F466908

General Info

Members Datasets Scaffolds Average Seq Length
589 326 1178 379

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0038359|Ga0501037_0038359_349_1545
Length 398
Sequence MDSGFAASRRPGMTVGFSMRIAILGAGPAGLYLSYLLKRRRPDAGVTVIEQNPANATFGFGVVFSDRALDFLRADDPETYDAITPQMESWNDITLAIRNERIVIDGIGFAAVGRLKLLQLLQERARAVGVTLQFDRSAKSFDELPEADLIVGADGLNSLVRKTFADDFKPTIHLLNNRFAWFGTSRVFDTLTQTFRHTPIGDFNAHHYRYAPGRSTFIVEVDEATFARAGFERMDEGDARSLCEKVFADALGGARLISNNSIWRRFPQLRNEHWHYGKHVILGDAAHTAHFSIGSGTRLAMEDAIALERALRETGDDVAKALPAYEAARRPVVEKIVQGANASAAWYEDFAAHMELVPRDFAMSYIQRSGRVDLERLRKISPQFVARYEAEQNLDPSS

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
17 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
220 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 7.3
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0038359 3300049573 Bacteria 3529
2 SwRhRL2b_contig_650213 2162886007 Bacteria 3063
3 2214544930 2209111006 Bacteria 17913
4 ARcpr5oldR_c000108 3300000041 Bacteria 15035
5 ARSoilYngRDRAFT_c00008 3300000042 Bacteria 31696
6 ARcpr5yngRDRAFT_c000024 3300000043 Bacteria 25202
7 ARSoilOldRDRAFT_c000034 3300000044 Bacteria 30454
8 ARCol0oldRDRAFT_c00091 3300000045 Bacteria 7612
9 ARCol0yngRDRAFT_1000026 3300000652 Bacteria 26647
10 JGI24737J22298_10002972 3300001990 Bacteria 6008
11 JGI24738J21930_10008885 3300002075 Bacteria 2276
12 JGI24034J26672_10000683 3300002239 Bacteria 4362
13 JGI24742J22300_10004211 3300002244 Bacteria 2348
14 JGI24751J29686_10005756 3300002459 Bacteria 2526
15 JGI25405J52794_10000447 3300003911 Bacteria 5831
16 Ga0065717_1002210 3300005276 Bacteria 2486
17 Ga0065716_1001626 3300005277 Bacteria 4985
18 Ga0065704_10080155 3300005289 Bacteria 4000
19 Ga0065712_10018578 3300005290 Bacteria 1934
20 Ga0065712_10074541 3300005290 Bacteria 4069
21 Ga0065715_10008489 3300005293 Bacteria 5089
22 Ga0065715_10011549 3300005293 Bacteria 3183
23 Ga0070676_10009242 3300005328 Bacteria 5327
24 Ga0070683_100003952 3300005329 Bacteria 12131
25 Ga0070683_100014605 3300005329 Bacteria 6876
26 Ga0070690_100023607 3300005330 Bacteria 3773
27 Ga0070690_100033273 3300005330 Bacteria 3225
28 Ga0070670_100011123 3300005331 Bacteria 7689
29 Ga0070670_100146446 3300005331 Bacteria 2043
30 Ga0070666_10042832 3300005335 Bacteria 3029
31 Ga0070680_100102175 3300005336 Bacteria 2380
32 Ga0070682_100051422 3300005337 Bacteria 2575
33 Ga0070682_100068445 3300005337 Bacteria 2265
34 Ga0070682_100072609 3300005337 Unclassified 2205
35 Ga0068868_100043271 3300005338 Bacteria 3517
36 Ga0070660_100064968 3300005339 Bacteria 2840
37 Ga0070689_100036221 3300005340 Bacteria 3773
38 Ga0070689_100052111 3300005340 Bacteria 3164
39 Ga0070691_10004569 3300005341 Bacteria 6287
40 Ga0070687_100000813 3300005343 Bacteria 10406
41 Ga0070687_100052107 3300005343 Bacteria 2122
42 Ga0070692_10009877 3300005345 Bacteria 4323
43 Ga0070668_100025151 3300005347 Bacteria 4513
44 Ga0070669_100005635 3300005353 Bacteria 9042
45 Ga0070675_100004413 3300005354 Bacteria 10723
46 Ga0070675_100050882 3300005354 Bacteria 3402
47 Ga0070675_100289760 3300005354 Bacteria 1441
48 Ga0070671_100008712 3300005355 Bacteria 8138
49 Ga0070674_100155452 3300005356 Bacteria 1730
50 Ga0070673_100002330 3300005364 Bacteria 11534
51 Ga0070688_100019996 3300005365 Bacteria 3886
52 Ga0070688_100032083 3300005365 Bacteria 3164
53 Ga0070667_100004935 3300005367 Bacteria 11178
54 Ga0070667_100274379 3300005367 Bacteria 1513
55 Ga0070709_10003688 3300005434 Bacteria 8226
56 Ga0070714_100007364 3300005435 Bacteria 8563
57 Ga0070714_100075812 3300005435 Bacteria 2918
58 Ga0070714_100119666 3300005435 Bacteria 2341
59 Ga0070710_10003317 3300005437 Bacteria 7634
60 Ga0070710_10021422 3300005437 Bacteria 3369
61 Ga0070711_100008598 3300005439 Bacteria 6261
62 Ga0070711_100028168 3300005439 Bacteria 3694
63 Ga0070711_100146502 3300005439 Bacteria 1776
64 Ga0070705_100058918 3300005440 Bacteria 2272
65 Ga0070700_100002037 3300005441 Bacteria 10273
66 Ga0070700_100020503 3300005441 Bacteria 3830
67 Ga0070694_100034629 3300005444 Bacteria 3331
68 Ga0070694_100052016 3300005444 Bacteria 2767
69 Ga0070708_100299869 3300005445 Bacteria 1513
70 Ga0070678_100013441 3300005456 Bacteria 5133
71 Ga0070662_100235942 3300005457 Bacteria 1465
72 Ga0070681_10015134 3300005458 Bacteria 7673
73 Ga0070681_10047747 3300005458 Bacteria 4279
74 Ga0070685_10009668 3300005466 Bacteria 4991
75 Ga0070685_10020649 3300005466 Bacteria 3565
76 Ga0070706_100053042 3300005467 Bacteria 3742
77 Ga0070699_100033003 3300005518 Bacteria 4472
78 Ga0070679_100038222 3300005530 Bacteria 4771
79 Ga0070679_100062259 3300005530 Bacteria 3719
80 Ga0070679_100121892 3300005530 Bacteria 2592
81 Ga0070679_100230778 3300005530 Bacteria 1810
82 Ga0068853_100032983 3300005539 Bacteria 4390
83 Ga0068853_100072826 3300005539 Bacteria 2994
84 Ga0070686_100013613 3300005544 Bacteria 4664
85 Ga0070695_100016247 3300005545 Bacteria 4503
86 Ga0070695_100016434 3300005545 Bacteria 4478
87 Ga0070695_100031427 3300005545 Bacteria 3312
88 Ga0070696_100023909 3300005546 Bacteria 4152
89 Ga0070696_100057047 3300005546 Bacteria 2725
90 Ga0070665_100214077 3300005548 Bacteria 1928
91 Ga0070704_100069567 3300005549 Bacteria 2551
92 Ga0070664_100056779 3300005564 Bacteria 3326
93 Ga0070664_100183124 3300005564 Bacteria 1863
94 Ga0068857_100120707 3300005577 Bacteria 2360
95 Ga0070702_100073859 3300005615 Bacteria 2022
96 Ga0068859_100000920 3300005617 Bacteria 30125
97 Ga0068859_100054565 3300005617 Bacteria 4020
98 Ga0068864_100017905 3300005618 Bacteria 5910
99 Ga0068870_10000803 3300005840 Bacteria 12169
100 Ga0068863_100063270 3300005841 Bacteria 3499
101 Ga0068858_100007950 3300005842 Bacteria 10220
102 Ga0068858_100026670 3300005842 Bacteria 5366
103 Ga0068858_100073842 3300005842 Bacteria 3166
104 Ga0068860_100083839 3300005843 Bacteria 3032
105 Ga0068860_100130455 3300005843 Bacteria 2411
106 Ga0081455_10000059 3300005937 Bacteria 119148
107 Ga0081455_10000456 3300005937 Bacteria 53636
108 Ga0081455_10003227 3300005937 Bacteria 18892
109 Ga0081538_10040388 3300005981 Bacteria 2977
110 Ga0081538_10055126 3300005981 Bacteria 2344
111 Ga0081540_1065934 3300005983 Bacteria 1699
112 Ga0070717_10003657 3300006028 Bacteria 11038
113 Ga0070717_10087281 3300006028 Bacteria 2627
114 Ga0070717_10130831 3300006028 Bacteria 2158
115 Ga0075432_10000777 3300006058 Bacteria 9944
116 Ga0070716_100003302 3300006173 Bacteria 7581
117 Ga0075427_10001355 3300006194 Bacteria 3137
118 Ga0097621_100028569 3300006237 Bacteria 4396
119 Ga0097621_100039536 3300006237 Bacteria 3789
120 Ga0068871_100002951 3300006358 Bacteria 11669
121 Ga0068871_100113250 3300006358 Bacteria 2284
122 Ga0075428_100003077 3300006844 Bacteria 18196
123 Ga0075430_100002563 3300006846 Bacteria 15151
124 Ga0075430_100076700 3300006846 Bacteria 2801
125 Ga0075431_100003535 3300006847 Bacteria 15151
126 Ga0075433_10002075 3300006852 Bacteria 15151
127 Ga0075433_10008289 3300006852 Bacteria 8285
128 Ga0075433_10056340 3300006852 Bacteria 3432
129 Ga0075433_10103426 3300006852 Unclassified 2523
130 Ga0075434_100001839 3300006871 Bacteria 18321
131 Ga0075434_100078788 3300006871 Bacteria 3291
132 Ga0075434_100130585 3300006871 Unclassified 2531
133 Ga0075434_100297595 3300006871 Bacteria 1634
134 Ga0075434_100353531 3300006871 Bacteria 1490
135 Ga0075429_100001678 3300006880 Bacteria 18316
136 Ga0075429_100168541 3300006880 Unclassified 1918
137 Ga0068865_100018577 3300006881 Bacteria 4488
138 Ga0075436_100001222 3300006914 Bacteria 17450
139 Ga0097620_100000920 3300006931 Bacteria 30125
140 Ga0097620_100054565 3300006931 Bacteria 4020
141 Ga0075435_100000314 3300007076 Bacteria 29815
142 Ga0075435_100021586 3300007076 Bacteria 4955
143 Ga0075435_100080265 3300007076 Bacteria 2678
144 Ga0105251_10027996 3300009011 Bacteria 2851
145 Ga0105244_10007516 3300009036 Bacteria 6916
146 Ga0105240_10334096 3300009093 Unclassified 1723
147 Ga0111539_10002742 3300009094 Bacteria 23379
148 Ga0111539_10003209 3300009094 Bacteria 21620
149 Ga0111539_10051951 3300009094 Bacteria 4880
150 Ga0111539_10064222 3300009094 Bacteria 4344
151 Ga0111539_10096535 3300009094 Bacteria 3472
152 Ga0111539_10259694 3300009094 Bacteria 2022
153 Ga0105245_10019958 3300009098 Bacteria 5876
154 Ga0105247_10004155 3300009101 Bacteria 9288
155 Ga0114129_10078557 3300009147 Bacteria 4590
156 Ga0114129_10242644 3300009147 Unclassified 2422
157 Ga0105243_10024358 3300009148 Bacteria 4616
158 Ga0105243_10091714 3300009148 Bacteria 2502
159 Ga0105243_10398191 3300009148 Unclassified 1278
160 Ga0105241_10004816 3300009174 Bacteria 9943
161 Ga0105242_10000995 3300009176 Bacteria 22203
162 Ga0105242_10003723 3300009176 Bacteria 11852
163 Ga0105248_10006282 3300009177 Bacteria 13035
164 Ga0105248_10072372 3300009177 Bacteria 3874
165 Ga0105237_10041751 3300009545 Bacteria 4625
166 Ga0105237_10045361 3300009545 Bacteria 4424
167 Ga0105238_10077312 3300009551 Bacteria 3320
168 Ga0105249_10044646 3300009553 Bacteria 4029
169 Ga0105249_10293185 3300009553 Bacteria 1629
170 Ga0105239_10210463 3300010375 Bacteria 2179
171 Ga0105239_10246204 3300010375 Bacteria 2007
172 Ga0105246_10007150 3300011119 Bacteria 6837
173 Ga0105246_10093827 3300011119 Bacteria 2169
174 Ga0105246_10103218 3300011119 Bacteria 2080
175 Ga0157373_10058795 3300013100 Bacteria 2725
176 Ga0157370_10108266 3300013104 Bacteria 2599
177 Ga0157374_10199571 3300013296 Bacteria 1958
178 Ga0157378_10019352 3300013297 Bacteria 5986
179 Ga0157378_10035949 3300013297 Bacteria 4384
180 Ga0157378_10037879 3300013297 Bacteria 4273
181 Ga0163162_10049480 3300013306 Bacteria 4213
182 Ga0163162_10084481 3300013306 Bacteria 3250
183 Ga0163162_10652073 3300013306 Bacteria 1176
184 Ga0157375_10413723 3300013308 Bacteria 1515
185 Ga0163163_10004815 3300014325 Bacteria 11592
186 Ga0163163_10029832 3300014325 Bacteria 5249
187 Ga0157380_10030695 3300014326 Bacteria 4118
188 Ga0157380_10099062 3300014326 Bacteria 2423
189 Ga0157377_10008954 3300014745 Bacteria 4898
190 Ga0157377_10054757 3300014745 Bacteria 2259
191 Ga0157379_10091012 3300014968 Bacteria 2737
192 Ga0157379_10100826 3300014968 Bacteria 2592
193 Ga0157376_10089903 3300014969 Bacteria 2656
194 Ga0157376_10091250 3300014969 Bacteria 2638
195 Ga0163161_10039028 3300017792 Bacteria 3407
196 Ga0163161_10083752 3300017792 Bacteria 2351
197 Ga0213876_10018982 3300021384 Bacteria 3632
198 Ga0213875_10000011 3300021388 Bacteria 332447
199 Ga0209233_1002060 3300025261 Bacteria 7618
200 Ga0207666_1000058 3300025271 Bacteria 19987
201 Ga0207697_10002181 3300025315 Bacteria 10236
202 Ga0207653_10010841 3300025885 Bacteria 2844
203 Ga0207692_10002221 3300025898 Bacteria 7426
204 Ga0207642_10004337 3300025899 Bacteria 4573
205 Ga0207710_10008217 3300025900 Bacteria 4407
206 Ga0207710_10031948 3300025900 Bacteria 2305
207 Ga0207688_10000104 3300025901 Bacteria 33727
208 Ga0207647_10017913 3300025904 Bacteria 4805
209 Ga0207685_10035700 3300025905 Bacteria 1816
210 Ga0207699_10005711 3300025906 Bacteria 5980
211 Ga0207645_10008843 3300025907 Bacteria 7000
212 Ga0207643_10000064 3300025908 Bacteria 70490
213 Ga0207684_10046297 3300025910 Bacteria 3690
214 Ga0207654_10031302 3300025911 Bacteria 2929
215 Ga0207707_10019344 3300025912 Bacteria 5943
216 Ga0207707_10021923 3300025912 Bacteria 5583
217 Ga0207707_10089166 3300025912 Bacteria 2695
218 Ga0207671_10066094 3300025914 Bacteria 2691
219 Ga0207693_10001804 3300025915 Bacteria 18782
220 Ga0207693_10019287 3300025915 Bacteria 5426
221 Ga0207693_10021370 3300025915 Bacteria 5143
222 Ga0207693_10061368 3300025915 Bacteria 2944
223 Ga0207663_10069935 3300025916 Bacteria 2260
224 Ga0207660_10023685 3300025917 Bacteria 4149
225 Ga0207662_10000134 3300025918 Bacteria 35725
226 Ga0207657_10012774 3300025919 Bacteria 8269
227 Ga0207657_10103842 3300025919 Bacteria 2355
228 Ga0207649_10005821 3300025920 Bacteria 6674
229 Ga0207649_10061614 3300025920 Bacteria 2362
230 Ga0207652_10006818 3300025921 Bacteria 9205
231 Ga0207652_10141615 3300025921 Bacteria 2150
232 Ga0207652_10149392 3300025921 Bacteria 2091
233 Ga0207646_10224673 3300025922 Bacteria 1696
234 Ga0207681_10012844 3300025923 Bacteria 5178
235 Ga0207650_10037274 3300025925 Bacteria 3543
236 Ga0207650_10078711 3300025925 Bacteria 2495
237 Ga0207659_10068521 3300025926 Bacteria 2581
238 Ga0207659_10304306 3300025926 Bacteria 1310
239 Ga0207700_10000783 3300025928 Bacteria 18363
240 Ga0207664_10028834 3300025929 Bacteria 4222
241 Ga0207664_10057083 3300025929 Bacteria 3102
242 Ga0207664_10313657 3300025929 Bacteria 1382
243 Ga0207644_10004656 3300025931 Bacteria 8915
244 Ga0207644_10005681 3300025931 Bacteria 8122
245 Ga0207644_10050523 3300025931 Bacteria 2981
246 Ga0207706_10034053 3300025933 Bacteria 4533
247 Ga0207686_10003587 3300025934 Bacteria 8324
248 Ga0207686_10061234 3300025934 Bacteria 2385
249 Ga0207686_10116783 3300025934 Bacteria 1809
250 Ga0207709_10009237 3300025935 Bacteria 5432
251 Ga0207709_10166721 3300025935 Bacteria 1542
252 Ga0207670_10004727 3300025936 Bacteria 7384
253 Ga0207670_10055502 3300025936 Bacteria 2678
254 Ga0207704_10064657 3300025938 Bacteria 2287
255 Ga0207665_10000547 3300025939 Bacteria 25334
256 Ga0207665_10005569 3300025939 Bacteria 8399
257 Ga0207665_10044170 3300025939 Bacteria 2982
258 Ga0207691_10004339 3300025940 Bacteria 13762
259 Ga0207711_10008097 3300025941 Bacteria 8799
260 Ga0207711_10008358 3300025941 Bacteria 8662
261 Ga0207689_10001739 3300025942 Bacteria 20560
262 Ga0207689_10025768 3300025942 Bacteria 4927
263 Ga0207661_10000098 3300025944 Bacteria 55518
264 Ga0207661_10070993 3300025944 Bacteria 2844
265 Ga0207679_10256111 3300025945 Bacteria 1490
266 Ga0207667_10245253 3300025949 Bacteria 1833
267 Ga0207651_10000786 3300025960 Bacteria 13625
268 Ga0207712_10071871 3300025961 Bacteria 2490
269 Ga0207712_10188627 3300025961 Bacteria 1626
270 Ga0207703_10001605 3300026035 Bacteria 20452
271 Ga0207703_10076397 3300026035 Bacteria 2778
272 Ga0207703_10198613 3300026035 Bacteria 1781
273 Ga0207639_10095325 3300026041 Bacteria 2391
274 Ga0207678_10053612 3300026067 Bacteria 3475
275 Ga0207708_10013004 3300026075 Bacteria 6209
276 Ga0207708_10028544 3300026075 Bacteria 4225
277 Ga0207708_10172943 3300026075 Bacteria 1712
278 Ga0207702_10020830 3300026078 Bacteria 5424
279 Ga0207702_10172241 3300026078 Bacteria 1986
280 Ga0207641_10016098 3300026088 Bacteria 6124
281 Ga0207641_10205274 3300026088 Bacteria 1819
282 Ga0207648_10004808 3300026089 Bacteria 13780
283 Ga0207676_10001552 3300026095 Bacteria 16925
284 Ga0207676_10127581 3300026095 Unclassified 2157
285 Ga0207676_10359161 3300026095 Bacteria 1349
286 Ga0207674_10011184 3300026116 Bacteria 10091
287 Ga0207674_10036461 3300026116 Bacteria 5124
288 Ga0207675_100001176 3300026118 Bacteria 26064
289 Ga0207683_10001611 3300026121 Bacteria 20292
290 Ga0207683_10007909 3300026121 Bacteria 9096
291 Ga0207683_10011462 3300026121 Bacteria 7566
292 Ga0207683_10158989 3300026121 Bacteria 2042
293 Ga0209973_1000946 3300027252 Bacteria 2386
294 Ga0210002_1002471 3300027617 Bacteria 2668
295 Ga0209971_1004666 3300027682 Bacteria 3251
296 Ga0207428_10000075 3300027907 Bacteria 137887
297 Ga0207428_10001650 3300027907 Bacteria 23209
298 Ga0268266_10027490 3300028379 Bacteria 4836
299 Ga0268266_10070460 3300028379 Bacteria 3029
300 Ga0268265_10086217 3300028380 Bacteria 2495
301 Ga0268264_10027530 3300028381 Bacteria 4646
302 Ga0265325_10000398 3300031241 Bacteria 30875
303 Ga0265325_10006343 3300031241 Bacteria 7187
304 Ga0265325_10041595 3300031241 Bacteria 2407
305 Ga0265339_10002964 3300031249 Bacteria 11989
306 Ga0265313_10000710 3300031595 Bacteria 34401
307 Ga0265313_10006372 3300031595 Bacteria 8386
308 Ga0265313_10009195 3300031595 Bacteria 6443
309 Ga0265313_10030743 3300031595 Bacteria 2760
310 Ga0265314_10000439 3300031711 Bacteria 55613
311 Ga0316583_10006840 3300032133 Bacteria 4108
312 Ga0373930_0000770 3300034816 Bacteria 4553
313 Ga0373948_0000230 3300034817 Bacteria 6642
314 Ga0373959_0001479 3300034820 Bacteria 3752
315 Ga0373934_0026186 3300035086 Bacteria 2262
316 Ga0373940_0000632 3300035088 Bacteria 5634
317 Ga0373940_0019538 3300035088 Bacteria 1713
318 Ga0373949_0005367 3300035090 Bacteria 2860
319 Ga0373951_0000245 3300035091 Bacteria 18132
320 Ga0373951_0003734 3300035091 Bacteria 3673
321 Ga0373952_0000027 3300035092 Bacteria 16625
322 Ga0373932_0000184 3300035112 Bacteria 18145
323 Ga0373932_0000645 3300035112 Bacteria 10610
324 Ga0373932_0005721 3300035112 Bacteria 2925
325 Ga0373939_0001544 3300035114 Bacteria 5585
326 Ga0373941_0001157 3300035115 Bacteria 5501
327 Ga0373941_0001231 3300035115 Bacteria 5371
328 Ga0373941_0001755 3300035115 Bacteria 4657
329 Ga0373956_0023980 3300035119 Bacteria 2624
330 Ga0373956_0037468 3300035119 Bacteria 2143
331 Ga0373957_0006219 3300035120 Bacteria 3752
332 Ga0373960_0005573 3300035121 Bacteria 2923
333 Ga0373943_0010837 3300035170 Bacteria 4092
334 Ga0373943_0030427 3300035170 Bacteria 2554
335 Ga0373943_0040500 3300035170 Unclassified 2250
336 Ga0373946_0012132 3300035171 Bacteria 3223
337 Ga0373955_0003756 3300035172 Bacteria 6689
338 Ga0373942_0000413 3300035207 Bacteria 11943
339 Ga0373961_0001099 3300035241 Bacteria 8596
340 Ga0373962_0003152 3300035242 Bacteria 3953
341 Ga0373924_0039500 3300035410 Bacteria 1928
342 Ga0373931_0039690 3300035691 Bacteria 2467
343 Ga0373935_0103490 3300035692 Bacteria 1880
344 Ga0373935_0155350 3300035692 Bacteria 1555
345 Ga0373927_0019963 3300035695 Bacteria 4395
346 Ga0373933_0001260 3300035724 Bacteria 14949
347 Ga0373933_0021610 3300035724 Bacteria 3657
348 Ga0373933_0068902 3300035724 Bacteria 2149
349 Ga0373937_0011313 3300036401 Bacteria 7827
350 Ga0373937_0028218 3300036401 Bacteria 5077
351 Ga0373937_0058950 3300036401 Bacteria 3527
352 Ga0373937_0070318 3300036401 Bacteria 3228
353 Ga0373937_0325124 3300036401 Bacteria 1455
354 Ga0436364_0622718 3300037853 Bacteria 37563
355 Ga0436365_0253472 3300039437 Bacteria 28103
356 Ga0436365_1171722 3300039437 Bacteria 9354
357 Ga0436363_0783330 3300039450 Bacteria 2337
358 Ga0436362_0844795 3300039453 Bacteria 2584
359 Ga0439441_000229 3300042001 Bacteria 5367
360 Ga0439450_000962 3300042008 Bacteria 4025
361 Ga0439460_0022020 3300042461 Bacteria 1745
362 Ga0453684_0037750 3300044712 Bacteria 6624
363 Ga0451576_0020807 3300045051 Bacteria 7140
364 Ga0451576_0057657 3300045051 Bacteria 4060
365 Ga0451576_0068019 3300045051 Bacteria 3707
366 Ga0451576_0345918 3300045051 Bacteria 1557
367 Ga0495592_0027486 3300046454 Bacteria 4313
368 Ga0495592_0186346 3300046454 Bacteria 1409
369 Ga0495603_0011684 3300046455 Bacteria 5312
370 Ga0495629_0000768 3300046459 Bacteria 25902
371 Ga0495641_0055727 3300046461 Bacteria 1793
372 Ga0495651_0152169 3300046462 Bacteria 1666
373 Ga0495653_0051147 3300046463 Bacteria 3173
374 Ga0495653_0061811 3300046463 Bacteria 2832
375 Ga0495653_0136686 3300046463 Bacteria 1728
376 Ga0495582_0011452 3300046473 Bacteria 4886
377 Ga0495582_0013456 3300046473 Bacteria 4504
378 Ga0495608_0012014 3300046511 Bacteria 6020
379 Ga0495608_0033600 3300046511 Bacteria 3464
380 Ga0495618_0010501 3300046514 Bacteria 5601
381 Ga0495628_0002874 3300046516 Bacteria 15429
382 Ga0495628_0058960 3300046516 Bacteria 3015
383 Ga0495628_0279347 3300046516 Bacteria 1240
384 Ga0495630_0034958 3300046517 Bacteria 3754
385 Ga0495663_0011203 3300046525 Bacteria 2495
386 Ga0495652_0002010 3300046529 Bacteria 21660
387 Ga0495665_0014559 3300046531 Bacteria 4241
388 Ga0495665_0049524 3300046531 Bacteria 2227
389 Ga0495640_0020864 3300046533 Bacteria 4816
390 Ga0495640_0029202 3300046533 Bacteria 3962
391 Ga0495587_0001517 3300046536 Bacteria 15420
392 Ga0495587_0014807 3300046536 Bacteria 4881
393 Ga0495587_0106890 3300046536 Bacteria 1609
394 Ga0495645_0001520 3300046543 Bacteria 15645
395 Ga0495645_0029463 3300046543 Bacteria 3992
396 Ga0495667_0020913 3300046559 Bacteria 4416
397 Ga0495667_0146773 3300046559 Bacteria 1519
398 Ga0495634_0059231 3300046642 Bacteria 2551
399 Ga0495635_0009233 3300046663 Bacteria 6888
400 Ga0495635_0018885 3300046663 Bacteria 4812
401 Ga0495635_0043293 3300046663 Bacteria 3107
402 Ga0495635_0106288 3300046663 Bacteria 1917
403 Ga0495659_0000979 3300046664 Bacteria 10008
404 Ga0495659_0031557 3300046664 Unclassified 1849
405 Ga0495659_0057308 3300046664 Bacteria 1431
406 Ga0495588_0031006 3300046674 Bacteria 2689
407 Ga0495657_0013755 3300046675 Bacteria 5958
408 Ga0495657_0031614 3300046675 Bacteria 3698
409 Ga0495599_0180440 3300046678 Unclassified 1301
410 Ga0495623_0009973 3300046679 Bacteria 6152
411 Ga0495658_0159434 3300046683 Bacteria 1390
412 Ga0495613_0056871 3300046689 Bacteria 2873
413 Ga0495600_0050039 3300046809 Bacteria 2726
414 Ga0495600_0127882 3300046809 Bacteria 1652
415 Ga0495581_0087491 3300047315 Bacteria 1806
416 Ga0495581_0092878 3300047315 Bacteria 1751
417 Ga0495604_0013004 3300047317 Bacteria 6632
418 Ga0495604_0039533 3300047317 Bacteria 3707
419 Ga0495604_0117840 3300047317 Bacteria 1925
420 Ga0495636_0003694 3300047318 Bacteria 5951
421 Ga0495674_0024012 3300047319 Bacteria 5609
422 Ga0495674_0074182 3300047319 Bacteria 2931
423 Ga0495676_0071500 3300047321 Bacteria 2667
424 Ga0495680_0001681 3300047322 Bacteria 23530
425 Ga0495680_0003788 3300047322 Bacteria 14702
426 Ga0495680_0008770 3300047322 Bacteria 9162
427 Ga0495675_0011002 3300047444 Bacteria 5671
428 Ga0495675_0020819 3300047444 Bacteria 4174
429 Ga0495685_008811 3300047447 Bacteria 3361
430 Ga0495684_0029590 3300047471 Bacteria 4204
431 Ga0495593_0011214 3300047673 Bacteria 5153
432 Ga0495602_0007672 3300048088 Bacteria 11275
433 Ga0495602_0072830 3300048088 Bacteria 2927
434 Ga0496100_0052053 3300048903 Bacteria 2660
435 Ga0496101_0177200 3300048904 Bacteria 1640
436 Ga0496102_0005119 3300048905 Bacteria 11113
437 Ga0496102_0120284 3300048905 Bacteria 2452
438 Ga0496102_0155633 3300048905 Bacteria 2148
439 Ga0496102_0158646 3300048905 Bacteria 2127
440 Ga0496102_0223991 3300048905 Bacteria 1773
441 Ga0496103_0073753 3300048906 Bacteria 2138
442 Ga0496103_0116744 3300048906 Bacteria 1698
443 Ga0496104_0000126 3300048907 Bacteria 70488
444 Ga0496104_0025839 3300048907 Bacteria 5416
445 Ga0496104_0050393 3300048907 Bacteria 3928
446 Ga0496104_0376826 3300048907 Bacteria 1331
447 Ga0496105_0001562 3300048908 Bacteria 16224
448 Ga0496105_0009019 3300048908 Bacteria 7783
449 Ga0496105_0264083 3300048908 Bacteria 1391
450 Ga0496106_0018040 3300048909 Bacteria 5217
451 Ga0496106_0112034 3300048909 Bacteria 2125
452 Ga0496106_0346898 3300048909 Unclassified 1192
453 Ga0496107_0037405 3300048910 Bacteria 3482
454 Ga0496107_0051832 3300048910 Bacteria 2960
455 Ga0496107_0078683 3300048910 Unclassified 2403
456 Ga0496108_0004643 3300048911 Bacteria 11074
457 Ga0496109_0000188 3300048912 Bacteria 61633
458 Ga0496109_0000831 3300048912 Bacteria 25758
459 Ga0496109_0143609 3300048912 Bacteria 2232
460 Ga0496109_0196811 3300048912 Bacteria 1894
461 Ga0496109_0470465 3300048912 Bacteria 1187
462 Ga0496110_0045337 3300048913 Bacteria 3843
463 Ga0496111_0114945 3300048914 Bacteria 1984
464 Ga0496112_0287030 3300048915 Bacteria 1592
465 Ga0496112_0385834 3300048915 Bacteria 1341
466 Ga0496112_0428836 3300048915 Bacteria 1260
467 Ga0496113_0000478 3300048916 Bacteria 19609
468 Ga0496113_0083130 3300048916 Bacteria 2456
469 Ga0496114_0018626 3300048917 Bacteria 5616
470 Ga0496114_0045990 3300048917 Bacteria 3626
471 Ga0496115_0007975 3300048918 Bacteria 7818
472 Ga0496115_0015337 3300048918 Bacteria 5810
473 Ga0496115_0025762 3300048918 Bacteria 4583
474 Ga0496115_0036866 3300048918 Bacteria 3872
475 Ga0496115_0048656 3300048918 Bacteria 3391
476 Ga0496115_0186597 3300048918 Bacteria 1713
477 Ga0501031_0059673 3300049568 Bacteria 2485
478 Ga0501032_0191801 3300049569 Bacteria 1335
479 Ga0501033_0011371 3300049570 Bacteria 6810
480 Ga0501034_0000820 3300049571 Bacteria 46252
481 Ga0501034_0001125 3300049571 Bacteria 37359
482 Ga0501034_0101635 3300049571 Bacteria 2868
483 Ga0501034_0163881 3300049571 Bacteria 2192
484 Ga0501034_0242724 3300049571 Bacteria 1747
485 Ga0501036_0000216 3300049572 Bacteria 38518
486 Ga0501037_0029194 3300049573 Bacteria 4074
487 Ga0501037_0077356 3300049573 Bacteria 2414
488 Ga0501038_0214244 3300049574 Bacteria 1539
489 Ga0501039_0044131 3300049575 Bacteria 3443
490 Ga0501039_0070599 3300049575 Bacteria 2713
491 Ga0501039_0252895 3300049575 Bacteria 1385
492 Ga0501043_0002528 3300049579 Bacteria 15463
493 Ga0501043_0094269 3300049579 Bacteria 2353
494 Ga0501043_0115688 3300049579 Bacteria 2105
495 Ga0501043_0178420 3300049579 Bacteria 1655
496 Ga0501046_0087739 3300049580 Bacteria 2397
497 Ga0501047_0000124 3300049581 Bacteria 94721
498 Ga0501047_0129499 3300049581 Bacteria 2404
499 Ga0501047_0237466 3300049581 Bacteria 1674
500 Ga0501048_0000375 3300049582 Bacteria 31006
501 Ga0501068_0005079 3300049584 Bacteria 7174
502 Ga0501068_0026523 3300049584 Bacteria 3414
503 Ga0501069_0113070 3300049585 Bacteria 1547
504 Ga0501070_0008473 3300049586 Bacteria 8687
505 Ga0501070_0015967 3300049586 Bacteria 6311
506 Ga0501070_0021269 3300049586 Bacteria 5445
507 Ga0501070_0025503 3300049586 Bacteria 4958
508 Ga0501070_0122146 3300049586 Bacteria 2152
509 Ga0501070_0130708 3300049586 Bacteria 2074
510 Ga0501070_0150824 3300049586 Bacteria 1918
511 Ga0501070_0275423 3300049586 Bacteria 1373
512 Ga0501071_0223455 3300049587 Bacteria 1418
513 Ga0501072_0235349 3300049588 Bacteria 1459
514 Ga0501073_0057033 3300049589 Bacteria 2731
515 Ga0501073_0193435 3300049589 Bacteria 1407
516 Ga0501074_0045712 3300049590 Bacteria 3166
517 Ga0501076_0076694 3300049592 Bacteria 2681
518 Ga0501077_0007001 3300049593 Bacteria 6951
519 Ga0501080_0000074 3300049742 Bacteria 66985
520 Ga0501080_0057717 3300049742 Bacteria 3613
521 Ga0501080_0082909 3300049742 Bacteria 2978
522 Ga0501080_0166683 3300049742 Bacteria 2032
523 Ga0501080_0362597 3300049742 Bacteria 1307
524 Ga0501081_0017578 3300049743 Bacteria 4737
525 Ga0501083_0000485 3300049744 Bacteria 25494
526 Ga0501083_0035202 3300049744 Bacteria 3421
527 Ga0501083_0038126 3300049744 Bacteria 3268
528 Ga0501083_0082697 3300049744 Bacteria 2127
529 Ga0501035_0001064 3300049822 Bacteria 28788
530 Ga0501035_0189126 3300049822 Bacteria 1770
531 Ga0501035_0204258 3300049822 Bacteria 1693
532 Ga0501035_0230503 3300049822 Bacteria 1578
533 Ga0501035_0308022 3300049822 Bacteria 1333
534 Ga0501044_0001469 3300049823 Bacteria 27682
535 Ga0501044_0067611 3300049823 Bacteria 3640
536 Ga0501044_0110160 3300049823 Bacteria 2762
537 Ga0501044_0112361 3300049823 Bacteria 2731
538 Ga0501044_0381303 3300049823 Bacteria 1325
539 Ga0501044_0405867 3300049823 Bacteria 1274
540 Ga0501045_0044478 3300049824 Bacteria 3235
541 nmdc:mga05p37_131679_c1 3300050507 Bacteria 3069
542 nmdc:mga05p37_169897_c1 3300050507 Bacteria 2660
543 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
544 nmdc:mga05p37_4831_c1 3300050507 Bacteria 15760
545 nmdc:mga09592_165932_c1 3300050508 Unclassified 1909
546 nmdc:mga09592_1665_c1 3300050508 Bacteria 17906
547 nmdc:mga09592_78668_c1 3300050508 Bacteria 2807
548 nmdc:mga0qj67_12610_c1 3300050509 Bacteria 6373
549 nmdc:mga0qj67_94011_c1 3300050509 Bacteria 2411
550 nmdc:mga06r32_109945_c1 3300050510 Bacteria 2711
551 nmdc:mga06r32_18880_c1 3300050510 Bacteria 6321
552 nmdc:mga06r32_26837_c1 3300050510 Bacteria 5374
553 nmdc:mga06r32_468844_c1 3300050510 Bacteria 1238
554 nmdc:mga08y16_30292_c1 3300050511 Bacteria 5697
555 nmdc:mga08y16_684_c1 3300050511 Bacteria 32082
556 nmdc:mga0n895_143976_c1 3300050512 Bacteria 2413
557 nmdc:mga0n895_27229_c1 3300050512 Bacteria 5428
558 nmdc:mga0n895_527827_c1 3300050512 Bacteria 1188
559 nmdc:mga0n895_824_c1 3300050512 Bacteria 22214
560 nmdc:mga0n895_9017_c1 3300050512 Bacteria 8700
561 nmdc:mga0rr50_139958_c1 3300050513 Bacteria 1946
562 nmdc:mga0rr50_8982_c1 3300050513 Bacteria 6252
563 nmdc:mga08x19_124210_c1 3300050514 Bacteria 1732
564 nmdc:mga0a205_112337_c1 3300050515 Unclassified 2624
565 nmdc:mga0a205_2160_c1 3300050515 Bacteria 17293
566 nmdc:mga0a205_217_c1 3300050515 Bacteria 40547
567 nmdc:mga0a205_31206_c1 3300050515 Bacteria 5104
568 Ga0495601_0000159 3300053077 Bacteria 37216
569 Ga0495601_0004928 3300053077 Bacteria 7748
570 Ga0495612_0001126 3300053078 Bacteria 10963
571 Ga0495612_0004030 3300053078 Bacteria 6084
572 Ga0495612_0011691 3300053078 Bacteria 3538
573 Ga0495595_0000928 3300053084 Bacteria 11304
574 Ga0495595_0018108 3300053084 Bacteria 3039
575 Ga0495619_0000016 3300053085 Bacteria 231442
576 Ga0495619_0000190 3300053085 Bacteria 45343
577 Ga0495619_0003261 3300053085 Bacteria 10497
578 Ga0495619_0011237 3300053085 Bacteria 5632
579 Ga0495619_0041075 3300053085 Bacteria 3024
580 Ga0500644_0000552 3300053088 Bacteria 15075
581 Ga0500651_0002718 3300053093 Bacteria 9435
582 Ga0500595_000010 3300053119 Bacteria 275806
583 Ga0500616_0000001 3300053153 Bacteria 1986011
584 Ga0500645_000559 3300053730 Bacteria 24493
585 Ga0501084_0077891 3300054114 Bacteria 2779
586 Ga0501082_0030992 3300060353 Bacteria 4609
587 Ga0501082_0138617 3300060353 Bacteria 2111
588 Ga0530510_0008941 3300061734 Bacteria 7016
589 2643758770 2643221547 Bacteria 4740017
590 Ga0501037_0038359
591 SwRhRL2b_contig_650213
592 2214544930
593 ARcpr5oldR_c000108
594 ARSoilYngRDRAFT_c00008
595 ARcpr5yngRDRAFT_c000024
596 ARSoilOldRDRAFT_c000034
597 ARCol0oldRDRAFT_c00091
598 ARCol0yngRDRAFT_1000026
599 JGI24737J22298_10002972
600 JGI24738J21930_10008885
601 JGI24034J26672_10000683
602 JGI24742J22300_10004211
603 JGI24751J29686_10005756
604 JGI25405J52794_10000447
605 Ga0065717_1002210
606 Ga0065716_1001626
607 Ga0065704_10080155
608 Ga0065712_10018578
609 Ga0065712_10074541
610 Ga0065715_10008489
611 Ga0065715_10011549
612 Ga0070676_10009242
613 Ga0070683_100003952
614 Ga0070683_100014605
615 Ga0070690_100023607
616 Ga0070690_100033273
617 Ga0070670_100011123
618 Ga0070670_100146446
619 Ga0070666_10042832
620 Ga0070680_100102175
621 Ga0070682_100051422
622 Ga0070682_100068445
623 Ga0070682_100072609
624 Ga0068868_100043271
625 Ga0070660_100064968
626 Ga0070689_100036221
627 Ga0070689_100052111
628 Ga0070691_10004569
629 Ga0070687_100000813
630 Ga0070687_100052107
631 Ga0070692_10009877
632 Ga0070668_100025151
633 Ga0070669_100005635
634 Ga0070675_100004413
635 Ga0070675_100050882
636 Ga0070675_100289760
637 Ga0070671_100008712
638 Ga0070674_100155452
639 Ga0070673_100002330
640 Ga0070688_100019996
641 Ga0070688_100032083
642 Ga0070667_100004935
643 Ga0070667_100274379
644 Ga0070709_10003688
645 Ga0070714_100007364
646 Ga0070714_100075812
647 Ga0070714_100119666
648 Ga0070710_10003317
649 Ga0070710_10021422
650 Ga0070711_100008598
651 Ga0070711_100028168
652 Ga0070711_100146502
653 Ga0070705_100058918
654 Ga0070700_100002037
655 Ga0070700_100020503
656 Ga0070694_100034629
657 Ga0070694_100052016
658 Ga0070708_100299869
659 Ga0070678_100013441
660 Ga0070662_100235942
661 Ga0070681_10015134
662 Ga0070681_10047747
663 Ga0070685_10009668
664 Ga0070685_10020649
665 Ga0070706_100053042
666 Ga0070699_100033003
667 Ga0070679_100038222
668 Ga0070679_100062259
669 Ga0070679_100121892
670 Ga0070679_100230778
671 Ga0068853_100032983
672 Ga0068853_100072826
673 Ga0070686_100013613
674 Ga0070695_100016247
675 Ga0070695_100016434
676 Ga0070695_100031427
677 Ga0070696_100023909
678 Ga0070696_100057047
679 Ga0070665_100214077
680 Ga0070704_100069567
681 Ga0070664_100056779
682 Ga0070664_100183124
683 Ga0068857_100120707
684 Ga0070702_100073859
685 Ga0068859_100000920
686 Ga0068859_100054565
687 Ga0068864_100017905
688 Ga0068870_10000803
689 Ga0068863_100063270
690 Ga0068858_100007950
691 Ga0068858_100026670
692 Ga0068858_100073842
693 Ga0068860_100083839
694 Ga0068860_100130455
695 Ga0081455_10000059
696 Ga0081455_10000456
697 Ga0081455_10003227
698 Ga0081538_10040388
699 Ga0081538_10055126
700 Ga0081540_1065934
701 Ga0070717_10003657
702 Ga0070717_10087281
703 Ga0070717_10130831
704 Ga0075432_10000777
705 Ga0070716_100003302
706 Ga0075427_10001355
707 Ga0097621_100028569
708 Ga0097621_100039536
709 Ga0068871_100002951
710 Ga0068871_100113250
711 Ga0075428_100003077
712 Ga0075430_100002563
713 Ga0075430_100076700
714 Ga0075431_100003535
715 Ga0075433_10002075
716 Ga0075433_10008289
717 Ga0075433_10056340
718 Ga0075433_10103426
719 Ga0075434_100001839
720 Ga0075434_100078788
721 Ga0075434_100130585
722 Ga0075434_100297595
723 Ga0075434_100353531
724 Ga0075429_100001678
725 Ga0075429_100168541
726 Ga0068865_100018577
727 Ga0075436_100001222
728 Ga0097620_100000920
729 Ga0097620_100054565
730 Ga0075435_100000314
731 Ga0075435_100021586
732 Ga0075435_100080265
733 Ga0105251_10027996
734 Ga0105244_10007516
735 Ga0105240_10334096
736 Ga0111539_10002742
737 Ga0111539_10003209
738 Ga0111539_10051951
739 Ga0111539_10064222
740 Ga0111539_10096535
741 Ga0111539_10259694
742 Ga0105245_10019958
743 Ga0105247_10004155
744 Ga0114129_10078557
745 Ga0114129_10242644
746 Ga0105243_10024358
747 Ga0105243_10091714
748 Ga0105243_10398191
749 Ga0105241_10004816
750 Ga0105242_10000995
751 Ga0105242_10003723
752 Ga0105248_10006282
753 Ga0105248_10072372
754 Ga0105237_10041751
755 Ga0105237_10045361
756 Ga0105238_10077312
757 Ga0105249_10044646
758 Ga0105249_10293185
759 Ga0105239_10210463
760 Ga0105239_10246204
761 Ga0105246_10007150
762 Ga0105246_10093827
763 Ga0105246_10103218
764 Ga0157373_10058795
765 Ga0157370_10108266
766 Ga0157374_10199571
767 Ga0157378_10019352
768 Ga0157378_10035949
769 Ga0157378_10037879
770 Ga0163162_10049480
771 Ga0163162_10084481
772 Ga0163162_10652073
773 Ga0157375_10413723
774 Ga0163163_10004815
775 Ga0163163_10029832
776 Ga0157380_10030695
777 Ga0157380_10099062
778 Ga0157377_10008954
779 Ga0157377_10054757
780 Ga0157379_10091012
781 Ga0157379_10100826
782 Ga0157376_10089903
783 Ga0157376_10091250
784 Ga0163161_10039028
785 Ga0163161_10083752
786 Ga0213876_10018982
787 Ga0213875_10000011
788 Ga0209233_1002060
789 Ga0207666_1000058
790 Ga0207697_10002181
791 Ga0207653_10010841
792 Ga0207692_10002221
793 Ga0207642_10004337
794 Ga0207710_10008217
795 Ga0207710_10031948
796 Ga0207688_10000104
797 Ga0207647_10017913
798 Ga0207685_10035700
799 Ga0207699_10005711
800 Ga0207645_10008843
801 Ga0207643_10000064
802 Ga0207684_10046297
803 Ga0207654_10031302
804 Ga0207707_10019344
805 Ga0207707_10021923
806 Ga0207707_10089166
807 Ga0207671_10066094
808 Ga0207693_10001804
809 Ga0207693_10019287
810 Ga0207693_10021370
811 Ga0207693_10061368
812 Ga0207663_10069935
813 Ga0207660_10023685
814 Ga0207662_10000134
815 Ga0207657_10012774
816 Ga0207657_10103842
817 Ga0207649_10005821
818 Ga0207649_10061614
819 Ga0207652_10006818
820 Ga0207652_10141615
821 Ga0207652_10149392
822 Ga0207646_10224673
823 Ga0207681_10012844
824 Ga0207650_10037274
825 Ga0207650_10078711
826 Ga0207659_10068521
827 Ga0207659_10304306
828 Ga0207700_10000783
829 Ga0207664_10028834
830 Ga0207664_10057083
831 Ga0207664_10313657
832 Ga0207644_10004656
833 Ga0207644_10005681
834 Ga0207644_10050523
835 Ga0207706_10034053
836 Ga0207686_10003587
837 Ga0207686_10061234
838 Ga0207686_10116783
839 Ga0207709_10009237
840 Ga0207709_10166721
841 Ga0207670_10004727
842 Ga0207670_10055502
843 Ga0207704_10064657
844 Ga0207665_10000547
845 Ga0207665_10005569
846 Ga0207665_10044170
847 Ga0207691_10004339
848 Ga0207711_10008097
849 Ga0207711_10008358
850 Ga0207689_10001739
851 Ga0207689_10025768
852 Ga0207661_10000098
853 Ga0207661_10070993
854 Ga0207679_10256111
855 Ga0207667_10245253
856 Ga0207651_10000786
857 Ga0207712_10071871
858 Ga0207712_10188627
859 Ga0207703_10001605
860 Ga0207703_10076397
861 Ga0207703_10198613
862 Ga0207639_10095325
863 Ga0207678_10053612
864 Ga0207708_10013004
865 Ga0207708_10028544
866 Ga0207708_10172943
867 Ga0207702_10020830
868 Ga0207702_10172241
869 Ga0207641_10016098
870 Ga0207641_10205274
871 Ga0207648_10004808
872 Ga0207676_10001552
873 Ga0207676_10127581
874 Ga0207676_10359161
875 Ga0207674_10011184
876 Ga0207674_10036461
877 Ga0207675_100001176
878 Ga0207683_10001611
879 Ga0207683_10007909
880 Ga0207683_10011462
881 Ga0207683_10158989
882 Ga0209973_1000946
883 Ga0210002_1002471
884 Ga0209971_1004666
885 Ga0207428_10000075
886 Ga0207428_10001650
887 Ga0268266_10027490
888 Ga0268266_10070460
889 Ga0268265_10086217
890 Ga0268264_10027530
891 Ga0265325_10000398
892 Ga0265325_10006343
893 Ga0265325_10041595
894 Ga0265339_10002964
895 Ga0265313_10000710
896 Ga0265313_10006372
897 Ga0265313_10009195
898 Ga0265313_10030743
899 Ga0265314_10000439
900 Ga0316583_10006840
901 Ga0373930_0000770
902 Ga0373948_0000230
903 Ga0373959_0001479
904 Ga0373934_0026186
905 Ga0373940_0000632
906 Ga0373940_0019538
907 Ga0373949_0005367
908 Ga0373951_0000245
909 Ga0373951_0003734
910 Ga0373952_0000027
911 Ga0373932_0000184
912 Ga0373932_0000645
913 Ga0373932_0005721
914 Ga0373939_0001544
915 Ga0373941_0001157
916 Ga0373941_0001231
917 Ga0373941_0001755
918 Ga0373956_0023980
919 Ga0373956_0037468
920 Ga0373957_0006219
921 Ga0373960_0005573
922 Ga0373943_0010837
923 Ga0373943_0030427
924 Ga0373943_0040500
925 Ga0373946_0012132
926 Ga0373955_0003756
927 Ga0373942_0000413
928 Ga0373961_0001099
929 Ga0373962_0003152
930 Ga0373924_0039500
931 Ga0373931_0039690
932 Ga0373935_0103490
933 Ga0373935_0155350
934 Ga0373927_0019963
935 Ga0373933_0001260
936 Ga0373933_0021610
937 Ga0373933_0068902
938 Ga0373937_0011313
939 Ga0373937_0028218
940 Ga0373937_0058950
941 Ga0373937_0070318
942 Ga0373937_0325124
943 Ga0436364_0622718
944 Ga0436365_0253472
945 Ga0436365_1171722
946 Ga0436363_0783330
947 Ga0436362_0844795
948 Ga0439441_000229
949 Ga0439450_000962
950 Ga0439460_0022020
951 Ga0453684_0037750
952 Ga0451576_0020807
953 Ga0451576_0057657
954 Ga0451576_0068019
955 Ga0451576_0345918
956 Ga0495592_0027486
957 Ga0495592_0186346
958 Ga0495603_0011684
959 Ga0495629_0000768
960 Ga0495641_0055727
961 Ga0495651_0152169
962 Ga0495653_0051147
963 Ga0495653_0061811
964 Ga0495653_0136686
965 Ga0495582_0011452
966 Ga0495582_0013456
967 Ga0495608_0012014
968 Ga0495608_0033600
969 Ga0495618_0010501
970 Ga0495628_0002874
971 Ga0495628_0058960
972 Ga0495628_0279347
973 Ga0495630_0034958
974 Ga0495663_0011203
975 Ga0495652_0002010
976 Ga0495665_0014559
977 Ga0495665_0049524
978 Ga0495640_0020864
979 Ga0495640_0029202
980 Ga0495587_0001517
981 Ga0495587_0014807
982 Ga0495587_0106890
983 Ga0495645_0001520
984 Ga0495645_0029463
985 Ga0495667_0020913
986 Ga0495667_0146773
987 Ga0495634_0059231
988 Ga0495635_0009233
989 Ga0495635_0018885
990 Ga0495635_0043293
991 Ga0495635_0106288
992 Ga0495659_0000979
993 Ga0495659_0031557
994 Ga0495659_0057308
995 Ga0495588_0031006
996 Ga0495657_0013755
997 Ga0495657_0031614
998 Ga0495599_0180440
999 Ga0495623_0009973
1000 Ga0495658_0159434
1001 Ga0495613_0056871
1002 Ga0495600_0050039
1003 Ga0495600_0127882
1004 Ga0495581_0087491
1005 Ga0495581_0092878
1006 Ga0495604_0013004
1007 Ga0495604_0039533
1008 Ga0495604_0117840
1009 Ga0495636_0003694
1010 Ga0495674_0024012
1011 Ga0495674_0074182
1012 Ga0495676_0071500
1013 Ga0495680_0001681
1014 Ga0495680_0003788
1015 Ga0495680_0008770
1016 Ga0495675_0011002
1017 Ga0495675_0020819
1018 Ga0495685_008811
1019 Ga0495684_0029590
1020 Ga0495593_0011214
1021 Ga0495602_0007672
1022 Ga0495602_0072830
1023 Ga0496100_0052053
1024 Ga0496101_0177200
1025 Ga0496102_0005119
1026 Ga0496102_0120284
1027 Ga0496102_0155633
1028 Ga0496102_0158646
1029 Ga0496102_0223991
1030 Ga0496103_0073753
1031 Ga0496103_0116744
1032 Ga0496104_0000126
1033 Ga0496104_0025839
1034 Ga0496104_0050393
1035 Ga0496104_0376826
1036 Ga0496105_0001562
1037 Ga0496105_0009019
1038 Ga0496105_0264083
1039 Ga0496106_0018040
1040 Ga0496106_0112034
1041 Ga0496106_0346898
1042 Ga0496107_0037405
1043 Ga0496107_0051832
1044 Ga0496107_0078683
1045 Ga0496108_0004643
1046 Ga0496109_0000188
1047 Ga0496109_0000831
1048 Ga0496109_0143609
1049 Ga0496109_0196811
1050 Ga0496109_0470465
1051 Ga0496110_0045337
1052 Ga0496111_0114945
1053 Ga0496112_0287030
1054 Ga0496112_0385834
1055 Ga0496112_0428836
1056 Ga0496113_0000478
1057 Ga0496113_0083130
1058 Ga0496114_0018626
1059 Ga0496114_0045990
1060 Ga0496115_0007975
1061 Ga0496115_0015337
1062 Ga0496115_0025762
1063 Ga0496115_0036866
1064 Ga0496115_0048656
1065 Ga0496115_0186597
1066 Ga0501031_0059673
1067 Ga0501032_0191801
1068 Ga0501033_0011371
1069 Ga0501034_0000820
1070 Ga0501034_0001125
1071 Ga0501034_0101635
1072 Ga0501034_0163881
1073 Ga0501034_0242724
1074 Ga0501036_0000216
1075 Ga0501037_0029194
1076 Ga0501037_0077356
1077 Ga0501038_0214244
1078 Ga0501039_0044131
1079 Ga0501039_0070599
1080 Ga0501039_0252895
1081 Ga0501043_0002528
1082 Ga0501043_0094269
1083 Ga0501043_0115688
1084 Ga0501043_0178420
1085 Ga0501046_0087739
1086 Ga0501047_0000124
1087 Ga0501047_0129499
1088 Ga0501047_0237466
1089 Ga0501048_0000375
1090 Ga0501068_0005079
1091 Ga0501068_0026523
1092 Ga0501069_0113070
1093 Ga0501070_0008473
1094 Ga0501070_0015967
1095 Ga0501070_0021269
1096 Ga0501070_0025503
1097 Ga0501070_0122146
1098 Ga0501070_0130708
1099 Ga0501070_0150824
1100 Ga0501070_0275423
1101 Ga0501071_0223455
1102 Ga0501072_0235349
1103 Ga0501073_0057033
1104 Ga0501073_0193435
1105 Ga0501074_0045712
1106 Ga0501076_0076694
1107 Ga0501077_0007001
1108 Ga0501080_0000074
1109 Ga0501080_0057717
1110 Ga0501080_0082909
1111 Ga0501080_0166683
1112 Ga0501080_0362597
1113 Ga0501081_0017578
1114 Ga0501083_0000485
1115 Ga0501083_0035202
1116 Ga0501083_0038126
1117 Ga0501083_0082697
1118 Ga0501035_0001064
1119 Ga0501035_0189126
1120 Ga0501035_0204258
1121 Ga0501035_0230503
1122 Ga0501035_0308022
1123 Ga0501044_0001469
1124 Ga0501044_0067611
1125 Ga0501044_0110160
1126 Ga0501044_0112361
1127 Ga0501044_0381303
1128 Ga0501044_0405867
1129 Ga0501045_0044478
1130 nmdc:mga05p37_131679_c1
1131 nmdc:mga05p37_169897_c1
1132 nmdc:mga05p37_32_c1
1133 nmdc:mga05p37_4831_c1
1134 nmdc:mga09592_165932_c1
1135 nmdc:mga09592_1665_c1
1136 nmdc:mga09592_78668_c1
1137 nmdc:mga0qj67_12610_c1
1138 nmdc:mga0qj67_94011_c1
1139 nmdc:mga06r32_109945_c1
1140 nmdc:mga06r32_18880_c1
1141 nmdc:mga06r32_26837_c1
1142 nmdc:mga06r32_468844_c1
1143 nmdc:mga08y16_30292_c1
1144 nmdc:mga08y16_684_c1
1145 nmdc:mga0n895_143976_c1
1146 nmdc:mga0n895_27229_c1
1147 nmdc:mga0n895_527827_c1
1148 nmdc:mga0n895_824_c1
1149 nmdc:mga0n895_9017_c1
1150 nmdc:mga0rr50_139958_c1
1151 nmdc:mga0rr50_8982_c1
1152 nmdc:mga08x19_124210_c1
1153 nmdc:mga0a205_112337_c1
1154 nmdc:mga0a205_2160_c1
1155 nmdc:mga0a205_217_c1
1156 nmdc:mga0a205_31206_c1
1157 Ga0495601_0000159
1158 Ga0495601_0004928
1159 Ga0495612_0001126
1160 Ga0495612_0004030
1161 Ga0495612_0011691
1162 Ga0495595_0000928
1163 Ga0495595_0018108
1164 Ga0495619_0000016
1165 Ga0495619_0000190
1166 Ga0495619_0003261
1167 Ga0495619_0011237
1168 Ga0495619_0041075
1169 Ga0500644_0000552
1170 Ga0500651_0002718
1171 Ga0500595_000010
1172 Ga0500616_0000001
1173 Ga0500645_000559
1174 Ga0501084_0077891
1175 Ga0501082_0030992
1176 Ga0501082_0138617
1177 Ga0530510_0008941
1178 2643758770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

142

340

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kd9-assembly2.cif.gz_C-2 crystal structure of pyridine nucleotide disulfide oxidoreductase from pyrococcus horikoshii 0.9646 2 34
1nhr-assembly1.cif.gz_A an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide 0.9183 1 35
4bur-assembly4.cif.gz_D crystal structure of the reduced human apoptosis inducing factor complexed with nad 0.9135 2 34
1m6i-assembly1.cif.gz_A crystal structure of apoptosis inducing factor (aif) 0.9102 2 34
8d3i-assembly1.cif.gz_B crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with quinolin-4-amine 0.9055 2 34
ID Description Score Start End Superfamily
af_Q0E3X3_17_318_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9678 2 35 3.50.50.100
1yqzB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9592 1 32 3.50.50.60
3iwaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9369 1 33 3.50.50.60
3dzbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9345 1 33 3.40.50.720
1nhrA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9228 1 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2V8JI15-F1-model_v4 Monooxygenase 0.9853 1 252 GO:0004497
AF-A0A537C3L9-F1-model_v4 Monooxygenase 0.9829 1 368 GO:0004497
GO:0071949
AF-A0A2E2CWR4-F1-model_v4 Monooxygenase 0.9819 1 375 GO:0004497
GO:0071949
AF-A0A2V8JI15-F1-model_v4 Monooxygenase 0.9815 1 252 GO:0004497
AF-A0A537C3L9-F1-model_v4 Monooxygenase 0.9776 1 368 GO:0004497
GO:0071949

Map