 | Bacteria | 4203 |
| 191 | Ga0207656_10217105 | 3300025321 | Bacteria | 928 |
| 192 | Ga0207710_10034219 | 3300025900 | Bacteria | 2232 |
| 193 | Ga0207710_10216258 | 3300025900 | Bacteria | 950 |
| 194 | Ga0207680_10008110 | 3300025903 | Bacteria | 5147 |
| 195 | Ga0207680_10028578 | 3300025903 | Bacteria | 3121 |
| 196 | Ga0207680_10033449 | 3300025903 | Bacteria | 2933 |
| 197 | Ga0207680_10342538 | 3300025903 | Bacteria | 1049 |
| 198 | Ga0207647_10000008 | 3300025904 | Bacteria | 192602 |
| 199 | Ga0207647_10002496 | 3300025904 | Bacteria | 13931 |
| 200 | Ga0207645_10021426 | 3300025907 | Bacteria | 4214 |
| 201 | Ga0207643_10227401 | 3300025908 | Bacteria | 1143 |
| 202 | Ga0207643_10534763 | 3300025908 | Bacteria | 751 |
| 203 | Ga0207705_10287724 | 3300025909 | Bacteria | 1259 |
| 204 | Ga0207705_11472947 | 3300025909 | Bacteria | 516 |
| 205 | Ga0207654_10152482 | 3300025911 | Bacteria | 1485 |
| 206 | Ga0207654_11086175 | 3300025911 | Bacteria | 583 |
| 207 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 208 | Ga0207695_10002028 | 3300025913 | Bacteria | 31095 |
| 209 | Ga0207695_10762853 | 3300025913 | Bacteria | 847 |
| 210 | Ga0207649_10126540 | 3300025920 | Bacteria | 1730 |
| 211 | Ga0207649_10241097 | 3300025920 | Bacteria | 1298 |
| 212 | Ga0207649_11121452 | 3300025920 | Bacteria | 621 |
| 213 | Ga0207681_10238971 | 3300025923 | Bacteria | 1413 |
| 214 | Ga0207694_10005098 | 3300025924 | Bacteria | 10153 |
| 215 | Ga0207694_10007511 | 3300025924 | Bacteria | 8263 |
| 216 | Ga0207694_10092650 | 3300025924 | Bacteria | 2385 |
| 217 | Ga0207694_10123407 | 3300025924 | Bacteria | 2070 |
| 218 | Ga0207694_10582258 | 3300025924 | Bacteria | 941 |
| 219 | Ga0207650_10040621 | 3300025925 | Bacteria | 3405 |
| 220 | Ga0207650_11740392 | 3300025925 | Bacteria | 528 |
| 221 | Ga0207659_10297963 | 3300025926 | Bacteria | 1323 |
| 222 | Ga0207644_10477187 | 3300025931 | Bacteria | 1027 |
| 223 | Ga0207644_11349213 | 3300025931 | Bacteria | 599 |
| 224 | Ga0207690_11007956 | 3300025932 | Bacteria | 693 |
| 225 | Ga0207706_10006474 | 3300025933 | Bacteria | 10872 |
| 226 | Ga0207706_10288932 | 3300025933 | Bacteria | 1430 |
| 227 | Ga0207686_10032376 | 3300025934 | Bacteria | 3111 |
| 228 | Ga0207686_11567228 | 3300025934 | Bacteria | 544 |
| 229 | Ga0207709_10324791 | 3300025935 | Bacteria | 1153 |
| 230 | Ga0207670_10182421 | 3300025936 | Bacteria | 1582 |
| 231 | Ga0207704_10015776 | 3300025938 | Bacteria | 3861 |
| 232 | Ga0207704_10050293 | 3300025938 | Bacteria | 2513 |
| 233 | Ga0207704_10092087 | 3300025938 | Bacteria | 1994 |
| 234 | Ga0207704_11869776 | 3300025938 | Bacteria | 516 |
| 235 | Ga0207691_11470612 | 3300025940 | Bacteria | 558 |
| 236 | Ga0207711_10829711 | 3300025941 | Unclassified | 861 |
| 237 | Ga0207711_11222579 | 3300025941 | Bacteria | 693 |
| 238 | Ga0207689_10148749 | 3300025942 | Bacteria | 1930 |
| 239 | Ga0207689_10175680 | 3300025942 | Bacteria | 1766 |
| 240 | Ga0207689_10407809 | 3300025942 | Bacteria | 1133 |
| 241 | Ga0207689_10568554 | 3300025942 | Bacteria | 953 |
| 242 | Ga0207679_11754773 | 3300025945 | Bacteria | 567 |
| 243 | Ga0207667_10000124 | 3300025949 | Bacteria | 118199 |
| 244 | Ga0207667_10089902 | 3300025949 | Bacteria | 3173 |
| 245 | Ga0207667_10233666 | 3300025949 | Bacteria | 1882 |
| 246 | Ga0207712_10007905 | 3300025961 | Bacteria | 6719 |
| 247 | Ga0207668_10443731 | 3300025972 | Bacteria | 1106 |
| 248 | Ga0207668_10569931 | 3300025972 | Unclassified | 983 |
| 249 | Ga0207640_10207846 | 3300025981 | Bacteria | 1489 |
| 250 | Ga0207640_10908364 | 3300025981 | Bacteria | 769 |
| 251 | Ga0207640_11436509 | 3300025981 | Bacteria | 619 |
| 252 | Ga0207658_10145265 | 3300025986 | Bacteria | 1925 |
| 253 | Ga0207658_10146137 | 3300025986 | Bacteria | 1920 |
| 254 | Ga0207658_10181618 | 3300025986 | Bacteria | 1742 |
| 255 | Ga0207658_11293452 | 3300025986 | Bacteria | 667 |
| 256 | Ga0207677_10306264 | 3300026023 | Bacteria | 1314 |
| 257 | Ga0207677_10639727 | 3300026023 | Bacteria | 937 |
| 258 | Ga0207677_10667596 | 3300026023 | Bacteria | 919 |
| 259 | Ga0207703_10002988 | 3300026035 | Bacteria | 14340 |
| 260 | Ga0207703_10265457 | 3300026035 | Bacteria | 1553 |
| 261 | Ga0207639_10000398 | 3300026041 | Bacteria | 29968 |
| 262 | Ga0207639_11699959 | 3300026041 | Bacteria | 591 |
| 263 | Ga0207639_11962518 | 3300026041 | Bacteria | 546 |
| 264 | Ga0207678_10140849 | 3300026067 | Bacteria | 2058 |
| 265 | Ga0207678_10244971 | 3300026067 | Bacteria | 1535 |
| 266 | Ga0207678_11792618 | 3300026067 | Bacteria | 537 |
| 267 | Ga0207702_10016655 | 3300026078 | Bacteria | 6085 |
| 268 | Ga0207702_10022797 | 3300026078 | Bacteria | 5193 |
| 269 | Ga0207702_10942821 | 3300026078 | Bacteria | 856 |
| 270 | Ga0207702_11865032 | 3300026078 | Bacteria | 593 |
| 271 | Ga0207641_10064699 | 3300026088 | Bacteria | 3126 |
| 272 | Ga0207648_10078882 | 3300026089 | Bacteria | 2873 |
| 273 | Ga0207648_10142765 | 3300026089 | Bacteria | 2111 |
| 274 | Ga0207648_10158841 | 3300026089 | Bacteria | 1996 |
| 275 | Ga0207676_10756685 | 3300026095 | Bacteria | 945 |
| 276 | Ga0207676_11196605 | 3300026095 | Bacteria | 753 |
| 277 | Ga0207676_12464087 | 3300026095 | Unclassified | 517 |
| 278 | Ga0207674_10149424 | 3300026116 | Bacteria | 2294 |
| 279 | Ga0207698_10015225 | 3300026142 | Bacteria | 5146 |
| 280 | Ga0207698_10095932 | 3300026142 | Bacteria | 2443 |
| 281 | Ga0207698_10502424 | 3300026142 | Bacteria | 1180 |
| 282 | Ga0207698_10532968 | 3300026142 | Bacteria | 1148 |
| 283 | Ga0207698_11409804 | 3300026142 | Bacteria | 712 |
| 284 | Ga0207698_11435345 | 3300026142 | Bacteria | 705 |
| 285 | Ga0207698_11794506 | 3300026142 | Bacteria | 629 |
| 286 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 287 | Ga0268266_10993599 | 3300028379 | Bacteria | 812 |
| 288 | Ga0268265_11649230 | 3300028380 | Bacteria | 647 |
| 289 | Ga0268264_10319828 | 3300028381 | Bacteria | 1467 |
| 290 | Ga0307515_10624505 | 3300028794 | Bacteria | 689 |
| 291 | Ga0265324_10060839 | 3300029957 | Bacteria | 1291 |
| 292 | Ga0265328_10280302 | 3300031239 | Bacteria | 641 |
| 293 | Ga0265339_10000061 | 3300031249 | Bacteria | 96584 |
| 294 | Ga0265331_10586799 | 3300031250 | Bacteria | 503 |
| 295 | Ga0265316_10000396 | 3300031344 | Bacteria | 49712 |
| 296 | Ga0307509_10148769 | 3300031507 | Bacteria | 2262 |
| 297 | Ga0307408_100520887 | 3300031548 | Bacteria | 1044 |
| 298 | Ga0307408_101447585 | 3300031548 | Bacteria | 648 |
| 299 | Ga0307508_10230769 | 3300031616 | Bacteria | 1449 |
| 300 | Ga0307508_10390884 | 3300031616 | Bacteria | 982 |
| 301 | Ga0307508_10608490 | 3300031616 | Bacteria | 695 |
| 302 | Ga0316575_10013285 | 3300031665 | Bacteria | 3073 |
| 303 | Ga0316579_10017166 | 3300031691 | Bacteria | 3172 |
| 304 | Ga0316579_10297809 | 3300031691 | Bacteria | 780 |
| 305 | Ga0265314_10000011 | 3300031711 | Bacteria | 445050 |
| 306 | Ga0316576_10152582 | 3300031727 | Bacteria | 1741 |
| 307 | Ga0316578_10040118 | 3300031728 | Bacteria | 2705 |
| 308 | Ga0307516_10002273 | 3300031730 | Bacteria | 25900 |
| 309 | Ga0307516_10016196 | 3300031730 | Bacteria | 7809 |
| 310 | Ga0307405_10376174 | 3300031731 | Bacteria | 1104 |
| 311 | Ga0307405_10979663 | 3300031731 | Bacteria | 720 |
| 312 | Ga0316577_10007159 | 3300031733 | Bacteria | 5934 |
| 313 | Ga0316577_10106903 | 3300031733 | Bacteria | 1570 |
| 314 | Ga0316577_10738316 | 3300031733 | Bacteria | 559 |
| 315 | Ga0307413_10303509 | 3300031824 | Bacteria | 1212 |
| 316 | Ga0307518_10434202 | 3300031838 | Bacteria | 712 |
| 317 | Ga0307410_10959805 | 3300031852 | Bacteria | 735 |
| 318 | Ga0307410_10996593 | 3300031852 | Bacteria | 722 |
| 319 | Ga0307406_10365892 | 3300031901 | Bacteria | 1132 |
| 320 | Ga0307412_10000549 | 3300031911 | Bacteria | 22324 |
| 321 | Ga0307412_10041548 | 3300031911 | Bacteria | 2981 |
| 322 | Ga0307412_10425233 | 3300031911 | Bacteria | 1087 |
| 323 | Ga0307416_100116106 | 3300032002 | Bacteria | 2372 |
| 324 | Ga0307414_10814963 | 3300032004 | Bacteria | 852 |
| 325 | Ga0307414_12252793 | 3300032004 | Bacteria | 509 |
| 326 | Ga0307411_10964652 | 3300032005 | Bacteria | 761 |
| 327 | Ga0307411_10999197 | 3300032005 | Bacteria | 749 |
| 328 | Ga0316585_10028239 | 3300032137 | Bacteria | 1754 |
| 329 | Ga0316580_10035081 | 3300032139 | Bacteria | 1552 |
| 330 | Ga0307507_10167251 | 3300033179 | Bacteria | 1608 |
| 331 | Ga0316592_1106644 | 3300033524 | Bacteria | 646 |
| 332 | Ga0316596_1157217 | 3300033541 | Bacteria | 625 |
| 333 | Ga0373934_0020125 | 3300035086 | Bacteria | 2565 |
| 334 | Ga0373944_0313865 | 3300035089 | Bacteria | 590 |
| 335 | Ga0373936_0056676 | 3300035113 | Bacteria | 1593 |
| 336 | Ga0373954_0003745 | 3300035118 | Bacteria | 6484 |
| 337 | Ga0373954_0223316 | 3300035118 | Bacteria | 927 |
| 338 | Ga0373957_0036748 | 3300035120 | Bacteria | 1826 |
| 339 | Ga0373943_0841500 | 3300035170 | Bacteria | 547 |
| 340 | Ga0373955_0017110 | 3300035172 | Bacteria | 3581 |
| 341 | Ga0373955_0133076 | 3300035172 | Bacteria | 1453 |
| 342 | Ga0316574_0458075 | 3300035398 | Bacteria | 798 |
| 343 | Ga0316574_0605156 | 3300035398 | Unclassified | 677 |
| 344 | Ga0316574_0791465 | 3300035398 | Bacteria | 578 |
| 345 | Ga0373924_0006176 | 3300035410 | Bacteria | 4283 |
| 346 | Ga0373927_0238871 | 3300035695 | Unclassified | 1194 |
| 347 | Ga0373927_0806139 | 3300035695 | Unclassified | 620 |
| 348 | Ga0373933_0068067 | 3300035724 | Bacteria | 2162 |
| 349 | Ga0373937_0015132 | 3300036401 | Bacteria | 6817 |
| 350 | Ga0373937_0123959 | 3300036401 | Bacteria | 2409 |
| 351 | Ga0373937_0515358 | 3300036401 | Bacteria | 1136 |
| 352 | Ga0316582_0047091 | 3300036647 | Bacteria | 2721 |
| 353 | Ga0316582_0092634 | 3300036647 | Bacteria | 1992 |
| 354 | Ga0316582_0607769 | 3300036647 | Unclassified | 752 |
| 355 | Ga0316581_0013021 | 3300037588 | Bacteria | 2353 |
| 356 | Ga0400483_107877 | 3300039062 | Bacteria | 9585 |
| 357 | Ga0436365_1211373 | 3300039437 | Bacteria | 3093 |
| 358 | Ga0436365_1692091 | 3300039437 | Bacteria | 971 |
| 359 | Ga0436360_0925588 | 3300039438 | Bacteria | 1473 |
| 360 | Ga0436361_0753834 | 3300039447 | Bacteria | 2542 |
| 361 | Ga0439436_0000022 | 3300041404 | Bacteria | 60408 |
| 362 | Ga0439436_0050823 | 3300041404 | Bacteria | 1172 |
| 363 | Ga0439465_0015525 | 3300041413 | Bacteria | 2376 |
| 364 | Ga0451789_0620140 | 3300041443 | Bacteria | 1373 |
| 365 | Ga0451789_0715167 | 3300041443 | Bacteria | 621 |
| 366 | Ga0451791_0387075 | 3300041451 | Bacteria | 672 |
| 367 | Ga0451793_1461656 | 3300041452 | Unclassified | 540 |
| 368 | Ga0451797_0315433 | 3300041453 | Bacteria | 1440 |
| 369 | Ga0451797_0358766 | 3300041453 | Bacteria | 638 |
| 370 | Ga0451797_0951503 | 3300041453 | Bacteria | 660 |
| 371 | Ga0451797_1369500 | 3300041453 | Bacteria | 652 |
| 372 | Ga0451798_0562695 | 3300041458 | Bacteria | 720 |
| 373 | Ga0451800_1434890 | 3300041459 | Bacteria | 1412 |
| 374 | Ga0451802_0188506 | 3300041460 | Bacteria | 1664 |
| 375 | Ga0451802_0760078 | 3300041460 | Bacteria | 516 |
| 376 | Ga0451807_0115392 | 3300041486 | Bacteria | 4855 |
| 377 | Ga0451807_0549023 | 3300041486 | Bacteria | 531 |
| 378 | Ga0451807_2006261 | 3300041486 | Bacteria | 510 |
| 379 | Ga0451807_2382850 | 3300041486 | Bacteria | 519 |
| 380 | Ga0451807_2603317 | 3300041486 | Bacteria | 619 |
| 381 | Ga0451833_1442070 | 3300041491 | Bacteria | 724 |
| 382 | Ga0451837_0932555 | 3300041494 | Bacteria | 3555 |
| 383 | Ga0451837_0937759 | 3300041494 | Bacteria | 840 |
| 384 | Ga0451841_0133503 | 3300041498 | Bacteria | 558 |
| 385 | Ga0451851_0246198 | 3300041507 | Bacteria | 756 |
| 386 | Ga0451843_1635939 | 3300041509 | Bacteria | 569 |
| 387 | Ga0451855_1120302 | 3300041511 | Bacteria | 667 |
| 388 | Ga0451853_0680897 | 3300041512 | Bacteria | 841 |
| 389 | Ga0451853_1187429 | 3300041512 | Bacteria | 693 |
| 390 | Ga0451853_3841156 | 3300041512 | Bacteria | 575 |
| 391 | Ga0450894_029594 | 3300042131 | Bacteria | 760 |
| 392 | Ga0450908_000075 | 3300042184 | Bacteria | 19743 |
| 393 | Ga0466982_0000037 | 3300044672 | Bacteria | 42622 |
| 394 | Ga0466957_0066841 | 3300044842 | Bacteria | 2217 |
| 395 | Ga0466960_0052483 | 3300044901 | Bacteria | 1973 |
| 396 | Ga0466967_1660326 | 3300045976 | Bacteria | 636 |
| 397 | Ga0495617_000420 | 3300046452 | Bacteria | 23121 |
| 398 | Ga0495617_003578 | 3300046452 | Bacteria | 5811 |
| 399 | Ga0495603_0209503 | 3300046455 | Bacteria | 1126 |
| 400 | Ga0495591_002496 | 3300046458 | Bacteria | 10186 |
| 401 | Ga0495629_0594455 | 3300046459 | Bacteria | 740 |
| 402 | Ga0495638_0003699 | 3300046460 | Bacteria | 11903 |
| 403 | Ga0495638_0531330 | 3300046460 | Bacteria | 588 |
| 404 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 405 | Ga0495650_0000562 | 3300046471 | Bacteria | 52583 |
| 406 | Ga0495650_0058735 | 3300046471 | Bacteria | 1551 |
| 407 | Ga0495582_0064794 | 3300046473 | Bacteria | 2018 |
| 408 | Ga0495605_0027185 | 3300046474 | Bacteria | 2966 |
| 409 | Ga0495639_0240454 | 3300046475 | Bacteria | 893 |
| 410 | Ga0495584_0001715 | 3300046491 | Bacteria | 12832 |
| 411 | Ga0495584_0010788 | 3300046491 | Bacteria | 4690 |
| 412 | Ga0495585_0000200 | 3300046492 | Bacteria | 62445 |
| 413 | Ga0495585_0001731 | 3300046492 | Bacteria | 16612 |
| 414 | Ga0495607_0000178 | 3300046501 | Bacteria | 67386 |
| 415 | Ga0495607_0000256 | 3300046501 | Bacteria | 57167 |
| 416 | Ga0495607_0003984 | 3300046501 | Bacteria | 11101 |
| 417 | Ga0495607_0009540 | 3300046501 | Bacteria | 6560 |
| 418 | Ga0495607_0189857 | 3300046501 | Bacteria | 1024 |
| 419 | Ga0495607_0313983 | 3300046501 | Bacteria | 733 |
| 420 | Ga0495583_0002800 | 3300046506 | Bacteria | 14317 |
| 421 | Ga0495606_0001619 | 3300046507 | Bacteria | 29382 |
| 422 | Ga0495606_0001846 | 3300046507 | Bacteria | 26681 |
| 423 | Ga0495606_0002611 | 3300046507 | Bacteria | 20602 |
| 424 | Ga0495606_0019940 | 3300046507 | Bacteria | 4964 |
| 425 | Ga0495606_0054526 | 3300046507 | Bacteria | 2589 |
| 426 | Ga0495606_0120977 | 3300046507 | Bacteria | 1567 |
| 427 | Ga0495610_0000341 | 3300046512 | Bacteria | 49154 |
| 428 | Ga0495616_0000357 | 3300046513 | Bacteria | 35877 |
| 429 | Ga0495616_0013102 | 3300046513 | Bacteria | 4688 |
| 430 | Ga0495616_0022311 | 3300046513 | Bacteria | 3418 |
| 431 | Ga0495620_0000150 | 3300046515 | Bacteria | 56486 |
| 432 | Ga0495620_0000287 | 3300046515 | Bacteria | 36247 |
| 433 | Ga0495631_0000257 | 3300046518 | Bacteria | 36879 |
| 434 | Ga0495631_0000664 | 3300046518 | Bacteria | 22221 |
| 435 | Ga0495631_0099291 | 3300046518 | Bacteria | 1253 |
| 436 | Ga0495631_0245714 | 3300046518 | Bacteria | 763 |
| 437 | Ga0495632_0000016 | 3300046519 | Bacteria | 232022 |
| 438 | Ga0495632_0012122 | 3300046519 | Bacteria | 4986 |
| 439 | Ga0495632_0331260 | 3300046519 | Bacteria | 671 |
| 440 | Ga0495637_0006974 | 3300046520 | Bacteria | 5628 |
| 441 | Ga0495643_0076134 | 3300046522 | Bacteria | 1755 |
| 442 | Ga0495644_0040994 | 3300046523 | Bacteria | 1744 |
| 443 | Ga0495648_0001786 | 3300046524 | Bacteria | 20692 |
| 444 | Ga0495648_0013340 | 3300046524 | Bacteria | 6082 |
| 445 | Ga0495648_0014184 | 3300046524 | Bacteria | 5846 |
| 446 | Ga0495654_0000467 | 3300046530 | Bacteria | 33780 |
| 447 | Ga0495587_0305599 | 3300046536 | Bacteria | 889 |
| 448 | Ga0495609_0003864 | 3300046538 | Bacteria | 8418 |
| 449 | Ga0495645_0062462 | 3300046543 | Bacteria | 2698 |
| 450 | Ga0495668_0692630 | 3300046616 | Bacteria | 564 |
| 451 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 452 | Ga0495611_0000044 | 3300046648 | Bacteria | 92551 |
| 453 | Ga0495625_0000041 | 3300046660 | Bacteria | 206598 |
| 454 | Ga0495625_0008315 | 3300046660 | Bacteria | 8864 |
| 455 | Ga0495625_0069375 | 3300046660 | Bacteria | 2476 |
| 456 | Ga0495635_0622866 | 3300046663 | Bacteria | 703 |
| 457 | Ga0495661_0012895 | 3300046665 | Bacteria | 5632 |
| 458 | Ga0495657_0749146 | 3300046675 | Unclassified | 560 |
| 459 | Ga0495646_0460651 | 3300046680 | Bacteria | 656 |
| 460 | Ga0495647_0017738 | 3300046681 | Bacteria | 2523 |
| 461 | Ga0495658_0001223 | 3300046683 | Bacteria | 13482 |
| 462 | Ga0495624_0338918 | 3300046690 | Bacteria | 905 |
| 463 | Ga0495670_0003155 | 3300046691 | Bacteria | 8123 |
| 464 | Ga0495670_0006364 | 3300046691 | Bacteria | 5799 |
| 465 | Ga0495670_0176182 | 3300046691 | Bacteria | 1127 |
| 466 | Ga0495671_0000303 | 3300046692 | Bacteria | 41634 |
| 467 | Ga0495671_0009568 | 3300046692 | Bacteria | 5409 |
| 468 | Ga0495649_0074074 | 3300046694 | Bacteria | 1824 |
| 469 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 470 | Ga0495589_0047433 | 3300046794 | Bacteria | 2129 |
| 471 | Ga0495660_0000019 | 3300046810 | Bacteria | 311047 |
| 472 | Ga0495660_0000231 | 3300046810 | Bacteria | 54997 |
| 473 | Ga0495660_0004058 | 3300046810 | Bacteria | 8941 |
| 474 | Ga0495604_0084443 | 3300047317 | Bacteria | 2371 |
| 475 | Ga0495674_0535174 | 3300047319 | Bacteria | 934 |
| 476 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 477 | Ga0495672_0211098 | 3300047320 | Bacteria | 964 |
| 478 | Ga0495676_0806357 | 3300047321 | Bacteria | 604 |
| 479 | Ga0495680_0362925 | 3300047322 | Bacteria | 1006 |
| 480 | Ga0495683_0000643 | 3300047323 | Bacteria | 25972 |
| 481 | Ga0495683_0060141 | 3300047323 | Bacteria | 1883 |
| 482 | Ga0495675_0798694 | 3300047444 | Bacteria | 522 |
| 483 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 484 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 485 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 486 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 487 | Ga0495673_0005506 | 3300047469 | Bacteria | 7643 |
| 488 | Ga0495681_0096407 | 3300047470 | Bacteria | 1299 |
| 489 | Ga0495684_0350836 | 3300047471 | Bacteria | 1047 |
| 490 | Ga0495686_0000108 | 3300047472 | Bacteria | 173579 |
| 491 | Ga0495686_0004535 | 3300047472 | Bacteria | 11381 |
| 492 | Ga0495686_0016087 | 3300047472 | Bacteria | 5083 |
| 493 | Ga0495686_0171282 | 3300047472 | Bacteria | 1262 |
| 494 | Ga0495686_0364558 | 3300047472 | Bacteria | 782 |
| 495 | Ga0496102_0067734 | 3300048905 | Bacteria | 3275 |
| 496 | Ga0496102_0290429 | 3300048905 | Bacteria | 1541 |
| 497 | Ga0496103_0334375 | 3300048906 | Bacteria | 974 |
| 498 | Ga0496104_0000058 | 3300048907 | Bacteria | 118768 |
| 499 | Ga0496105_0000021 | 3300048908 | Bacteria | 164255 |
| 500 | Ga0496106_0001787 | 3300048909 | Bacteria | 16065 |
| 501 | Ga0496109_0641755 | 3300048912 | Bacteria | 999 |
| 502 | Ga0496113_0845195 | 3300048916 | Bacteria | 726 |
| 503 | Ga0496115_0000387 | 3300048918 | Bacteria | 36211 |
| 504 | Ga0496116_0171293 | 3300048919 | Bacteria | 1176 |
| 505 | Ga0496116_0240461 | 3300048919 | Bacteria | 910 |
| 506 | Ga0496117_0015847 | 3300048920 | Bacteria | 6394 |
| 507 | Ga0496117_0102518 | 3300048920 | Bacteria | 1806 |
| 508 | Ga0496117_0158699 | 3300048920 | Bacteria | 1328 |
| 509 | Ga0496118_0000169 | 3300048921 | Bacteria | 118190 |
| 510 | Ga0496118_0003233 | 3300048921 | Bacteria | 20771 |
| 511 | Ga0496118_0014200 | 3300048921 | Bacteria | 7469 |
| 512 | Ga0496118_0025248 | 3300048921 | Bacteria | 5102 |
| 513 | Ga0496118_0315544 | 3300048921 | Bacteria | 851 |
| 514 | Ga0496119_0047913 | 3300048922 | Bacteria | 2654 |
| 515 | Ga0496121_0000148 | 3300048924 | Bacteria | 154021 |
| 516 | Ga0496121_0002094 | 3300048924 | Bacteria | 31439 |
| 517 | Ga0496121_0004100 | 3300048924 | Bacteria | 19992 |
| 518 | Ga0496121_0013648 | 3300048924 | Bacteria | 8709 |
| 519 | Ga0496122_0023158 | 3300048925 | Bacteria | 5487 |
| 520 | Ga0496122_0044436 | 3300048925 | Bacteria | 3467 |
| 521 | Ga0496123_0016094 | 3300048926 | Bacteria | 6094 |
| 522 | Ga0496123_0025676 | 3300048926 | Bacteria | 4433 |
| 523 | Ga0496123_0038725 | 3300048926 | Bacteria | 3346 |
| 524 | Ga0496124_0001854 | 3300048927 | Bacteria | 29197 |
| 525 | Ga0496124_0014877 | 3300048927 | Bacteria | 7495 |
| 526 | Ga0496124_0218364 | 3300048927 | Bacteria | 1436 |
| 527 | Ga0496124_0285030 | 3300048927 | Bacteria | 1202 |
| 528 | Ga0496126_0000835 | 3300048929 | Bacteria | 54796 |
| 529 | Ga0496126_0392579 | 3300048929 | Bacteria | 1127 |
| 530 | Ga0496126_0582909 | 3300048929 | Bacteria | 883 |
| 531 | Ga0495678_000158 | 3300049459 | Bacteria | 81058 |
| 532 | Ga0495678_000479 | 3300049459 | Bacteria | 39762 |
| 533 | Ga0495682_0000006 | 3300049460 | Bacteria | 316373 |
| 534 | Ga0495682_0002224 | 3300049460 | Bacteria | 9371 |
| 535 | Ga0495682_0012087 | 3300049460 | Bacteria | 3317 |
| 536 | Ga0501034_0340064 | 3300049571 | Bacteria | 1431 |
| 537 | Ga0501047_0087722 | 3300049581 | Bacteria | 2989 |
| 538 | Ga0501047_0522885 | 3300049581 | Unclassified | 1012 |
| 539 | Ga0501067_0126310 | 3300049583 | Bacteria | 1423 |
| 540 | Ga0501070_0375392 | 3300049586 | Bacteria | 1152 |
| 541 | Ga0501071_0072307 | 3300049587 | Unclassified | 2515 |
| 542 | Ga0501071_0877408 | 3300049587 | Bacteria | 692 |
| 543 | Ga0501073_0018182 | 3300049589 | Bacteria | 5080 |
| 544 | Ga0501073_0722615 | 3300049589 | Bacteria | 687 |
| 545 | Ga0501075_0815359 | 3300049591 | Unclassified | 710 |
| 546 | Ga0501077_0377743 | 3300049593 | Bacteria | 905 |
| 547 | Ga0501080_0109945 | 3300049742 | Bacteria | 2554 |
| 548 | Ga0501080_0280904 | 3300049742 | Bacteria | 1514 |
| 549 | Ga0501083_0497734 | 3300049744 | Unclassified | 793 |
| 550 | Ga0501035_0113464 | 3300049822 | Bacteria | 2374 |
| 551 | Ga0501035_0200628 | 3300049822 | Bacteria | 1711 |
| 552 | nmdc:mga03683_655392_c1 | 3300050489 | Unclassified | 517 |
| 553 | nmdc:mga00v17_610761_c1 | 3300050491 | Bacteria | 703 |
| 554 | nmdc:mga0k408_9218_c1 | 3300050493 | Bacteria | 5317 |
| 555 | nmdc:mga09592_971813_c1 | 3300050508 | Bacteria | 711 |
| 556 | nmdc:mga0sz30_5002_c1 | 3300050516 | Bacteria | 4525 |
| 557 | Ga0500610_0013793 | 3300053079 | Bacteria | 3775 |
| 558 | Ga0495595_0332093 | 3300053084 | Bacteria | 766 |
| 559 | Ga0500643_000103 | 3300053087 | Bacteria | 87887 |
| 560 | Ga0500566_0214342 | 3300053094 | Bacteria | 962 |
| 561 | Ga0500555_000995 | 3300053103 | Bacteria | 9699 |
| 562 | Ga0500614_026914 | 3300053123 | Bacteria | 1378 |
| 563 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 564 | Ga0500652_152208 | 3300053131 | Bacteria | 959 |
| 565 | Ga0500588_0225040 | 3300053146 | Unclassified | 700 |
| 566 | Ga0500645_000741 | 3300053730 | Bacteria | 20060 |
| 567 | Ga0501084_0274242 | 3300054114 | Bacteria | 1424 |
| 568 | Ga0501084_1760045 | 3300054114 | Unclassified | 517 |
| 569 | Ga0587072_149826 | 3300059643 | Unclassified | 562 |
| 570 | Ga0466962_0656767 | 3300061719 | Unclassified | 536 |
| 571 | Ga0530510_1150002 | 3300061734 | Unclassified | 595 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0791465 | Ga0316574_0791465_123_383 | 85 |
| 2 | 3300036647 | Ga0316582_0607769 | Ga0316582_0607769_416_676 | 85 |
| 3 | 3300037588 | Ga0316581_0013021 | Ga0316581_0013021_1720_1980 | 85 |
| 4 | iso_pu_bacteria | 2747842501 | 2748016456 | 85 |
| 5 | 3300026095 | Ga0207676_12464087 | Ga0207676_124640871 | 86 |
| 6 | 3300029957 | Ga0265324_10060839 | Ga0265324_100608392 | 86 |
| 7 | 3300031239 | Ga0265328_10280302 | Ga0265328_102803021 | 86 |
| 8 | 3300039438 | Ga0436360_0925588 | Ga0436360_0925588_450_713 | 86 |
| 9 | 3300039447 | Ga0436361_0753834 | Ga0436361_0753834_1721_1984 | 86 |
| 10 | iso_pu_bacteria | 2524614729 | 2525557115 | 86 |
| 11 | iso_pu_bacteria | 2593339238 | 2595447099 | 86 |
| 12 | iso_pu_bacteria | 2593339239 | 2595449857 | 86 |
| 13 | iso_pu_bacteria | 2627854209 | 2630648711 | 86 |
| 14 | iso_pu_bacteria | 2643221573 | 2643881643 | 86 |
| 15 | iso_pu_bacteria | 2643221720 | 2644662732 | 86 |
| 16 | iso_pu_bacteria | 2643221728 | 2644698314 | 86 |
| 17 | iso_pu_bacteria | 2718218334 | 2721026241 | 86 |
| 18 | iso_pu_bacteria | 2734482264 | 2735833783 | 86 |
| 19 | iso_pu_bacteria | 2818991440 | 2819564242 | 86 |
| 20 | iso_pu_bacteria | 2842914999 | 2842918127 | 86 |
| 21 | iso_pu_bacteria | 2842918807 | 2842920155 | 86 |
| 22 | iso_pu_bacteria | 2884338543 | 2884341771 | 86 |
| 23 | iso_pu_bacteria | 2904463128 | 2904464882 | 86 |
| 24 | iso_pu_bacteria | 2919085039 | 2919087477 | 86 |
| 25 | iso_pu_bacteria | 2919404418 | 2919406391 | 86 |
| 26 | iso_pu_bacteria | 2941471342 | 2941475461 | 86 |
| 27 | iso_pu_bacteria | 2953994433 | 2953995446 | 86 |
| 28 | 3300035086 | Ga0373934_0020125 | Ga0373934_0020125_944_1210 | 87 |
| 29 | 3300035118 | Ga0373954_0003745 | Ga0373954_0003745_1206_1472 | 87 |
| 30 | 3300035120 | Ga0373957_0036748 | Ga0373957_0036748_1442_1708 | 87 |
| 31 | 3300035172 | Ga0373955_0017110 | Ga0373955_0017110_1480_1746 | 87 |
| 32 | 3300035398 | Ga0316574_0605156 | Ga0316574_0605156_147_410 | 87 |
| 33 | 3300035410 | Ga0373924_0006176 | Ga0373924_0006176_1850_2116 | 87 |
| 34 | 3300035724 | Ga0373933_0068067 | Ga0373933_0068067_1057_1323 | 87 |
| 35 | 3300036401 | Ga0373937_0015132 | Ga0373937_0015132_1620_1886 | 87 |
| 36 | 3300036401 | Ga0373937_0515358 | Ga0373937_0515358_210_476 | 87 |
| 37 | 3300036647 | Ga0316582_0092634 | Ga0316582_0092634_18_281 | 87 |
| 38 | 3300046458 | Ga0495591_002496 | Ga0495591_002496_5058_5321 | 87 |
| 39 | 3300046491 | Ga0495584_0010788 | Ga0495584_0010788_614_877 | 87 |
| 40 | 3300046501 | Ga0495607_0009540 | Ga0495607_0009540_3737_4000 | 87 |
| 41 | 3300046501 | Ga0495607_0189857 | Ga0495607_0189857_433_702 | 87 |
| 42 | 3300046507 | Ga0495606_0001619 | Ga0495606_0001619_13805_14068 | 87 |
| 43 | 3300046507 | Ga0495606_0001846 | Ga0495606_0001846_23041_23310 | 87 |
| 44 | 3300046513 | Ga0495616_0013102 | Ga0495616_0013102_2495_2758 | 87 |
| 45 | 3300046518 | Ga0495631_0099291 | Ga0495631_0099291_134_403 | 87 |
| 46 | 3300046518 | Ga0495631_0245714 | Ga0495631_0245714_41_304 | 87 |
| 47 | 3300046522 | Ga0495643_0076134 | Ga0495643_0076134_1137_1400 | 87 |
| 48 | 3300046524 | Ga0495648_0014184 | Ga0495648_0014184_923_1186 | 87 |
| 49 | 3300046660 | Ga0495625_0008315 | Ga0495625_0008315_3785_4054 | 87 |
| 50 | 3300046675 | Ga0495657_0749146 | Ga0495657_0749146_96_362 | 87 |
| 51 | 3300046692 | Ga0495671_0009568 | Ga0495671_0009568_2583_2846 | 87 |
| 52 | 3300046794 | Ga0495589_0047433 | Ga0495589_0047433_889_1152 | 87 |
| 53 | 3300046810 | Ga0495660_0000019 | Ga0495660_0000019_62583_62846 | 87 |
| 54 | 3300047321 | Ga0495676_0806357 | Ga0495676_0806357_152_415 | 87 |
| 55 | 3300047323 | Ga0495683_0060141 | Ga0495683_0060141_682_945 | 87 |
| 56 | 3300047469 | Ga0495673_0000011 | Ga0495673_0000011_424944_425207 | 87 |
| 57 | 3300047472 | Ga0495686_0364558 | Ga0495686_0364558_134_403 | 87 |
| 58 | 3300048924 | Ga0496121_0013648 | Ga0496121_0013648_3021_3290 | 87 |
| 59 | 3300049459 | Ga0495678_000479 | Ga0495678_000479_25483_25746 | 87 |
| 60 | 3300049460 | Ga0495682_0000006 | Ga0495682_0000006_15782_16045 | 87 |
| 61 | 3300049581 | Ga0501047_0522885 | Ga0501047_0522885_261_524 | 87 |
| 62 | 3300053084 | Ga0495595_0332093 | Ga0495595_0332093_238_504 | 87 |
| 63 | 3300053126 | Ga0500621_000004 | Ga0500621_000004_236135_236398 | 87 |
| 64 | 3300003323 | rootH1_10088254 | rootH1_100882542 | 88 |
| 65 | 3300005367 | Ga0070667_101146090 | Ga0070667_1011460902 | 88 |
| 66 | 3300005563 | Ga0068855_100311355 | Ga0068855_1003113553 | 88 |
| 67 | 3300005617 | Ga0068859_100138341 | Ga0068859_1001383412 | 88 |
| 68 | 3300006931 | Ga0097620_100138346 | Ga0097620_1001383462 | 88 |
| 69 | 3300031616 | Ga0307508_10230769 | Ga0307508_102307693 | 88 |
| 70 | 3300031665 | Ga0316575_10013285 | Ga0316575_100132854 | 88 |
| 71 | 3300031691 | Ga0316579_10017166 | Ga0316579_100171662 | 88 |
| 72 | 3300031691 | Ga0316579_10297809 | Ga0316579_102978091 | 88 |
| 73 | 3300031727 | Ga0316576_10152582 | Ga0316576_101525822 | 88 |
| 74 | 3300031728 | Ga0316578_10040118 | Ga0316578_100401182 | 88 |
| 75 | 3300031730 | Ga0307516_10002273 | Ga0307516_1000227317 | 88 |
| 76 | 3300031733 | Ga0316577_10007159 | Ga0316577_100071594 | 88 |
| 77 | 3300032004 | Ga0307414_10814963 | Ga0307414_108149632 | 88 |
| 78 | 3300032137 | Ga0316585_10028239 | Ga0316585_100282393 | 88 |
| 79 | 3300032139 | Ga0316580_10035081 | Ga0316580_100350812 | 88 |
| 80 | 3300033524 | Ga0316592_1106644 | Ga0316592_11066442 | 88 |
| 81 | 3300033541 | Ga0316596_1157217 | Ga0316596_11572172 | 88 |
| 82 | 3300036647 | Ga0316582_0047091 | Ga0316582_0047091_1697_1966 | 88 |
| 83 | 3300039062 | Ga0400483_107877 | Ga0400483_107877_144_413 | 88 |
| 84 | 3300041443 | Ga0451789_0620140 | Ga0451789_0620140_895_1161 | 88 |
| 85 | 3300041453 | Ga0451797_0315433 | Ga0451797_0315433_833_1099 | 88 |
| 86 | 3300041453 | Ga0451797_1369500 | Ga0451797_1369500_16_282 | 88 |
| 87 | 3300041459 | Ga0451800_1434890 | Ga0451800_1434890_73_339 | 88 |
| 88 | 3300041460 | Ga0451802_0188506 | Ga0451802_0188506_321_587 | 88 |
| 89 | 3300041486 | Ga0451807_0115392 | Ga0451807_0115392_4258_4524 | 88 |
| 90 | 3300041491 | Ga0451833_1442070 | Ga0451833_1442070_141_407 | 88 |
| 91 | 3300041511 | Ga0451855_1120302 | Ga0451855_1120302_32_298 | 88 |
| 92 | 3300044901 | Ga0466960_0052483 | Ga0466960_0052483_443_709 | 88 |
| 93 | 3300049583 | Ga0501067_0126310 | Ga0501067_0126310_1004_1309 | 88 |
| 94 | 3300049589 | Ga0501073_0722615 | Ga0501073_0722615_362_628 | 88 |
| 95 | 3300049742 | Ga0501080_0280904 | Ga0501080_0280904_1178_1444 | 88 |
| 96 | 3300061719 | Ga0466962_0656767 | Ga0466962_0656767_232_522 | 88 |
| 97 | 3300003323 | rootH1_10017453 | rootH1_100174533 | 89 |
| 98 | 3300004798 | Ga0058859_11615505 | Ga0058859_116155051 | 89 |
| 99 | 3300004801 | Ga0058860_12100890 | Ga0058860_121008901 | 89 |
| 100 | 3300005338 | Ga0068868_101308476 | Ga0068868_1013084762 | 89 |
| 101 | 3300005343 | Ga0070687_101018642 | Ga0070687_1010186422 | 89 |
| 102 | 3300005441 | Ga0070700_100997334 | Ga0070700_1009973342 | 89 |
| 103 | 3300005459 | Ga0068867_100557629 | Ga0068867_1005576291 | 89 |
| 104 | 3300005466 | Ga0070685_10025649 | Ga0070685_100256493 | 89 |
| 105 | 3300005563 | Ga0068855_100000078 | Ga0068855_10000007858 | 89 |
| 106 | 3300005615 | Ga0070702_100135199 | Ga0070702_1001351993 | 89 |
| 107 | 3300005618 | Ga0068864_102640006 | Ga0068864_1026400061 | 89 |
| 108 | 3300005840 | Ga0068870_10198846 | Ga0068870_101988462 | 89 |
| 109 | 3300005841 | Ga0068863_101491569 | Ga0068863_1014915691 | 89 |
| 110 | 3300006048 | Ga0075363_100109275 | Ga0075363_1001092751 | 89 |
| 111 | 3300006195 | Ga0075366_10017805 | Ga0075366_100178055 | 89 |
| 112 | 3300006237 | Ga0097621_100122229 | Ga0097621_1001222293 | 89 |
| 113 | 3300006881 | Ga0068865_100210062 | Ga0068865_1002100622 | 89 |
| 114 | 3300009094 | Ga0111539_10737058 | Ga0111539_107370581 | 89 |
| 115 | 3300009094 | Ga0111539_12511916 | Ga0111539_125119162 | 89 |
| 116 | 3300009551 | Ga0105238_12484495 | Ga0105238_124844952 | 89 |
| 117 | 3300014969 | Ga0157376_10049620 | Ga0157376_100496205 | 89 |
| 118 | 3300020078 | Ga0206352_10691753 | Ga0206352_106917532 | 89 |
| 119 | 3300021384 | Ga0213876_10437183 | Ga0213876_104371832 | 89 |
| 120 | 3300025908 | Ga0207643_10227401 | Ga0207643_102274012 | 89 |
| 121 | 3300025941 | Ga0207711_10829711 | Ga0207711_108297112 | 89 |
| 122 | 3300025942 | Ga0207689_10568554 | Ga0207689_105685542 | 89 |
| 123 | 3300025949 | Ga0207667_10000124 | Ga0207667_1000012485 | 89 |
| 124 | 3300025981 | Ga0207640_11436509 | Ga0207640_114365092 | 89 |
| 125 | 3300026023 | Ga0207677_10306264 | Ga0207677_103062642 | 89 |
| 126 | 3300026095 | Ga0207676_10756685 | Ga0207676_107566851 | 89 |
| 127 | 3300028380 | Ga0268265_11649230 | Ga0268265_116492302 | 89 |
| 128 | 3300028794 | Ga0307515_10624505 | Ga0307515_106245051 | 89 |
| 129 | 3300031249 | Ga0265339_10000061 | Ga0265339_1000006166 | 89 |
| 130 | 3300031250 | Ga0265331_10586799 | Ga0265331_105867992 | 89 |
| 131 | 3300031344 | Ga0265316_10000396 | Ga0265316_1000039619 | 89 |
| 132 | 3300031548 | Ga0307408_101447585 | Ga0307408_1014475851 | 89 |
| 133 | 3300031711 | Ga0265314_10000011 | Ga0265314_10000011157 | 89 |
| 134 | 3300031731 | Ga0307405_10979663 | Ga0307405_109796631 | 89 |
| 135 | 3300031852 | Ga0307410_10959805 | Ga0307410_109598052 | 89 |
| 136 | 3300039437 | Ga0436365_1211373 | Ga0436365_1211373_1686_1955 | 89 |
| 137 | 3300041451 | Ga0451791_0387075 | Ga0451791_0387075_153_422 | 89 |
| 138 | 3300041452 | Ga0451793_1461656 | Ga0451793_1461656_187_456 | 89 |
| 139 | 3300041453 | Ga0451797_0358766 | Ga0451797_0358766_134_403 | 89 |
| 140 | 3300041453 | Ga0451797_1369500 | Ga0451797_1369500_369_638 | 89 |
| 141 | 3300041458 | Ga0451798_0562695 | Ga0451798_0562695_412_681 | 89 |
| 142 | 3300041486 | Ga0451807_0549023 | Ga0451807_0549023_142_411 | 89 |
| 143 | 3300041486 | Ga0451807_2382850 | Ga0451807_2382850_19_288 | 89 |
| 144 | 3300041494 | Ga0451837_0937759 | Ga0451837_0937759_133_402 | 89 |
| 145 | 3300041507 | Ga0451851_0246198 | Ga0451851_0246198_418_687 | 89 |
| 146 | 3300041509 | Ga0451843_1635939 | Ga0451843_1635939_196_465 | 89 |
| 147 | 3300041512 | Ga0451853_1187429 | Ga0451853_1187429_89_358 | 89 |
| 148 | 3300041512 | Ga0451853_3841156 | Ga0451853_3841156_97_366 | 89 |
| 149 | 3300047320 | Ga0495672_0211098 | Ga0495672_0211098_426_695 | 89 |
| 150 | 3300048918 | Ga0496115_0000387 | Ga0496115_0000387_7063_7332 | 89 |
| 151 | 3300048929 | Ga0496126_0000835 | Ga0496126_0000835_21413_21682 | 89 |
| 152 | 3300049581 | Ga0501047_0087722 | Ga0501047_0087722_1152_1460 | 89 |
| 153 | 3300049586 | Ga0501070_0375392 | Ga0501070_0375392_270_578 | 89 |
| 154 | 3300049587 | Ga0501071_0072307 | Ga0501071_0072307_215_484 | 89 |
| 155 | 3300049589 | Ga0501073_0018182 | Ga0501073_0018182_1283_1576 | 89 |
| 156 | 3300049591 | Ga0501075_0815359 | Ga0501075_0815359_11_280 | 89 |
| 157 | 3300049593 | Ga0501077_0377743 | Ga0501077_0377743_347_640 | 89 |
| 158 | 3300049742 | Ga0501080_0109945 | Ga0501080_0109945_2215_2484 | 89 |
| 159 | 3300049744 | Ga0501083_0497734 | Ga0501083_0497734_55_324 | 89 |
| 160 | 3300049822 | Ga0501035_0113464 | Ga0501035_0113464_1352_1621 | 89 |
| 161 | 3300050489 | nmdc:mga03683_655392_c1 | nmdc:mga03683_655392_c1_37_306 | 89 |
| 162 | 3300050491 | nmdc:mga00v17_610761_c1 | nmdc:mga00v17_610761_c1_364_633 | 89 |
| 163 | 3300050493 | nmdc:mga0k408_9218_c1 | nmdc:mga0k408_9218_c1_1338_1607 | 89 |
| 164 | 3300050508 | nmdc:mga09592_971813_c1 | nmdc:mga09592_971813_c1_332_601 | 89 |
| 165 | 3300053146 | Ga0500588_0225040 | Ga0500588_0225040_300_569 | 89 |
| 166 | 3300054114 | Ga0501084_0274242 | Ga0501084_0274242_1004_1273 | 89 |
| 167 | 3300054114 | Ga0501084_1760045 | Ga0501084_1760045_107_376 | 89 |
| 168 | 3300059643 | Ga0587072_149826 | Ga0587072_149826_245_514 | 89 |
| 169 | 3300001904 | JGI24736J21556_1029647 | JGI24736J21556_10296472 | 90 |
| 170 | 3300002737 | JGI25162J39368_1020736 | JGI25162J39368_10207361 | 90 |
| 171 | 3300002773 | JGI25152J39213_1049024 | JGI25152J39213_10490242 | 90 |
| 172 | 3300003214 | JGI25165J46597_1008854 | JGI25165J46597_10088542 | 90 |
| 173 | 3300003578 | Ga0006562J51391_1099466 | Ga0006562J51391_10994661 | 90 |
| 174 | 3300003856 | Ga0058692_1005461 | Ga0058692_10054612 | 90 |
| 175 | 3300004625 | Ga0055543_1011606 | Ga0055543_10116062 | 90 |
| 176 | 3300005262 | Ga0065165_1000260 | Ga0065165_100026015 | 90 |
| 177 | 3300005327 | Ga0070658_10240707 | Ga0070658_102407071 | 90 |
| 178 | 3300005327 | Ga0070658_10413787 | Ga0070658_104137872 | 90 |
| 179 | 3300005327 | Ga0070658_11268747 | Ga0070658_112687471 | 90 |
| 180 | 3300005328 | Ga0070676_10466687 | Ga0070676_104666872 | 90 |
| 181 | 3300005331 | Ga0070670_100197512 | Ga0070670_1001975122 | 90 |
| 182 | 3300005334 | Ga0068869_100267896 | Ga0068869_1002678962 | 90 |
| 183 | 3300005334 | Ga0068869_100629881 | Ga0068869_1006298812 | 90 |
| 184 | 3300005334 | Ga0068869_101005301 | Ga0068869_1010053012 | 90 |
| 185 | 3300005335 | Ga0070666_10000742 | Ga0070666_100007422 | 90 |
| 186 | 3300005335 | Ga0070666_10072315 | Ga0070666_100723152 | 90 |
| 187 | 3300005335 | Ga0070666_10195517 | Ga0070666_101955172 | 90 |
| 188 | 3300005338 | Ga0068868_102145478 | Ga0068868_1021454782 | 90 |
| 189 | 3300005340 | Ga0070689_100917237 | Ga0070689_1009172372 | 90 |
| 190 | 3300005344 | Ga0070661_100089903 | Ga0070661_1000899033 | 90 |
| 191 | 3300005344 | Ga0070661_100364863 | Ga0070661_1003648632 | 90 |
| 192 | 3300005347 | Ga0070668_100125371 | Ga0070668_1001253713 | 90 |
| 193 | 3300005347 | Ga0070668_100297059 | Ga0070668_1002970594 | 90 |
| 194 | 3300005347 | Ga0070668_101039478 | Ga0070668_1010394782 | 90 |
| 195 | 3300005353 | Ga0070669_100280726 | Ga0070669_1002807263 | 90 |
| 196 | 3300005354 | Ga0070675_100276276 | Ga0070675_1002762761 | 90 |
| 197 | 3300005355 | Ga0070671_100829822 | Ga0070671_1008298222 | 90 |
| 198 | 3300005356 | Ga0070674_102081129 | Ga0070674_1020811292 | 90 |
| 199 | 3300005364 | Ga0070673_100187164 | Ga0070673_1001871643 | 90 |
| 200 | 3300005365 | Ga0070688_100094178 | Ga0070688_1000941782 | 90 |
| 201 | 3300005367 | Ga0070667_100855423 | Ga0070667_1008554231 | 90 |
| 202 | 3300005367 | Ga0070667_101815184 | Ga0070667_1018151842 | 90 |
| 203 | 3300005455 | Ga0070663_100527976 | Ga0070663_1005279762 | 90 |
| 204 | 3300005455 | Ga0070663_100656638 | Ga0070663_1006566382 | 90 |
| 205 | 3300005455 | Ga0070663_100811358 | Ga0070663_1008113582 | 90 |
| 206 | 3300005456 | Ga0070678_100412452 | Ga0070678_1004124522 | 90 |
| 207 | 3300005457 | Ga0070662_100094370 | Ga0070662_1000943702 | 90 |
| 208 | 3300005457 | Ga0070662_100107522 | Ga0070662_1001075225 | 90 |
| 209 | 3300005459 | Ga0068867_100282825 | Ga0068867_1002828252 | 90 |
| 210 | 3300005459 | Ga0068867_100468820 | Ga0068867_1004688202 | 90 |
| 211 | 3300005466 | Ga0070685_10000205 | Ga0070685_1000020529 | 90 |
| 212 | 3300005466 | Ga0070685_10527167 | Ga0070685_105271672 | 90 |
| 213 | 3300005536 | Ga0070697_100522567 | Ga0070697_1005225672 | 90 |
| 214 | 3300005539 | Ga0068853_100036621 | Ga0068853_1000366211 | 90 |
| 215 | 3300005547 | Ga0070693_100001735 | Ga0070693_1000017355 | 90 |
| 216 | 3300005548 | Ga0070665_100000326 | Ga0070665_10000032653 | 90 |
| 217 | 3300005548 | Ga0070665_102168627 | Ga0070665_1021686271 | 90 |
| 218 | 3300005563 | Ga0068855_100024697 | Ga0068855_1000246974 | 90 |
| 219 | 3300005577 | Ga0068857_100824830 | Ga0068857_1008248302 | 90 |
| 220 | 3300005577 | Ga0068857_100870366 | Ga0068857_1008703662 | 90 |
| 221 | 3300005578 | Ga0068854_100025225 | Ga0068854_1000252252 | 90 |
| 222 | 3300005614 | Ga0068856_100010035 | Ga0068856_1000100358 | 90 |
| 223 | 3300005614 | Ga0068856_100134763 | Ga0068856_1001347632 | 90 |
| 224 | 3300005616 | Ga0068852_100017329 | Ga0068852_1000173292 | 90 |
| 225 | 3300005616 | Ga0068852_100168879 | Ga0068852_1001688792 | 90 |
| 226 | 3300005616 | Ga0068852_100201958 | Ga0068852_1002019582 | 90 |
| 227 | 3300005616 | Ga0068852_100238973 | Ga0068852_1002389732 | 90 |
| 228 | 3300005616 | Ga0068852_100340245 | Ga0068852_1003402452 | 90 |
| 229 | 3300005616 | Ga0068852_100359881 | Ga0068852_1003598812 | 90 |
| 230 | 3300005616 | Ga0068852_101432808 | Ga0068852_1014328082 | 90 |
| 231 | 3300005617 | Ga0068859_100215218 | Ga0068859_1002152183 | 90 |
| 232 | 3300005618 | Ga0068864_101236888 | Ga0068864_1012368882 | 90 |
| 233 | 3300005834 | Ga0068851_10003057 | Ga0068851_1000305710 | 90 |
| 234 | 3300005834 | Ga0068851_10513861 | Ga0068851_105138611 | 90 |
| 235 | 3300005840 | Ga0068870_10503358 | Ga0068870_105033582 | 90 |
| 236 | 3300005841 | Ga0068863_100027548 | Ga0068863_1000275487 | 90 |
| 237 | 3300005842 | Ga0068858_100001013 | Ga0068858_1000010139 | 90 |
| 238 | 3300005842 | Ga0068858_100320312 | Ga0068858_1003203122 | 90 |
| 239 | 3300005843 | Ga0068860_100533507 | Ga0068860_1005335072 | 90 |
| 240 | 3300006028 | Ga0070717_10269813 | Ga0070717_102698132 | 90 |
| 241 | 3300006186 | Ga0075369_10029070 | Ga0075369_100290702 | 90 |
| 242 | 3300006186 | Ga0075369_10069143 | Ga0075369_100691431 | 90 |
| 243 | 3300006237 | Ga0097621_100189583 | Ga0097621_1001895832 | 90 |
| 244 | 3300006237 | Ga0097621_100547377 | Ga0097621_1005473772 | 90 |
| 245 | 3300006237 | Ga0097621_101714959 | Ga0097621_1017149591 | 90 |
| 246 | 3300006358 | Ga0068871_100042692 | Ga0068871_1000426923 | 90 |
| 247 | 3300006358 | Ga0068871_100081029 | Ga0068871_1000810292 | 90 |
| 248 | 3300006358 | Ga0068871_100173286 | Ga0068871_1001732862 | 90 |
| 249 | 3300006358 | Ga0068871_100443409 | Ga0068871_1004434092 | 90 |
| 250 | 3300006881 | Ga0068865_100004902 | Ga0068865_1000049028 | 90 |
| 251 | 3300006881 | Ga0068865_100857375 | Ga0068865_1008573753 | 90 |
| 252 | 3300006931 | Ga0097620_100215215 | Ga0097620_1002152152 | 90 |
| 253 | 3300009093 | Ga0105240_10000669 | Ga0105240_1000066964 | 90 |
| 254 | 3300009093 | Ga0105240_10483933 | Ga0105240_104839332 | 90 |
| 255 | 3300009093 | Ga0105240_11016058 | Ga0105240_110160582 | 90 |
| 256 | 3300009098 | Ga0105245_10260673 | Ga0105245_102606732 | 90 |
| 257 | 3300009098 | Ga0105245_10974587 | Ga0105245_109745872 | 90 |
| 258 | 3300009101 | Ga0105247_10069032 | Ga0105247_100690325 | 90 |
| 259 | 3300009148 | Ga0105243_11047576 | Ga0105243_110475762 | 90 |
| 260 | 3300009174 | Ga0105241_10011914 | Ga0105241_100119144 | 90 |
| 261 | 3300009174 | Ga0105241_10304357 | Ga0105241_103043572 | 90 |
| 262 | 3300009176 | Ga0105242_10119069 | Ga0105242_101190692 | 90 |
| 263 | 3300009176 | Ga0105242_10740788 | Ga0105242_107407882 | 90 |
| 264 | 3300009176 | Ga0105242_11655181 | Ga0105242_116551812 | 90 |
| 265 | 3300009177 | Ga0105248_11677650 | Ga0105248_116776502 | 90 |
| 266 | 3300009545 | Ga0105237_10196553 | Ga0105237_101965532 | 90 |
| 267 | 3300009545 | Ga0105237_10344685 | Ga0105237_103446852 | 90 |
| 268 | 3300009545 | Ga0105237_10488869 | Ga0105237_104888692 | 90 |
| 269 | 3300009545 | Ga0105237_11036382 | Ga0105237_110363822 | 90 |
| 270 | 3300009545 | Ga0105237_11831889 | Ga0105237_118318891 | 90 |
| 271 | 3300009551 | Ga0105238_10015295 | Ga0105238_100152952 | 90 |
| 272 | 3300009551 | Ga0105238_10035481 | Ga0105238_100354816 | 90 |
| 273 | 3300009551 | Ga0105238_10083466 | Ga0105238_100834663 | 90 |
| 274 | 3300009551 | Ga0105238_10335484 | Ga0105238_103354842 | 90 |
| 275 | 3300009551 | Ga0105238_10658459 | Ga0105238_106584592 | 90 |
| 276 | 3300009551 | Ga0105238_11385265 | Ga0105238_113852651 | 90 |
| 277 | 3300009551 | Ga0105238_12951911 | Ga0105238_129519112 | 90 |
| 278 | 3300009553 | Ga0105249_10011129 | Ga0105249_100111292 | 90 |
| 279 | 3300010375 | Ga0105239_10018464 | Ga0105239_100184647 | 90 |
| 280 | 3300010375 | Ga0105239_10180374 | Ga0105239_101803742 | 90 |
| 281 | 3300010375 | Ga0105239_10405167 | Ga0105239_104051673 | 90 |
| 282 | 3300010375 | Ga0105239_10942375 | Ga0105239_109423751 | 90 |
| 283 | 3300011119 | Ga0105246_12594422 | Ga0105246_125944221 | 90 |
| 284 | 3300013104 | Ga0157370_10026574 | Ga0157370_100265744 | 90 |
| 285 | 3300013104 | Ga0157370_10116048 | Ga0157370_101160485 | 90 |
| 286 | 3300013104 | Ga0157370_10153048 | Ga0157370_101530483 | 90 |
| 287 | 3300013104 | Ga0157370_10182816 | Ga0157370_101828165 | 90 |
| 288 | 3300013104 | Ga0157370_10455417 | Ga0157370_104554172 | 90 |
| 289 | 3300013105 | Ga0157369_10022557 | Ga0157369_100225574 | 90 |
| 290 | 3300013105 | Ga0157369_10110918 | Ga0157369_101109184 | 90 |
| 291 | 3300013296 | Ga0157374_10146969 | Ga0157374_101469692 | 90 |
| 292 | 3300013296 | Ga0157374_11060161 | Ga0157374_110601612 | 90 |
| 293 | 3300013297 | Ga0157378_10000158 | Ga0157378_1000015830 | 90 |
| 294 | 3300013297 | Ga0157378_10043597 | Ga0157378_100435974 | 90 |
| 295 | 3300013297 | Ga0157378_10918393 | Ga0157378_109183932 | 90 |
| 296 | 3300013306 | Ga0163162_10206003 | Ga0163162_102060032 | 90 |
| 297 | 3300013307 | Ga0157372_10121872 | Ga0157372_101218722 | 90 |
| 298 | 3300013308 | Ga0157375_10014871 | Ga0157375_100148717 | 90 |
| 299 | 3300013308 | Ga0157375_10389301 | Ga0157375_103893012 | 90 |
| 300 | 3300013308 | Ga0157375_10535464 | Ga0157375_105354642 | 90 |
| 301 | 3300014325 | Ga0163163_10000415 | Ga0163163_1000041510 | 90 |
| 302 | 3300014325 | Ga0163163_11517169 | Ga0163163_115171692 | 90 |
| 303 | 3300014326 | Ga0157380_10128383 | Ga0157380_101283832 | 90 |
| 304 | 3300014326 | Ga0157380_12909621 | Ga0157380_129096212 | 90 |
| 305 | 3300014497 | Ga0182008_10001870 | Ga0182008_1000187010 | 90 |
| 306 | 3300014497 | Ga0182008_10007165 | Ga0182008_100071652 | 90 |
| 307 | 3300014497 | Ga0182008_10538076 | Ga0182008_105380762 | 90 |
| 308 | 3300014968 | Ga0157379_11566227 | Ga0157379_115662272 | 90 |
| 309 | 3300014969 | Ga0157376_10007397 | Ga0157376_100073975 | 90 |
| 310 | 3300014969 | Ga0157376_10013837 | Ga0157376_100138373 | 90 |
| 311 | 3300014969 | Ga0157376_10220949 | Ga0157376_102209492 | 90 |
| 312 | 3300015261 | Ga0182006_1000148 | Ga0182006_100014817 | 90 |
| 313 | 3300015261 | Ga0182006_1000764 | Ga0182006_100076418 | 90 |
| 314 | 3300015262 | Ga0182007_10022089 | Ga0182007_100220893 | 90 |
| 315 | 3300015262 | Ga0182007_10149377 | Ga0182007_101493772 | 90 |
| 316 | 3300015265 | Ga0182005_1000138 | Ga0182005_100013830 | 90 |
| 317 | 3300015265 | Ga0182005_1000821 | Ga0182005_10008212 | 90 |
| 318 | 3300015265 | Ga0182005_1013927 | Ga0182005_10139273 | 90 |
| 319 | 3300017792 | Ga0163161_10013899 | Ga0163161_100138996 | 90 |
| 320 | 3300020082 | Ga0206353_10323706 | Ga0206353_103237062 | 90 |
| 321 | 3300021384 | Ga0213876_10370448 | Ga0213876_103704482 | 90 |
| 322 | 3300025226 | Ga0209674_100762 | Ga0209674_1007625 | 90 |
| 323 | 3300025254 | Ga0209148_1001376 | Ga0209148_100137611 | 90 |
| 324 | 3300025258 | Ga0209129_1002303 | Ga0209129_10023033 | 90 |
| 325 | 3300025261 | Ga0209233_1006128 | Ga0209233_10061282 | 90 |
| 326 | 3300025299 | Ga0209256_1011917 | Ga0209256_10119173 | 90 |
| 327 | 3300025303 | Ga0209051_1033416 | Ga0209051_10334163 | 90 |
| 328 | 3300025304 | Ga0209257_1004136 | Ga0209257_10041364 | 90 |
| 329 | 3300025321 | Ga0207656_10006516 | Ga0207656_100065163 | 90 |
| 330 | 3300025321 | Ga0207656_10217105 | Ga0207656_102171052 | 90 |
| 331 | 3300025900 | Ga0207710_10034219 | Ga0207710_100342192 | 90 |
| 332 | 3300025900 | Ga0207710_10216258 | Ga0207710_102162582 | 90 |
| 333 | 3300025903 | Ga0207680_10008110 | Ga0207680_100081108 | 90 |
| 334 | 3300025903 | Ga0207680_10028578 | Ga0207680_100285784 | 90 |
| 335 | 3300025903 | Ga0207680_10033449 | Ga0207680_100334492 | 90 |
| 336 | 3300025903 | Ga0207680_10342538 | Ga0207680_103425382 | 90 |
| 337 | 3300025904 | Ga0207647_10000008 | Ga0207647_10000008107 | 90 |
| 338 | 3300025904 | Ga0207647_10002496 | Ga0207647_1000249610 | 90 |
| 339 | 3300025907 | Ga0207645_10021426 | Ga0207645_100214266 | 90 |
| 340 | 3300025908 | Ga0207643_10534763 | Ga0207643_105347631 | 90 |
| 341 | 3300025909 | Ga0207705_10287724 | Ga0207705_102877242 | 90 |
| 342 | 3300025909 | Ga0207705_11472947 | Ga0207705_114729471 | 90 |
| 343 | 3300025911 | Ga0207654_10152482 | Ga0207654_101524822 | 90 |
| 344 | 3300025911 | Ga0207654_11086175 | Ga0207654_110861752 | 90 |
| 345 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014322 | 90 |
| 346 | 3300025913 | Ga0207695_10002028 | Ga0207695_1000202822 | 90 |
| 347 | 3300025913 | Ga0207695_10762853 | Ga0207695_107628532 | 90 |
| 348 | 3300025920 | Ga0207649_10126540 | Ga0207649_101265403 | 90 |
| 349 | 3300025920 | Ga0207649_10241097 | Ga0207649_102410972 | 90 |
| 350 | 3300025920 | Ga0207649_11121452 | Ga0207649_111214522 | 90 |
| 351 | 3300025923 | Ga0207681_10238971 | Ga0207681_102389712 | 90 |
| 352 | 3300025924 | Ga0207694_10005098 | Ga0207694_1000509815 | 90 |
| 353 | 3300025924 | Ga0207694_10007511 | Ga0207694_100075118 | 90 |
| 354 | 3300025924 | Ga0207694_10092650 | Ga0207694_100926502 | 90 |
| 355 | 3300025924 | Ga0207694_10123407 | Ga0207694_101234071 | 90 |
| 356 | 3300025924 | Ga0207694_10582258 | Ga0207694_105822582 | 90 |
| 357 | 3300025925 | Ga0207650_10040621 | Ga0207650_100406214 | 90 |
| 358 | 3300025925 | Ga0207650_11740392 | Ga0207650_117403921 | 90 |
| 359 | 3300025926 | Ga0207659_10297963 | Ga0207659_102979632 | 90 |
| 360 | 3300025931 | Ga0207644_10477187 | Ga0207644_104771872 | 90 |
| 361 | 3300025931 | Ga0207644_11349213 | Ga0207644_113492131 | 90 |
| 362 | 3300025932 | Ga0207690_11007956 | Ga0207690_110079561 | 90 |
| 363 | 3300025933 | Ga0207706_10006474 | Ga0207706_100064748 | 90 |
| 364 | 3300025933 | Ga0207706_10288932 | Ga0207706_102889323 | 90 |
| 365 | 3300025934 | Ga0207686_10032376 | Ga0207686_100323761 | 90 |
| 366 | 3300025934 | Ga0207686_11567228 | Ga0207686_115672282 | 90 |
| 367 | 3300025935 | Ga0207709_10324791 | Ga0207709_103247914 | 90 |
| 368 | 3300025936 | Ga0207670_10182421 | Ga0207670_101824213 | 90 |
| 369 | 3300025938 | Ga0207704_10015776 | Ga0207704_100157762 | 90 |
| 370 | 3300025938 | Ga0207704_10050293 | Ga0207704_100502933 | 90 |
| 371 | 3300025938 | Ga0207704_10092087 | Ga0207704_100920872 | 90 |
| 372 | 3300025938 | Ga0207704_11869776 | Ga0207704_118697762 | 90 |
| 373 | 3300025940 | Ga0207691_11470612 | Ga0207691_114706122 | 90 |
| 374 | 3300025941 | Ga0207711_11222579 | Ga0207711_112225792 | 90 |
| 375 | 3300025942 | Ga0207689_10148749 | Ga0207689_101487492 | 90 |
| 376 | 3300025942 | Ga0207689_10175680 | Ga0207689_101756802 | 90 |
| 377 | 3300025942 | Ga0207689_10407809 | Ga0207689_104078092 | 90 |
| 378 | 3300025945 | Ga0207679_11754773 | Ga0207679_117547732 | 90 |
| 379 | 3300025949 | Ga0207667_10089902 | Ga0207667_100899024 | 90 |
| 380 | 3300025949 | Ga0207667_10233666 | Ga0207667_102336663 | 90 |
| 381 | 3300025961 | Ga0207712_10007905 | Ga0207712_100079057 | 90 |
| 382 | 3300025972 | Ga0207668_10443731 | Ga0207668_104437312 | 90 |
| 383 | 3300025972 | Ga0207668_10569931 | Ga0207668_105699313 | 90 |
| 384 | 3300025981 | Ga0207640_10207846 | Ga0207640_102078462 | 90 |
| 385 | 3300025981 | Ga0207640_10908364 | Ga0207640_109083642 | 90 |
| 386 | 3300025986 | Ga0207658_10145265 | Ga0207658_101452652 | 90 |
| 387 | 3300025986 | Ga0207658_10146137 | Ga0207658_101461372 | 90 |
| 388 | 3300025986 | Ga0207658_10181618 | Ga0207658_101816184 | 90 |
| 389 | 3300025986 | Ga0207658_11293452 | Ga0207658_112934521 | 90 |
| 390 | 3300026023 | Ga0207677_10639727 | Ga0207677_106397272 | 90 |
| 391 | 3300026023 | Ga0207677_10667596 | Ga0207677_106675962 | 90 |
| 392 | 3300026035 | Ga0207703_10002988 | Ga0207703_100029889 | 90 |
| 393 | 3300026035 | Ga0207703_10265457 | Ga0207703_102654572 | 90 |
| 394 | 3300026041 | Ga0207639_10000398 | Ga0207639_1000039817 | 90 |
| 395 | 3300026041 | Ga0207639_11699959 | Ga0207639_116999592 | 90 |
| 396 | 3300026041 | Ga0207639_11962518 | Ga0207639_119625181 | 90 |
| 397 | 3300026067 | Ga0207678_10140849 | Ga0207678_101408492 | 90 |
| 398 | 3300026067 | Ga0207678_10244971 | Ga0207678_102449712 | 90 |
| 399 | 3300026067 | Ga0207678_11792618 | Ga0207678_117926181 | 90 |
| 400 | 3300026078 | Ga0207702_10016655 | Ga0207702_100166553 | 90 |
| 401 | 3300026078 | Ga0207702_10022797 | Ga0207702_100227974 | 90 |
| 402 | 3300026078 | Ga0207702_10942821 | Ga0207702_109428212 | 90 |
| 403 | 3300026078 | Ga0207702_11865032 | Ga0207702_118650322 | 90 |
| 404 | 3300026088 | Ga0207641_10064699 | Ga0207641_100646993 | 90 |
| 405 | 3300026089 | Ga0207648_10078882 | Ga0207648_100788823 | 90 |
| 406 | 3300026089 | Ga0207648_10142765 | Ga0207648_101427652 | 90 |
| 407 | 3300026089 | Ga0207648_10158841 | Ga0207648_101588412 | 90 |
| 408 | 3300026095 | Ga0207676_11196605 | Ga0207676_111966052 | 90 |
| 409 | 3300026116 | Ga0207674_10149424 | Ga0207674_101494242 | 90 |
| 410 | 3300026142 | Ga0207698_10015225 | Ga0207698_100152252 | 90 |
| 411 | 3300026142 | Ga0207698_10095932 | Ga0207698_100959322 | 90 |
| 412 | 3300026142 | Ga0207698_10502424 | Ga0207698_105024242 | 90 |
| 413 | 3300026142 | Ga0207698_10532968 | Ga0207698_105329682 | 90 |
| 414 | 3300026142 | Ga0207698_11409804 | Ga0207698_114098041 | 90 |
| 415 | 3300026142 | Ga0207698_11435345 | Ga0207698_114353452 | 90 |
| 416 | 3300026142 | Ga0207698_11794506 | Ga0207698_117945061 | 90 |
| 417 | 3300028379 | Ga0268266_10000013 | Ga0268266_1000001359 | 90 |
| 418 | 3300028379 | Ga0268266_10993599 | Ga0268266_109935992 | 90 |
| 419 | 3300028381 | Ga0268264_10319828 | Ga0268264_103198283 | 90 |
| 420 | 3300031507 | Ga0307509_10148769 | Ga0307509_101487693 | 90 |
| 421 | 3300031548 | Ga0307408_100520887 | Ga0307408_1005208872 | 90 |
| 422 | 3300031616 | Ga0307508_10390884 | Ga0307508_103908842 | 90 |
| 423 | 3300031616 | Ga0307508_10608490 | Ga0307508_106084902 | 90 |
| 424 | 3300031730 | Ga0307516_10016196 | Ga0307516_100161962 | 90 |
| 425 | 3300031731 | Ga0307405_10376174 | Ga0307405_103761742 | 90 |
| 426 | 3300031733 | Ga0316577_10106903 | Ga0316577_101069032 | 90 |
| 427 | 3300031733 | Ga0316577_10738316 | Ga0316577_107383162 | 90 |
| 428 | 3300031824 | Ga0307413_10303509 | Ga0307413_103035092 | 90 |
| 429 | 3300031838 | Ga0307518_10434202 | Ga0307518_104342022 | 90 |
| 430 | 3300031852 | Ga0307410_10996593 | Ga0307410_109965932 | 90 |
| 431 | 3300031901 | Ga0307406_10365892 | Ga0307406_103658922 | 90 |
| 432 | 3300031911 | Ga0307412_10000549 | Ga0307412_100005493 | 90 |
| 433 | 3300031911 | Ga0307412_10041548 | Ga0307412_100415484 | 90 |
| 434 | 3300031911 | Ga0307412_10425233 | Ga0307412_104252332 | 90 |
| 435 | 3300032002 | Ga0307416_100116106 | Ga0307416_1001161063 | 90 |
| 436 | 3300032004 | Ga0307414_12252793 | Ga0307414_122527932 | 90 |
| 437 | 3300032005 | Ga0307411_10964652 | Ga0307411_109646522 | 90 |
| 438 | 3300032005 | Ga0307411_10999197 | Ga0307411_109991972 | 90 |
| 439 | 3300033179 | Ga0307507_10167251 | Ga0307507_101672512 | 90 |
| 440 | 3300035089 | Ga0373944_0313865 | Ga0373944_0313865_85_357 | 90 |
| 441 | 3300035113 | Ga0373936_0056676 | Ga0373936_0056676_669_941 | 90 |
| 442 | 3300035118 | Ga0373954_0223316 | Ga0373954_0223316_493_765 | 90 |
| 443 | 3300035170 | Ga0373943_0841500 | Ga0373943_0841500_20_292 | 90 |
| 444 | 3300035172 | Ga0373955_0133076 | Ga0373955_0133076_675_947 | 90 |
| 445 | 3300035398 | Ga0316574_0458075 | Ga0316574_0458075_109_381 | 90 |
| 446 | 3300035695 | Ga0373927_0238871 | Ga0373927_0238871_325_597 | 90 |
| 447 | 3300035695 | Ga0373927_0806139 | Ga0373927_0806139_150_425 | 90 |
| 448 | 3300036401 | Ga0373937_0123959 | Ga0373937_0123959_784_1056 | 90 |
| 449 | 3300039437 | Ga0436365_1692091 | Ga0436365_1692091_305_577 | 90 |
| 450 | 3300041404 | Ga0439436_0000022 | Ga0439436_0000022_5283_5561 | 90 |
| 451 | 3300041404 | Ga0439436_0050823 | Ga0439436_0050823_108_386 | 90 |
| 452 | 3300041413 | Ga0439465_0015525 | Ga0439465_0015525_353_631 | 90 |
| 453 | 3300041443 | Ga0451789_0715167 | Ga0451789_0715167_209_481 | 90 |
| 454 | 3300041453 | Ga0451797_0951503 | Ga0451797_0951503_323_598 | 90 |
| 455 | 3300041460 | Ga0451802_0760078 | Ga0451802_0760078_113_385 | 90 |
| 456 | 3300041486 | Ga0451807_2006261 | Ga0451807_2006261_109_381 | 90 |
| 457 | 3300041486 | Ga0451807_2603317 | Ga0451807_2603317_50_355 | 90 |
| 458 | 3300041494 | Ga0451837_0932555 | Ga0451837_0932555_3116_3391 | 90 |
| 459 | 3300041498 | Ga0451841_0133503 | Ga0451841_0133503_212_487 | 90 |
| 460 | 3300041512 | Ga0451853_0680897 | Ga0451853_0680897_310_624 | 90 |
| 461 | 3300042131 | Ga0450894_029594 | Ga0450894_029594_301_579 | 90 |
| 462 | 3300042184 | Ga0450908_000075 | Ga0450908_000075_10801_11079 | 90 |
| 463 | 3300044672 | Ga0466982_0000037 | Ga0466982_0000037_41742_42020 | 90 |
| 464 | 3300044842 | Ga0466957_0066841 | Ga0466957_0066841_497_775 | 90 |
| 465 | 3300045976 | Ga0466967_1660326 | Ga0466967_1660326_180_452 | 90 |
| 466 | 3300046452 | Ga0495617_000420 | Ga0495617_000420_5326_5604 | 90 |
| 467 | 3300046452 | Ga0495617_003578 | Ga0495617_003578_153_431 | 90 |
| 468 | 3300046455 | Ga0495603_0209503 | Ga0495603_0209503_193_465 | 90 |
| 469 | 3300046459 | Ga0495629_0594455 | Ga0495629_0594455_100_372 | 90 |
| 470 | 3300046460 | Ga0495638_0003699 | Ga0495638_0003699_6039_6317 | 90 |
| 471 | 3300046460 | Ga0495638_0531330 | Ga0495638_0531330_36_314 | 90 |
| 472 | 3300046471 | Ga0495650_0000008 | Ga0495650_0000008_438907_439179 | 90 |
| 473 | 3300046471 | Ga0495650_0000562 | Ga0495650_0000562_26721_26999 | 90 |
| 474 | 3300046471 | Ga0495650_0058735 | Ga0495650_0058735_356_634 | 90 |
| 475 | 3300046473 | Ga0495582_0064794 | Ga0495582_0064794_1449_1721 | 90 |
| 476 | 3300046474 | Ga0495605_0027185 | Ga0495605_0027185_254_532 | 90 |
| 477 | 3300046475 | Ga0495639_0240454 | Ga0495639_0240454_142_414 | 90 |
| 478 | 3300046491 | Ga0495584_0001715 | Ga0495584_0001715_4678_4956 | 90 |
| 479 | 3300046492 | Ga0495585_0000200 | Ga0495585_0000200_5219_5497 | 90 |
| 480 | 3300046492 | Ga0495585_0001731 | Ga0495585_0001731_3415_3693 | 90 |
| 481 | 3300046501 | Ga0495607_0000178 | Ga0495607_0000178_17588_17866 | 90 |
| 482 | 3300046501 | Ga0495607_0000256 | Ga0495607_0000256_40348_40626 | 90 |
| 483 | 3300046501 | Ga0495607_0003984 | Ga0495607_0003984_2202_2480 | 90 |
| 484 | 3300046501 | Ga0495607_0313983 | Ga0495607_0313983_422_700 | 90 |
| 485 | 3300046506 | Ga0495583_0002800 | Ga0495583_0002800_344_622 | 90 |
| 486 | 3300046507 | Ga0495606_0002611 | Ga0495606_0002611_3339_3617 | 90 |
| 487 | 3300046507 | Ga0495606_0019940 | Ga0495606_0019940_2149_2427 | 90 |
| 488 | 3300046507 | Ga0495606_0054526 | Ga0495606_0054526_209_487 | 90 |
| 489 | 3300046507 | Ga0495606_0120977 | Ga0495606_0120977_220_498 | 90 |
| 490 | 3300046512 | Ga0495610_0000341 | Ga0495610_0000341_25334_25612 | 90 |
| 491 | 3300046513 | Ga0495616_0000357 | Ga0495616_0000357_18588_18866 | 90 |
| 492 | 3300046513 | Ga0495616_0022311 | Ga0495616_0022311_2033_2311 | 90 |
| 493 | 3300046515 | Ga0495620_0000150 | Ga0495620_0000150_47133_47411 | 90 |
| 494 | 3300046515 | Ga0495620_0000287 | Ga0495620_0000287_17249_17527 | 90 |
| 495 | 3300046518 | Ga0495631_0000257 | Ga0495631_0000257_18075_18353 | 90 |
| 496 | 3300046518 | Ga0495631_0000664 | Ga0495631_0000664_5888_6166 | 90 |
| 497 | 3300046519 | Ga0495632_0000016 | Ga0495632_0000016_172861_173139 | 90 |
| 498 | 3300046519 | Ga0495632_0012122 | Ga0495632_0012122_292_570 | 90 |
| 499 | 3300046519 | Ga0495632_0331260 | Ga0495632_0331260_248_526 | 90 |
| 500 | 3300046520 | Ga0495637_0006974 | Ga0495637_0006974_194_472 | 90 |
| 501 | 3300046523 | Ga0495644_0040994 | Ga0495644_0040994_1269_1541 | 90 |
| 502 | 3300046524 | Ga0495648_0001786 | Ga0495648_0001786_5069_5347 | 90 |
| 503 | 3300046524 | Ga0495648_0013340 | Ga0495648_0013340_632_910 | 90 |
| 504 | 3300046530 | Ga0495654_0000467 | Ga0495654_0000467_33245_33517 | 90 |
| 505 | 3300046536 | Ga0495587_0305599 | Ga0495587_0305599_198_470 | 90 |
| 506 | 3300046538 | Ga0495609_0003864 | Ga0495609_0003864_5074_5352 | 90 |
| 507 | 3300046543 | Ga0495645_0062462 | Ga0495645_0062462_1758_2030 | 90 |
| 508 | 3300046616 | Ga0495668_0692630 | Ga0495668_0692630_229_507 | 90 |
| 509 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2493058_2493336 | 90 |
| 510 | 3300046648 | Ga0495611_0000044 | Ga0495611_0000044_5872_6150 | 90 |
| 511 | 3300046660 | Ga0495625_0000041 | Ga0495625_0000041_166558_166836 | 90 |
| 512 | 3300046660 | Ga0495625_0069375 | Ga0495625_0069375_1851_2129 | 90 |
| 513 | 3300046663 | Ga0495635_0622866 | Ga0495635_0622866_380_652 | 90 |
| 514 | 3300046665 | Ga0495661_0012895 | Ga0495661_0012895_110_388 | 90 |
| 515 | 3300046680 | Ga0495646_0460651 | Ga0495646_0460651_124_396 | 90 |
| 516 | 3300046681 | Ga0495647_0017738 | Ga0495647_0017738_1286_1558 | 90 |
| 517 | 3300046683 | Ga0495658_0001223 | Ga0495658_0001223_1475_1747 | 90 |
| 518 | 3300046690 | Ga0495624_0338918 | Ga0495624_0338918_445_717 | 90 |
| 519 | 3300046691 | Ga0495670_0003155 | Ga0495670_0003155_5196_5474 | 90 |
| 520 | 3300046691 | Ga0495670_0006364 | Ga0495670_0006364_2218_2496 | 90 |
| 521 | 3300046691 | Ga0495670_0176182 | Ga0495670_0176182_214_492 | 90 |
| 522 | 3300046692 | Ga0495671_0000303 | Ga0495671_0000303_35736_36014 | 90 |
| 523 | 3300046694 | Ga0495649_0074074 | Ga0495649_0074074_845_1123 | 90 |
| 524 | 3300046794 | Ga0495589_0000008 | Ga0495589_0000008_134590_134868 | 90 |
| 525 | 3300046810 | Ga0495660_0000231 | Ga0495660_0000231_48724_49002 | 90 |
| 526 | 3300046810 | Ga0495660_0004058 | Ga0495660_0004058_4237_4515 | 90 |
| 527 | 3300047317 | Ga0495604_0084443 | Ga0495604_0084443_587_859 | 90 |
| 528 | 3300047319 | Ga0495674_0535174 | Ga0495674_0535174_50_322 | 90 |
| 529 | 3300047320 | Ga0495672_0000003 | Ga0495672_0000003_281001_281273 | 90 |
| 530 | 3300047322 | Ga0495680_0362925 | Ga0495680_0362925_343_615 | 90 |
| 531 | 3300047323 | Ga0495683_0000643 | Ga0495683_0000643_6856_7134 | 90 |
| 532 | 3300047444 | Ga0495675_0798694 | Ga0495675_0798694_198_470 | 90 |
| 533 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_603830_604108 | 90 |
| 534 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_429255_429533 | 90 |
| 535 | 3300047469 | Ga0495673_0000041 | Ga0495673_0000041_40467_40745 | 90 |
| 536 | 3300047469 | Ga0495673_0005506 | Ga0495673_0005506_2305_2583 | 90 |
| 537 | 3300047470 | Ga0495681_0096407 | Ga0495681_0096407_69_347 | 90 |
| 538 | 3300047471 | Ga0495684_0350836 | Ga0495684_0350836_583_855 | 90 |
| 539 | 3300047472 | Ga0495686_0000108 | Ga0495686_0000108_96824_97102 | 90 |
| 540 | 3300047472 | Ga0495686_0004535 | Ga0495686_0004535_4442_4720 | 90 |
| 541 | 3300047472 | Ga0495686_0016087 | Ga0495686_0016087_308_586 | 90 |
| 542 | 3300047472 | Ga0495686_0171282 | Ga0495686_0171282_221_499 | 90 |
| 543 | 3300048905 | Ga0496102_0067734 | Ga0496102_0067734_921_1193 | 90 |
| 544 | 3300048905 | Ga0496102_0290429 | Ga0496102_0290429_1064_1342 | 90 |
| 545 | 3300048906 | Ga0496103_0334375 | Ga0496103_0334375_232_504 | 90 |
| 546 | 3300048907 | Ga0496104_0000058 | Ga0496104_0000058_61109_61381 | 90 |
| 547 | 3300048908 | Ga0496105_0000021 | Ga0496105_0000021_4183_4455 | 90 |
| 548 | 3300048909 | Ga0496106_0001787 | Ga0496106_0001787_15050_15328 | 90 |
| 549 | 3300048912 | Ga0496109_0641755 | Ga0496109_0641755_533_811 | 90 |
| 550 | 3300048916 | Ga0496113_0845195 | Ga0496113_0845195_366_644 | 90 |
| 551 | 3300048919 | Ga0496116_0171293 | Ga0496116_0171293_856_1134 | 90 |
| 552 | 3300048919 | Ga0496116_0240461 | Ga0496116_0240461_283_561 | 90 |
| 553 | 3300048920 | Ga0496117_0015847 | Ga0496117_0015847_4540_4818 | 90 |
| 554 | 3300048920 | Ga0496117_0102518 | Ga0496117_0102518_817_1095 | 90 |
| 555 | 3300048920 | Ga0496117_0158699 | Ga0496117_0158699_870_1145 | 90 |
| 556 | 3300048921 | Ga0496118_0000169 | Ga0496118_0000169_31670_31948 | 90 |
| 557 | 3300048921 | Ga0496118_0003233 | Ga0496118_0003233_4514_4792 | 90 |
| 558 | 3300048921 | Ga0496118_0014200 | Ga0496118_0014200_2088_2360 | 90 |
| 559 | 3300048921 | Ga0496118_0025248 | Ga0496118_0025248_1049_1324 | 90 |
| 560 | 3300048921 | Ga0496118_0315544 | Ga0496118_0315544_515_793 | 90 |
| 561 | 3300048922 | Ga0496119_0047913 | Ga0496119_0047913_12_290 | 90 |
| 562 | 3300048924 | Ga0496121_0000148 | Ga0496121_0000148_113602_113880 | 90 |
| 563 | 3300048924 | Ga0496121_0002094 | Ga0496121_0002094_26684_26962 | 90 |
| 564 | 3300048924 | Ga0496121_0004100 | Ga0496121_0004100_3997_4275 | 90 |
| 565 | 3300048925 | Ga0496122_0023158 | Ga0496122_0023158_1928_2206 | 90 |
| 566 | 3300048925 | Ga0496122_0044436 | Ga0496122_0044436_753_1031 | 90 |
| 567 | 3300048926 | Ga0496123_0016094 | Ga0496123_0016094_4608_4886 | 90 |
| 568 | 3300048926 | Ga0496123_0025676 | Ga0496123_0025676_3003_3281 | 90 |
| 569 | 3300048926 | Ga0496123_0038725 | Ga0496123_0038725_3000_3278 | 90 |
| 570 | 3300048927 | Ga0496124_0001854 | Ga0496124_0001854_4589_4867 | 90 |
| 571 | 3300048927 | Ga0496124_0014877 | Ga0496124_0014877_4607_4885 | 90 |
| 572 | 3300048927 | Ga0496124_0218364 | Ga0496124_0218364_1094_1372 | 90 |
| 573 | 3300048927 | Ga0496124_0285030 | Ga0496124_0285030_178_456 | 90 |
| 574 | 3300048929 | Ga0496126_0392579 | Ga0496126_0392579_174_452 | 90 |
| 575 | 3300048929 | Ga0496126_0582909 | Ga0496126_0582909_365_643 | 90 |
| 576 | 3300049459 | Ga0495678_000158 | Ga0495678_000158_5213_5491 | 90 |
| 577 | 3300049460 | Ga0495682_0002224 | Ga0495682_0002224_4658_4936 | 90 |
| 578 | 3300049460 | Ga0495682_0012087 | Ga0495682_0012087_1035_1313 | 90 |
| 579 | 3300049571 | Ga0501034_0340064 | Ga0501034_0340064_510_785 | 90 |
| 580 | 3300049587 | Ga0501071_0877408 | Ga0501071_0877408_238_510 | 90 |
| 581 | 3300049822 | Ga0501035_0200628 | Ga0501035_0200628_440_715 | 90 |
| 582 | 3300050516 | nmdc:mga0sz30_5002_c1 | nmdc:mga0sz30_5002_c1_2836_3114 | 90 |
| 583 | 3300053079 | Ga0500610_0013793 | Ga0500610_0013793_56_328 | 90 |
| 584 | 3300053087 | Ga0500643_000103 | Ga0500643_000103_79332_79610 | 90 |
| 585 | 3300053094 | Ga0500566_0214342 | Ga0500566_0214342_236_508 | 90 |
| 586 | 3300053103 | Ga0500555_000995 | Ga0500555_000995_1183_1461 | 90 |
| 587 | 3300053123 | Ga0500614_026914 | Ga0500614_026914_303_575 | 90 |
| 588 | 3300053131 | Ga0500652_152208 | Ga0500652_152208_40_318 | 90 |
| 589 | 3300053730 | Ga0500645_000741 | Ga0500645_000741_1118_1396 | 90 |
| 590 | 3300061734 | Ga0530510_1150002 | Ga0530510_1150002_235_507 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t07-assembly1.cif.gz_A | crystal structure of conserved protein of unknown function pa5148 from pseudomonas aeruginosa | 0.8888 | 1 | 76 |
| 1t07-assembly1.cif.gz_A | crystal structure of conserved protein of unknown function pa5148 from pseudomonas aeruginosa | 0.8295 | 1 | 76 |
| 1yhd-assembly1.cif.gz_A | the solution structure of yggx from escherichia coli | 0.7882 | 2 | 89 |
| 1yhd-assembly1.cif.gz_A | the solution structure of yggx from escherichia coli | 0.7643 | 2 | 89 |
| 1xs8-assembly1.cif.gz_A | solution structure of yggx protein of salmonella enterica | 0.7396 | 1 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yhdA01 | Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX | 0.8994 | 2 | 73 | 1.10.3880.10 |
| 1t07A00 | Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX | 0.8928 | 2 | 76 | 1.10.3880.10 |
| 1yhdA01 | Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX | 0.8561 | 2 | 73 | 1.10.3880.10 |
| 1xs8A01 | Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX | 0.8448 | 1 | 75 | 1.10.3880.10 |
| 1xs8A01 | Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX | 0.835 | 1 | 75 | 1.10.3880.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0CTM2-F1-model_v4 | Oxidative damage protection protein | 0.9972 | 1 | 55 |
GO:0005506
GO:0005829 GO:0034599 |
| AF-A0A2V9Z5R6-F1-model_v4 | Oxidative damage protection protein | 0.9963 | 2 | 49 |
GO:0005506
GO:0005829 GO:0034599 |
| AF-A0A357N4F9-F1-model_v4 | Oxidative damage protection protein | 0.9958 | 1 | 50 |
GO:0005506
GO:0005829 GO:0034599 |
| AF-A0A356IL84-F1-model_v4 | Oxidative damage protection protein | 0.995 | 1 | 50 |
GO:0005506
GO:0005829 GO:0034599 |
| AF-A0A7V5PHP1-F1-model_v4 | Oxidative damage protection protein | 0.9948 | 1 | 39 |
GO:0005506
GO:0005829 GO:0034599 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar