F466874

General Info

Members Datasets Scaffolds Average Seq Length
589 448 355 472

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10000038|Ga0307508_1000003836
Length 466
Sequence MSFETAGYQLQPVLPEMVLAVGAMALLMLGAYRGQATTRLVTALAVCLLILTGILVLMLPTGKLVTFGGSFIVDDFARFLKILALTGSVATLVLSTEFLSDPSRRIFEYAILVLLSTLGMMVLISAGDLIALYLGLELMSLALYVVAASNRDNAKSTEAGLKYFVLGALSSGMLLYGASLIAAAAKTGSTGIVFGIVFLLAGLCFKISAVPFHMWTPDVYEGAPTPVTAFFASAPKVAALAVFTRVALTAFPGIISQWQQIVVFVAIASMALGSFAAIGQNNIKRLMAYSSIGHMGFALVGLAAGTVEGAQGVLVYISIYVAMTLGSFAIIIAIKRNGQAFENISDFAGLSRTNPTLAFFFAMLLFSLAGVPPLAGFFAKWYVFVAAIKAGLFTLSVIGVLTSVVGAYYYLRIIKVMYFDEPLERLDPVRVELGTVMALGGLFNMFFFAYPGPLVSVAAAAAKSLF

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
22 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
23 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
52 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
53 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
99 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
100 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
108 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
109 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
110 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
111 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
112 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
113 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
114 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
115 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
118 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
131 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
132 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
133 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
134 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
135 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
136 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
137 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
138 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
139 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
140 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
141 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
142 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
143 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
144 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
145 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
146 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
147 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
148 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
149 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
150 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
151 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
152 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
153 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
154 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
155 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
156 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
157 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
158 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
159 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
160 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
161 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
162 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
163 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
164 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
165 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
166 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
167 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
168 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
169 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
170 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
171 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
172 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
173 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
174 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
175 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
176 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
179 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
180 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
181 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
182 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
183 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
184 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
185 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
186 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
187 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
188 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
189 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
190 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
191 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
192 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
193 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
194 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
195 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
196 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
197 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
198 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
199 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
200 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
201 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
202 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
203 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
206 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
207 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
208 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
209 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
210 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
211 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
212 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
213 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
214 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
217 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
218 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
219 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
220 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
221 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
224 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
225 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
226 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
227 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
228 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
229 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
230 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
231 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
232 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
233 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
234 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
235 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
236 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
237 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
238 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
239 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
240 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
241 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
242 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
243 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
244 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
245 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
246 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
247 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
248 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
249 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
250 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
251 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
252 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
253 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
254 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
255 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
256 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
258 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
262 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
285 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
286 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
287 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
288 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
292 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
293 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
294 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
295 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
298 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
299 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
300 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
306 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
325 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
326 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
395 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
396 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
401 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
407 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
410 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
411 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
412 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
413 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
414 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
415 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
416 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
417 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
418 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
419 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
420 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
421 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
422 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
423 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
424 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
425 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
426 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
427 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
428 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
429 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
430 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
431 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
432 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
433 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
434 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
435 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
436 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
437 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
438 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
439 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
440 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
441 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
442 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
443 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
444 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
445 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
446 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
447 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
448 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.79
Metatranscriptomes 0
Isolates 39.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.83
Nodule 30.22
Rhizoplane 5.09
Rhizosphere 39.22
Stem 0
Stem Tuber 0
Unclassified 16.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000681 3300003203 Bacteria 15800
2 JGI25153J46596_10017476 3300003215 Bacteria 2824
3 JGI25160J50197_1000688 3300003354 Bacteria 18717
4 Ga0070676_10029519 3300005328 Bacteria 3120
5 Ga0070680_100003958 3300005336 Bacteria 11079
6 Ga0070660_100020390 3300005339 Bacteria 4872
7 Ga0070689_100023367 3300005340 Bacteria 4627
8 Ga0070691_10052439 3300005341 Bacteria 1950
9 Ga0070668_100020152 3300005347 Bacteria 5028
10 Ga0070671_100012940 3300005355 Bacteria 6723
11 Ga0070674_100155364 3300005356 Bacteria 1731
12 Ga0070688_100009813 3300005365 Bacteria 5261
13 Ga0070667_100016529 3300005367 Bacteria 6106
14 Ga0070667_100255499 3300005367 Bacteria 1568
15 Ga0070709_10053313 3300005434 Bacteria 2546
16 Ga0070714_100068226 3300005435 Bacteria 3068
17 Ga0070714_100082791 3300005435 Bacteria 2796
18 Ga0070714_100141507 3300005435 Bacteria 2160
19 Ga0070713_100010326 3300005436 Bacteria 6744
20 Ga0070713_100031831 3300005436 Bacteria 4206
21 Ga0070713_100070853 3300005436 Bacteria 2944
22 Ga0070710_10001905 3300005437 Bacteria 9874
23 Ga0070710_10004824 3300005437 Bacteria 6377
24 Ga0070711_100001657 3300005439 Bacteria 12319
25 Ga0070711_100019783 3300005439 Bacteria 4326
26 Ga0070711_100021744 3300005439 Bacteria 4151
27 Ga0070711_100077427 3300005439 Bacteria 2360
28 Ga0070708_100137084 3300005445 Bacteria 2268
29 Ga0070663_100086704 3300005455 Bacteria 2312
30 Ga0070678_100031872 3300005456 Bacteria 3641
31 Ga0070681_10208988 3300005458 Bacteria 1868
32 Ga0068867_100043171 3300005459 Bacteria 3300
33 Ga0070706_100037379 3300005467 Bacteria 4484
34 Ga0070679_100003904 3300005530 Bacteria 13710
35 Ga0068853_100153799 3300005539 Bacteria 2072
36 Ga0068857_100073932 3300005577 Bacteria 3037
37 Ga0068856_100000206 3300005614 Bacteria 63167
38 Ga0068856_100128596 3300005614 Bacteria 2537
39 Ga0070702_100080566 3300005615 Bacteria 1948
40 Ga0068852_100007921 3300005616 Bacteria 7783
41 Ga0068851_10011399 3300005834 Bacteria 4168
42 Ga0068870_10040915 3300005840 Bacteria 2406
43 Ga0068860_100000469 3300005843 Bacteria 50219
44 Ga0081538_10040572 3300005981 Bacteria 2967
45 Ga0081540_1000108 3300005983 Bacteria 88825
46 Ga0081540_1000194 3300005983 Bacteria 62934
47 Ga0081540_1005440 3300005983 Bacteria 9503
48 Ga0081540_1015268 3300005983 Bacteria 4869
49 Ga0081540_1019388 3300005983 Bacteria 4136
50 Ga0081540_1036959 3300005983 Bacteria 2596
51 Ga0081540_1038145 3300005983 Bacteria 2536
52 Ga0081540_1072766 3300005983 Bacteria 1582
53 Ga0081539_10000269 3300005985 Bacteria 119082
54 Ga0075365_10011221 3300006038 Bacteria 5261
55 Ga0075365_10048847 3300006038 Bacteria 2786
56 Ga0075363_100028962 3300006048 Bacteria 2854
57 Ga0075363_100064607 3300006048 Bacteria 1977
58 Ga0075364_10093305 3300006051 Bacteria 1999
59 Ga0070716_100093956 3300006173 Bacteria 1822
60 Ga0070712_100028573 3300006175 Bacteria 3732
61 Ga0075362_10063132 3300006177 Bacteria 1679
62 Ga0075367_10081370 3300006178 Bacteria 1960
63 Ga0075369_10022935 3300006186 Bacteria 2577
64 Ga0075369_10039070 3300006186 Bacteria 2026
65 Ga0075366_10058563 3300006195 Bacteria 2288
66 Ga0075366_10099394 3300006195 Bacteria 1745
67 Ga0075370_10009067 3300006353 Bacteria 5145
68 Ga0075370_10046163 3300006353 Bacteria 2465
69 Ga0075430_100006921 3300006846 Bacteria 9557
70 Ga0068865_100103464 3300006881 Bacteria 2089
71 Ga0099824_1017629 3300006942 Bacteria 6121
72 Ga0099822_1006195 3300006943 Bacteria 15605
73 Ga0099823_1036180 3300006944 Bacteria 3807
74 Ga0099795_10008603 3300007788 Bacteria 2919
75 Ga0099795_10012866 3300007788 Bacteria 2551
76 Ga0099795_10013977 3300007788 Bacteria 2477
77 Ga0105240_10073048 3300009093 Bacteria 4237
78 Ga0111539_10111307 3300009094 Bacteria 3213
79 Ga0105245_10151781 3300009098 Bacteria 2191
80 Ga0105243_10104109 3300009148 Bacteria 2362
81 Ga0105248_10187241 3300009177 Bacteria 2332
82 Ga0105248_10223980 3300009177 Bacteria 2117
83 Ga0105237_10015902 3300009545 Bacteria 7823
84 Ga0105237_10031339 3300009545 Bacteria 5392
85 Ga0105237_10049988 3300009545 Bacteria 4202
86 Ga0105237_10075472 3300009545 Bacteria 3363
87 Ga0105237_10112302 3300009545 Bacteria 2717
88 Ga0105237_10127856 3300009545 Bacteria 2535
89 Ga0105237_10140240 3300009545 Bacteria 2411
90 Ga0105238_10037147 3300009551 Bacteria 4952
91 Ga0105238_10173410 3300009551 Bacteria 2133
92 Ga0157369_10064128 3300013105 Bacteria 3957
93 Ga0157374_10088521 3300013296 Bacteria 2949
94 Ga0157372_10045680 3300013307 Bacteria 4860
95 Ga0157375_10023492 3300013308 Bacteria 5691
96 Ga0163163_10104352 3300014325 Bacteria 2860
97 Ga0163163_10109880 3300014325 Bacteria 2785
98 Ga0213876_10015917 3300021384 Bacteria 3979
99 Ga0213876_10048179 3300021384 Bacteria 2252
100 Ga0213875_10000165 3300021388 Bacteria 68805
101 Ga0209677_100736 3300025253 Bacteria 16664
102 Ga0209233_1000803 3300025261 Bacteria 14041
103 Ga0209233_1003945 3300025261 Bacteria 5145
104 Ga0209455_1001378 3300025272 Bacteria 11099
105 Ga0209673_1018706 3300025273 Bacteria 2509
106 Ga0209564_1018381 3300025295 Bacteria 2667
107 Ga0209758_1002385 3300025297 Bacteria 19344
108 Ga0209758_1003773 3300025297 Bacteria 13376
109 Ga0209758_1006399 3300025297 Bacteria 8480
110 Ga0209758_1016882 3300025297 Bacteria 3677
111 Ga0207692_10003004 3300025898 Bacteria 6537
112 Ga0207710_10016928 3300025900 Bacteria 3088
113 Ga0207699_10001664 3300025906 Bacteria 10544
114 Ga0207699_10011672 3300025906 Bacteria 4446
115 Ga0207699_10030508 3300025906 Bacteria 3018
116 Ga0207699_10034313 3300025906 Bacteria 2877
117 Ga0207707_10001296 3300025912 Bacteria 23280
118 Ga0207707_10022540 3300025912 Bacteria 5505
119 Ga0207695_10129114 3300025913 Bacteria 2486
120 Ga0207671_10027041 3300025914 Bacteria 4292
121 Ga0207693_10055551 3300025915 Bacteria 3106
122 Ga0207693_10058802 3300025915 Bacteria 3012
123 Ga0207663_10008590 3300025916 Bacteria 5354
124 Ga0207663_10035734 3300025916 Bacteria 2983
125 Ga0207663_10066220 3300025916 Bacteria 2312
126 Ga0207663_10091336 3300025916 Bacteria 2021
127 Ga0207657_10028355 3300025919 Bacteria 5108
128 Ga0207694_10046844 3300025924 Bacteria 3342
129 Ga0207694_10060220 3300025924 Bacteria 2955
130 Ga0207700_10002197 3300025928 Bacteria 11192
131 Ga0207700_10019984 3300025928 Bacteria 4537
132 Ga0207700_10028701 3300025928 Bacteria 3917
133 Ga0207700_10141910 3300025928 Bacteria 1975
134 Ga0207664_10007415 3300025929 Bacteria 7605
135 Ga0207664_10028412 3300025929 Bacteria 4250
136 Ga0207664_10051334 3300025929 Bacteria 3256
137 Ga0207664_10060104 3300025929 Bacteria 3029
138 Ga0207706_10030685 3300025933 Bacteria 4794
139 Ga0207709_10043830 3300025935 Bacteria 2699
140 Ga0207665_10062214 3300025939 Bacteria 2532
141 Ga0207665_10067842 3300025939 Bacteria 2430
142 Ga0207689_10138784 3300025942 Bacteria 2002
143 Ga0207639_10077405 3300026041 Bacteria 2622
144 Ga0207702_10000516 3300026078 Bacteria 43552
145 Ga0207648_10068146 3300026089 Bacteria 3101
146 Ga0207676_10035626 3300026095 Bacteria 3779
147 Ga0207674_10047125 3300026116 Bacteria 4421
148 Ga0207674_10229857 3300026116 Bacteria 1802
149 Ga0207674_10278882 3300026116 Bacteria 1619
150 Ga0207698_10167665 3300026142 Bacteria 1930
151 Ga0209389_1000026 3300027296 Bacteria 147580
152 Ga0209389_1000117 3300027296 Bacteria 71506
153 Ga0209589_1000003 3300027357 Bacteria 629130
154 Ga0209589_1000022 3300027357 Bacteria 180757
155 Ga0209489_100003 3300027361 Bacteria 663105
156 Ga0209489_100058 3300027361 Bacteria 147117
157 Ga0209489_109135 3300027361 Bacteria 12644
158 Ga0209700_100003 3300027363 Bacteria 663105
159 Ga0209700_100021 3300027363 Bacteria 230859
160 Ga0209179_1003390 3300027512 Bacteria 2290
161 Ga0209588_1006465 3300027671 Bacteria 3407
162 Ga0268264_10000022 3300028381 Bacteria 476624
163 Ga0307517_10000111 3300028786 Bacteria 120304
164 Ga0307515_10013645 3300028794 Bacteria 15142
165 Ga0265338_10037607 3300028800 Bacteria 4602
166 Ga0307511_10047245 3300030521 Bacteria 3525
167 Ga0265325_10018460 3300031241 Bacteria 3868
168 Ga0265339_10000088 3300031249 Bacteria 78106
169 Ga0307509_10059610 3300031507 Bacteria 4038
170 Ga0265313_10000173 3300031595 Bacteria 68499
171 Ga0307508_10000038 3300031616 Bacteria 150186
172 Ga0307508_10098845 3300031616 Bacteria 2512
173 Ga0265342_10009668 3300031712 Bacteria 6763
174 Ga0265342_10078123 3300031712 Bacteria 1916
175 Ga0307516_10024007 3300031730 Bacteria 6236
176 Ga0307516_10129443 3300031730 Bacteria 2305
177 Ga0315911_1000001 3300033442 Bacteria 1088602
178 Ga0373956_0009619 3300035119 Bacteria 3937
179 Ga0373957_0004501 3300035120 Bacteria 4242
180 Ga0373943_0011104 3300035170 Bacteria 4047
181 Ga0373935_0049531 3300035692 Bacteria 2663
182 Ga0373935_0084182 3300035692 Bacteria 2071
183 Ga0373927_0025415 3300035695 Bacteria 3872
184 Ga0373927_0119869 3300035695 Bacteria 1717
185 Ga0373947_0088742 3300035725 Bacteria 1925
186 Ga0373937_0005216 3300036401 Bacteria 11097
187 Ga0395900_0197052 3300037418 Bacteria 2040
188 Ga0395898_0056929 3300037466 Bacteria 3810
189 Ga0395905_0046632 3300037471 Bacteria 4064
190 Ga0436364_1177974 3300037853 Bacteria 47646
191 Ga0395901_0144028 3300038443 Bacteria 2505
192 Ga0395901_0246522 3300038443 Bacteria 1862
193 Ga0436365_0802780 3300039437 Bacteria 4186
194 Ga0436365_0835883 3300039437 Bacteria 3507
195 Ga0436365_1104495 3300039437 Bacteria 6329
196 Ga0436361_1170103 3300039447 Bacteria 2165
197 Ga0436362_0305815 3300039453 Bacteria 2523
198 Ga0466963_0007006 3300044694 Bacteria 6710
199 Ga0466963_0010382 3300044694 Bacteria 5637
200 Ga0466957_0069524 3300044842 Bacteria 2175
201 Ga0466959_0014677 3300045049 Bacteria 5701
202 Ga0466959_0043807 3300045049 Bacteria 3298
203 Ga0495603_0014796 3300046455 Bacteria 4719
204 Ga0495638_0017320 3300046460 Bacteria 4807
205 Ga0495639_0059739 3300046475 Bacteria 1745
206 Ga0495664_0065502 3300046477 Bacteria 2166
207 Ga0495664_0091099 3300046477 Bacteria 1833
208 Ga0495606_0004193 3300046507 Bacteria 14598
209 Ga0495616_0043474 3300046513 Bacteria 2282
210 Ga0495630_0177245 3300046517 Bacteria 1625
211 Ga0495648_0003360 3300046524 Bacteria 14095
212 Ga0495640_0019432 3300046533 Bacteria 5014
213 Ga0495634_0022222 3300046642 Bacteria 4471
214 Ga0495600_0098264 3300046809 Bacteria 1908
215 Ga0495672_0013871 3300047320 Bacteria 5540
216 Ga0495687_022789 3300047443 Bacteria 3001
217 Ga0496100_0004311 3300048903 Bacteria 7531
218 Ga0496101_0012766 3300048904 Bacteria 5617
219 Ga0496101_0037110 3300048904 Bacteria 3455
220 Ga0496102_0016014 3300048905 Bacteria 6545
221 Ga0496102_0024702 3300048905 Bacteria 5344
222 Ga0496103_0013728 3300048906 Bacteria 4806
223 Ga0496104_0005723 3300048907 Bacteria 10878
224 Ga0496104_0104246 3300048907 Bacteria 2717
225 Ga0496104_0108396 3300048907 Bacteria 2662
226 Ga0496106_0000623 3300048909 Bacteria 25352
227 Ga0496106_0005727 3300048909 Bacteria 9194
228 Ga0496107_0012362 3300048910 Bacteria 5960
229 Ga0496108_0030478 3300048911 Bacteria 4471
230 Ga0496108_0044249 3300048911 Bacteria 3718
231 Ga0496109_0016831 3300048912 Bacteria 6398
232 Ga0496109_0019519 3300048912 Bacteria 5981
233 Ga0496109_0044184 3300048912 Bacteria 4041
234 Ga0496109_0058819 3300048912 Bacteria 3511
235 Ga0496110_0047700 3300048913 Bacteria 3752
236 Ga0496112_0000067 3300048915 Bacteria 68767
237 Ga0496112_0013997 3300048915 Bacteria 7424
238 Ga0496112_0036148 3300048915 Bacteria 4816
239 Ga0496112_0057815 3300048915 Bacteria 3819
240 Ga0496113_0049307 3300048916 Bacteria 3135
241 Ga0496114_0037512 3300048917 Bacteria 4008
242 Ga0496114_0045233 3300048917 Bacteria 3656
243 Ga0496115_0016680 3300048918 Bacteria 5598
244 Ga0496115_0022078 3300048918 Bacteria 4924
245 Ga0496115_0097252 3300048918 Bacteria 2411
246 Ga0496118_0011945 3300048921 Bacteria 8403
247 Ga0496118_0020314 3300048921 Bacteria 5893
248 Ga0496118_0047558 3300048921 Bacteria 3323
249 Ga0496119_0000289 3300048922 Bacteria 70660
250 Ga0496121_0000812 3300048924 Bacteria 56918
251 Ga0496121_0001595 3300048924 Bacteria 37710
252 Ga0496121_0088498 3300048924 Bacteria 2427
253 Ga0496122_0009638 3300048925 Bacteria 10111
254 Ga0496123_0000498 3300048926 Bacteria 68151
255 Ga0496124_0001501 3300048927 Bacteria 34172
256 Ga0496125_0003378 3300048928 Bacteria 19439
257 Ga0496126_0003507 3300048929 Bacteria 19762
258 Ga0496126_0005026 3300048929 Bacteria 15389
259 Ga0496126_0023550 3300048929 Bacteria 5967
260 Ga0496126_0051382 3300048929 Bacteria 3752
261 Ga0496126_0069587 3300048929 Bacteria 3138
262 Ga0496126_0227427 3300048929 Bacteria 1564
263 Ga0501031_0000406 3300049568 Bacteria 24952
264 Ga0501032_0000228 3300049569 Bacteria 46774
265 Ga0501032_0025329 3300049569 Bacteria 4090
266 Ga0501033_0000914 3300049570 Bacteria 26957
267 Ga0501033_0036675 3300049570 Bacteria 3672
268 Ga0501033_0102415 3300049570 Bacteria 2088
269 Ga0501034_0000097 3300049571 Bacteria 161027
270 Ga0501034_0000175 3300049571 Bacteria 119465
271 Ga0501034_0004331 3300049571 Bacteria 15831
272 Ga0501034_0100288 3300049571 Bacteria 2890
273 Ga0501034_0131942 3300049571 Bacteria 2481
274 Ga0501034_0132084 3300049571 Bacteria 2479
275 Ga0501036_0000158 3300049572 Bacteria 44516
276 Ga0501036_0000598 3300049572 Bacteria 26139
277 Ga0501036_0191708 3300049572 Bacteria 1719
278 Ga0501037_0000126 3300049573 Bacteria 71116
279 Ga0501037_0001159 3300049573 Bacteria 19501
280 Ga0501039_0002654 3300049575 Bacteria 13354
281 Ga0501043_0039258 3300049579 Bacteria 3720
282 Ga0501046_0000575 3300049580 Bacteria 36255
283 Ga0501047_0001252 3300049581 Bacteria 25141
284 Ga0501047_0007142 3300049581 Bacteria 10493
285 Ga0501047_0023378 3300049581 Bacteria 5934
286 Ga0501047_0092263 3300049581 Bacteria 2907
287 Ga0501048_0000588 3300049582 Bacteria 25774
288 Ga0501048_0001161 3300049582 Bacteria 19841
289 Ga0501067_0000898 3300049583 Bacteria 16003
290 Ga0501068_0007196 3300049584 Bacteria 6163
291 Ga0501069_0073094 3300049585 Bacteria 1922
292 Ga0501070_0027734 3300049586 Bacteria 4751
293 Ga0501070_0129852 3300049586 Bacteria 2082
294 Ga0501071_0036754 3300049587 Bacteria 3494
295 Ga0501072_0002976 3300049588 Bacteria 12770
296 Ga0501072_0109735 3300049588 Bacteria 2196
297 Ga0501073_0000035 3300049589 Bacteria 94077
298 Ga0501073_0077638 3300049589 Bacteria 2310
299 Ga0501074_0000266 3300049590 Bacteria 29764
300 Ga0501074_0039881 3300049590 Bacteria 3400
301 Ga0501079_0014874 3300049741 Bacteria 5931
302 Ga0501079_0061122 3300049741 Bacteria 2906
303 Ga0501080_0000734 3300049742 Bacteria 26489
304 Ga0501080_0004726 3300049742 Bacteria 12144
305 Ga0501080_0025614 3300049742 Bacteria 5477
306 Ga0501080_0029763 3300049742 Bacteria 5082
307 Ga0501081_0109203 3300049743 Bacteria 1962
308 Ga0501083_0009122 3300049744 Bacteria 7007
309 Ga0501083_0014090 3300049744 Bacteria 5590
310 Ga0501083_0055876 3300049744 Bacteria 2646
311 Ga0501083_0074768 3300049744 Bacteria 2250
312 Ga0501083_0077455 3300049744 Bacteria 2206
313 Ga0501035_0000319 3300049822 Bacteria 55737
314 Ga0501035_0014814 3300049822 Bacteria 7198
315 Ga0501035_0036787 3300049822 Bacteria 4435
316 Ga0501044_0000061 3300049823 Bacteria 133207
317 Ga0501044_0004122 3300049823 Bacteria 16308
318 Ga0501044_0013149 3300049823 Bacteria 8959
319 Ga0501044_0080479 3300049823 Bacteria 3300
320 Ga0501045_0020936 3300049824 Bacteria 4675
321 nmdc:mga0yw44_15866_c1 3300050492 Bacteria 4051
322 nmdc:mga06z11_29249_c1 3300050494 Bacteria 1936
323 nmdc:mga06z11_53824_c1 3300050494 Bacteria 2072
324 nmdc:mga07m45_12559_c1 3300050496 Bacteria 4479
325 nmdc:mga0qj67_177_c1 3300050509 Bacteria 43273
326 Ga0495601_0037727 3300053077 Bacteria 3020
327 Ga0495601_0088403 3300053077 Bacteria 1992
328 Ga0495612_0013626 3300053078 Bacteria 3275
329 Ga0500635_0011127 3300053080 Bacteria 2550
330 Ga0495595_0025430 3300053084 Bacteria 2624
331 Ga0495595_0042349 3300053084 Bacteria 2086
332 Ga0495619_0078497 3300053085 Bacteria 2219
333 Ga0500647_0079509 3300053091 Bacteria 1573
334 Ga0500566_0000187 3300053094 Bacteria 32100
335 Ga0500566_0012447 3300053094 Bacteria 5008
336 Ga0500641_0015150 3300053096 Bacteria 2856
337 Ga0500554_004314 3300053102 Bacteria 3003
338 Ga0500556_0000009 3300053104 Bacteria 288111
339 Ga0500557_000050 3300053105 Bacteria 54589
340 Ga0500595_002428 3300053119 Bacteria 9286
341 Ga0500595_004898 3300053119 Bacteria 5922
342 Ga0500642_0000058 3300053130 Bacteria 66200
343 Ga0500642_0000065 3300053130 Bacteria 57974
344 Ga0500559_0007587 3300053136 Bacteria 4792
345 Ga0500573_0009413 3300053140 Bacteria 5420
346 Ga0500603_002047 3300053150 Bacteria 4455
347 Ga0500616_0032718 3300053153 Bacteria 2842
348 Ga0500616_0039823 3300053153 Bacteria 2531
349 Ga0500622_0015979 3300053156 Bacteria 4015
350 Ga0500638_001948 3300053162 Bacteria 6901
351 Ga0500638_026874 3300053162 Bacteria 2758
352 Ga0500636_0002827 3300053177 Bacteria 9695
353 Ga0500596_000735 3300053735 Bacteria 6414
354 Ga0500661_000626 3300055283 Bacteria 6587
355 Ga0501082_0008155 3300060353 Bacteria 9037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005840 Ga0068870_10040915 Ga0068870_100409152 443
2 3300005983 Ga0081540_1005440 Ga0081540_10054403 444
3 3300006048 Ga0075363_100028962 Ga0075363_1000289622 446
4 3300006051 Ga0075364_10093305 Ga0075364_100933052 446
5 3300006195 Ga0075366_10058563 Ga0075366_100585632 446
6 3300006353 Ga0075370_10046163 Ga0075370_100461632 446
7 3300049744 Ga0501083_0009122 Ga0501083_0009122_4380_5816 447
8 3300028800 Ga0265338_10037607 Ga0265338_100376073 448
9 3300031241 Ga0265325_10018460 Ga0265325_100184603 448
10 3300031249 Ga0265339_10000088 Ga0265339_1000008822 448
11 3300031595 Ga0265313_10000173 Ga0265313_1000017325 448
12 3300031712 Ga0265342_10078123 Ga0265342_100781231 448
13 3300049744 Ga0501083_0055876 Ga0501083_0055876_152_1576 448
14 3300053153 Ga0500616_0032718 Ga0500616_0032718_497_1927 448
15 3300005328 Ga0070676_10029519 Ga0070676_100295192 449
16 3300005340 Ga0070689_100023367 Ga0070689_1000233673 449
17 3300005365 Ga0070688_100009813 Ga0070688_1000098133 449
18 3300009098 Ga0105245_10151781 Ga0105245_101517812 449
19 3300026095 Ga0207676_10035626 Ga0207676_100356262 449
20 3300048912 Ga0496109_0044184 Ga0496109_0044184_142_1566 449
21 3300053077 Ga0495601_0088403 Ga0495601_0088403_174_1598 449
22 3300006038 Ga0075365_10048847 Ga0075365_100488472 450
23 3300049571 Ga0501034_0132084 Ga0501034_0132084_946_2394 450
24 3300049581 Ga0501047_0023378 Ga0501047_0023378_3896_5344 450
25 3300049822 Ga0501035_0014814 Ga0501035_0014814_2336_3784 450
26 iso_pu_bacteria 8016603502 8016611471 451
27 3300005834 Ga0068851_10011399 Ga0068851_100113993 452
28 3300006186 Ga0075369_10039070 Ga0075369_100390702 452
29 3300009545 Ga0105237_10112302 Ga0105237_101123022 452
30 3300009551 Ga0105238_10037147 Ga0105238_100371472 452
31 3300025912 Ga0207707_10001296 Ga0207707_100012962 452
32 3300048903 Ga0496100_0004311 Ga0496100_0004311_1053_2486 452
33 3300048904 Ga0496101_0012766 Ga0496101_0012766_1868_3301 452
34 3300048905 Ga0496102_0016014 Ga0496102_0016014_2313_3746 452
35 3300048907 Ga0496104_0104246 Ga0496104_0104246_780_2213 452
36 3300048909 Ga0496106_0005727 Ga0496106_0005727_28_1461 452
37 3300048910 Ga0496107_0012362 Ga0496107_0012362_2211_3644 452
38 3300048911 Ga0496108_0030478 Ga0496108_0030478_2316_3749 452
39 3300048911 Ga0496108_0044249 Ga0496108_0044249_1188_2621 452
40 3300048912 Ga0496109_0016831 Ga0496109_0016831_4262_5695 452
41 3300048912 Ga0496109_0019519 Ga0496109_0019519_2206_3639 452
42 3300048913 Ga0496110_0047700 Ga0496110_0047700_1052_2485 452
43 3300048915 Ga0496112_0057815 Ga0496112_0057815_1136_2569 452
44 3300048918 Ga0496115_0097252 Ga0496115_0097252_401_1834 452
45 3300049572 Ga0501036_0191708 Ga0501036_0191708_27_1460 452
46 3300049590 Ga0501074_0039881 Ga0501074_0039881_923_2356 452
47 3300049742 Ga0501080_0025614 Ga0501080_0025614_297_1730 452
48 3300049571 Ga0501034_0004331 Ga0501034_0004331_12777_14210 453
49 3300049572 Ga0501036_0000598 Ga0501036_0000598_20565_21998 453
50 3300049582 Ga0501048_0000588 Ga0501048_0000588_6512_7945 453
51 3300049586 Ga0501070_0027734 Ga0501070_0027734_1125_2558 453
52 3300049742 Ga0501080_0000734 Ga0501080_0000734_1015_2448 453
53 3300049744 Ga0501083_0074768 Ga0501083_0074768_665_2098 453
54 3300049823 Ga0501044_0004122 Ga0501044_0004122_13558_14991 453
55 3300053130 Ga0500642_0000058 Ga0500642_0000058_63119_64555 453
56 3300049571 Ga0501034_0100288 Ga0501034_0100288_520_1950 455
57 3300003215 JGI25153J46596_10017476 JGI25153J46596_100174762 456
58 3300025924 Ga0207694_10046844 Ga0207694_100468442 456
59 3300031507 Ga0307509_10059610 Ga0307509_100596102 456
60 3300005336 Ga0070680_100003958 Ga0070680_1000039588 458
61 3300005339 Ga0070660_100020390 Ga0070660_1000203902 458
62 3300005458 Ga0070681_10208988 Ga0070681_102089881 458
63 3300005530 Ga0070679_100003904 Ga0070679_1000039042 458
64 3300005614 Ga0068856_100128596 Ga0068856_1001285962 458
65 3300005616 Ga0068852_100007921 Ga0068852_1000079212 458
66 3300025912 Ga0207707_10022540 Ga0207707_100225405 458
67 3300025919 Ga0207657_10028355 Ga0207657_100283553 458
68 3300003354 JGI25160J50197_1000688 JGI25160J50197_10006882 459
69 3300005347 Ga0070668_100020152 Ga0070668_1000201525 459
70 3300005367 Ga0070667_100255499 Ga0070667_1002554991 459
71 3300005455 Ga0070663_100086704 Ga0070663_1000867041 459
72 3300005467 Ga0070706_100037379 Ga0070706_1000373792 459
73 3300005983 Ga0081540_1000194 Ga0081540_100019457 459
74 3300005983 Ga0081540_1036959 Ga0081540_10369592 459
75 3300014325 Ga0163163_10104352 Ga0163163_101043522 459
76 3300030521 Ga0307511_10047245 Ga0307511_100472452 459
77 3300031730 Ga0307516_10024007 Ga0307516_100240073 459
78 3300035692 Ga0373935_0084182 Ga0373935_0084182_196_1632 459
79 3300035695 Ga0373927_0025415 Ga0373927_0025415_2223_3659 459
80 iso_pu_bacteria 2513237087 2513592720 459
81 iso_pu_bacteria 2828305725 2828310124 459
82 iso_pu_bacteria 2919450847 2919453921 459
83 iso_pu_bacteria 8001845381 8001849192 459
84 iso_pu_bacteria 8019668869 8019672660 459
85 3300006186 Ga0075369_10022935 Ga0075369_100229352 460
86 3300009177 Ga0105248_10223980 Ga0105248_102239802 460
87 3300027296 Ga0209389_1000026 Ga0209389_1000026141 460
88 3300027357 Ga0209589_1000022 Ga0209589_1000022141 460
89 3300027361 Ga0209489_100058 Ga0209489_100058142 460
90 3300028794 Ga0307515_10013645 Ga0307515_100136452 460
91 3300039437 Ga0436365_0835883 Ga0436365_0835883_1598_3025 460
92 3300044842 Ga0466957_0069524 Ga0466957_0069524_106_1533 460
93 3300049569 Ga0501032_0025329 Ga0501032_0025329_287_1720 460
94 3300049570 Ga0501033_0036675 Ga0501033_0036675_1315_2748 460
95 3300049570 Ga0501033_0102415 Ga0501033_0102415_531_1964 460
96 3300049571 Ga0501034_0000097 Ga0501034_0000097_102981_104414 460
97 3300049573 Ga0501037_0001159 Ga0501037_0001159_8169_9602 460
98 3300049579 Ga0501043_0039258 Ga0501043_0039258_1854_3287 460
99 3300049581 Ga0501047_0007142 Ga0501047_0007142_60_1493 460
100 3300049588 Ga0501072_0109735 Ga0501072_0109735_639_2072 460
101 3300049589 Ga0501073_0077638 Ga0501073_0077638_125_1558 460
102 3300049741 Ga0501079_0061122 Ga0501079_0061122_576_2009 460
103 3300049742 Ga0501080_0004726 Ga0501080_0004726_508_1941 460
104 3300049743 Ga0501081_0109203 Ga0501081_0109203_267_1700 460
105 3300049744 Ga0501083_0077455 Ga0501083_0077455_218_1651 460
106 3300049822 Ga0501035_0036787 Ga0501035_0036787_1974_3407 460
107 3300049823 Ga0501044_0013149 Ga0501044_0013149_7359_8792 460
108 3300053096 Ga0500641_0015150 Ga0500641_0015150_608_2044 460
109 iso_pu_bacteria 2643221651 2644288349 460
110 3300005435 Ga0070714_100068226 Ga0070714_1000682262 461
111 3300005439 Ga0070711_100077427 Ga0070711_1000774272 461
112 3300005983 Ga0081540_1019388 Ga0081540_10193881 461
113 3300006175 Ga0070712_100028573 Ga0070712_1000285732 461
114 3300006846 Ga0075430_100006921 Ga0075430_1000069212 461
115 3300021384 Ga0213876_10015917 Ga0213876_100159173 461
116 3300021388 Ga0213875_10000165 Ga0213875_1000016514 461
117 3300025297 Ga0209758_1003773 Ga0209758_10037733 461
118 3300025906 Ga0207699_10034313 Ga0207699_100343131 461
119 3300025915 Ga0207693_10058802 Ga0207693_100588022 461
120 3300025916 Ga0207663_10008590 Ga0207663_100085903 461
121 3300025929 Ga0207664_10060104 Ga0207664_100601042 461
122 3300035119 Ga0373956_0009619 Ga0373956_0009619_1291_2733 461
123 3300035120 Ga0373957_0004501 Ga0373957_0004501_1699_3135 461
124 3300035692 Ga0373935_0049531 Ga0373935_0049531_540_1982 461
125 3300036401 Ga0373937_0005216 Ga0373937_0005216_5455_6897 461
126 3300037853 Ga0436364_1177974 Ga0436364_1177974_13027_14463 461
127 3300039437 Ga0436365_0802780 Ga0436365_0802780_706_2142 461
128 3300039447 Ga0436361_1170103 Ga0436361_1170103_150_1586 461
129 3300044694 Ga0466963_0010382 Ga0466963_0010382_1482_2915 461
130 3300045049 Ga0466959_0043807 Ga0466959_0043807_320_1753 461
131 3300046517 Ga0495630_0177245 Ga0495630_0177245_165_1589 461
132 3300046533 Ga0495640_0019432 Ga0495640_0019432_2603_4027 461
133 3300046642 Ga0495634_0022222 Ga0495634_0022222_1964_3400 461
134 3300046809 Ga0495600_0098264 Ga0495600_0098264_213_1649 461
135 3300048907 Ga0496104_0108396 Ga0496104_0108396_1076_2557 461
136 3300048922 Ga0496119_0000289 Ga0496119_0000289_18052_19482 461
137 3300048925 Ga0496122_0009638 Ga0496122_0009638_724_2154 461
138 3300048926 Ga0496123_0000498 Ga0496123_0000498_502_1932 461
139 3300050509 nmdc:mga0qj67_177_c1 nmdc:mga0qj67_177_c1_1037_2473 461
140 3300053077 Ga0495601_0037727 Ga0495601_0037727_171_1595 461
141 3300053078 Ga0495612_0013626 Ga0495612_0013626_1261_2697 461
142 3300053084 Ga0495595_0042349 Ga0495595_0042349_203_1639 461
143 3300053085 Ga0495619_0078497 Ga0495619_0078497_91_1527 461
144 3300053104 Ga0500556_0000009 Ga0500556_0000009_33233_34663 461
145 iso_pu_bacteria 2507262055 2507509337 461
146 iso_pu_bacteria 2508501009 2508543393 461
147 iso_pu_bacteria 2508501042 2508698833 461
148 iso_pu_bacteria 2508501128 2509147331 461
149 iso_pu_bacteria 2511231028 2511396848 461
150 iso_pu_bacteria 2513237092 2513626815 461
151 iso_pu_bacteria 2513237094 2513637903 461
152 iso_pu_bacteria 2513237095 2513646659 461
153 iso_pu_bacteria 2513237096 2513656710 461
154 iso_pu_bacteria 2513237098 2513672250 461
155 iso_pu_bacteria 2513237101 2513691853 461
156 iso_pu_bacteria 2513237102 2513701313 461
157 iso_pu_bacteria 2513237104 2513718529 461
158 iso_pu_bacteria 2513237137 2513858499 461
159 iso_pu_bacteria 2513237139 2513876465 461
160 iso_pu_bacteria 2513237141 2513895015 461
161 iso_pu_bacteria 2513237145 2513917895 461
162 iso_pu_bacteria 2513237161 2514010806 461
163 iso_pu_bacteria 2515154112 2515628929 461
164 iso_pu_bacteria 2517093001 2517101992 461
165 iso_pu_bacteria 2517572143 2517893059 461
166 iso_pu_bacteria 2524023205 2524436579 461
167 iso_pu_bacteria 2524023210 2524466932 461
168 iso_pu_bacteria 2524023228 2524536823 461
169 iso_pu_bacteria 2528768022 2528851565 461
170 iso_pu_bacteria 2617270735 2617352318 461
171 iso_pu_bacteria 2617270741 2617376469 461
172 iso_pu_bacteria 2667528175 2671117682 461
173 iso_pu_bacteria 2721755755 2723845747 461
174 iso_pu_bacteria 2728368998 2728753249 461
175 iso_pu_bacteria 2744054633 2745081129 461
176 iso_pu_bacteria 2791355196 2793064030 461
177 iso_pu_bacteria 2791355197 2793070107 461
178 iso_pu_bacteria 2791355199 2793077280 461
179 iso_pu_bacteria 2802429603 2805919744 461
180 iso_pu_bacteria 2816332527 2818240147 461
181 iso_pu_bacteria 2824600985 2824603300 461
182 iso_pu_bacteria 2824609381 2824614051 461
183 iso_pu_bacteria 2824617872 2824619826 461
184 iso_pu_bacteria 2824626560 2824629434 461
185 iso_pu_bacteria 2824635225 2824637076 461
186 iso_pu_bacteria 2824644064 2824648511 461
187 iso_pu_bacteria 2824653114 2824656599 461
188 iso_pu_bacteria 2824661429 2824667854 461
189 iso_pu_bacteria 2824671348 2824676503 461
190 iso_pu_bacteria 2824679649 2824684923 461
191 iso_pu_bacteria 2824687955 2824692937 461
192 iso_pu_bacteria 2824696289 2824701579 461
193 iso_pu_bacteria 2824704595 2824713066 461
194 iso_pu_bacteria 2824714736 2824716317 461
195 iso_pu_bacteria 2824723954 2824726133 461
196 iso_pu_bacteria 2824732956 2824736973 461
197 iso_pu_bacteria 2824746037 2824750877 461
198 iso_pu_bacteria 2824753945 2824758579 461
199 iso_pu_bacteria 2824763712 2824768318 461
200 iso_pu_bacteria 2824773399 2824779138 461
201 iso_pu_bacteria 2838122688 2838126534 461
202 iso_pu_bacteria 2841941048 2841947193 461
203 iso_pu_bacteria 2841949485 2841950635 461
204 iso_pu_bacteria 2841957949 2841957987 461
205 iso_pu_bacteria 2841966195 2841966950 461
206 iso_pu_bacteria 2841974524 2841975700 461
207 iso_pu_bacteria 2841983080 2841990061 461
208 iso_pu_bacteria 2842038055 2842039750 461
209 iso_pu_bacteria 2842045827 2842047304 461
210 iso_pu_bacteria 2844315083 2844318389 461
211 iso_pu_bacteria 2847930680 2847935278 461
212 iso_pu_bacteria 2847939898 2847945869 461
213 iso_pu_bacteria 2849076700 2849079996 461
214 iso_pu_bacteria 2857509624 2857510632 461
215 iso_pu_bacteria 2874590934 2874597446 461
216 iso_pu_bacteria 2874604998 2874609635 461
217 iso_pu_bacteria 2874612657 2874612852 461
218 iso_pu_bacteria 2874620515 2874627897 461
219 iso_pu_bacteria 2874628541 2874636239 461
220 iso_pu_bacteria 2874645413 2874648522 461
221 iso_pu_bacteria 2876761206 2876770714 461
222 iso_pu_bacteria 2876771140 2876777757 461
223 iso_pu_bacteria 2876808645 2876809497 461
224 iso_pu_bacteria 2876818435 2876822484 461
225 iso_pu_bacteria 2879074833 2879078165 461
226 iso_pu_bacteria 2879083081 2879088979 461
227 iso_pu_bacteria 2879099564 2879102592 461
228 iso_pu_bacteria 2879110137 2879118504 461
229 iso_pu_bacteria 2879127579 2879134494 461
230 iso_pu_bacteria 2879142872 2879149971 461
231 iso_pu_bacteria 2881364244 2881366706 461
232 iso_pu_bacteria 2881665667 2881669536 461
233 iso_pu_bacteria 2885366525 2885371783 461
234 iso_pu_bacteria 2885374607 2885381981 461
235 iso_pu_bacteria 2885383462 2885387102 461
236 iso_pu_bacteria 2885409591 2885416968 461
237 iso_pu_bacteria 2888378607 2888383331 461
238 iso_pu_bacteria 2888388044 2888394591 461
239 iso_pu_bacteria 2888419890 2888423720 461
240 iso_pu_bacteria 2889033259 2889040562 461
241 iso_pu_bacteria 2893066018 2893068430 461
242 iso_pu_bacteria 2903727486 2903729337 461
243 iso_pu_bacteria 2903748898 2903755824 461
244 iso_pu_bacteria 2903768456 2903772556 461
245 iso_pu_bacteria 2904666416 2904672783 461
246 iso_pu_bacteria 2904690495 2904696257 461
247 iso_pu_bacteria 2904699407 2904702586 461
248 iso_pu_bacteria 2904711408 2904717175 461
249 iso_pu_bacteria 2906602504 2906606022 461
250 iso_pu_bacteria 2906610324 2906617939 461
251 iso_pu_bacteria 2906626472 2906627830 461
252 iso_pu_bacteria 2906635258 2906640683 461
253 iso_pu_bacteria 2906643746 2906648777 461
254 iso_pu_bacteria 2906660503 2906661431 461
255 iso_pu_bacteria 2908739725 2908743449 461
256 iso_pu_bacteria 2908756301 2908760957 461
257 iso_pu_bacteria 2908775508 2908779429 461
258 iso_pu_bacteria 2919073203 2919075410 461
259 iso_pu_bacteria 2922361189 2922367690 461
260 iso_pu_bacteria 2922368715 2922373489 461
261 iso_pu_bacteria 2922386360 2922392414 461
262 iso_pu_bacteria 2922393267 2922395641 461
263 iso_pu_bacteria 2922425934 2922429437 461
264 iso_pu_bacteria 2929615660 2929617235 461
265 iso_pu_bacteria 2929624759 2929626939 461
266 iso_pu_bacteria 2932784394 2932787747 461
267 iso_pu_bacteria 2932794094 2932796511 461
268 iso_pu_bacteria 2932801729 2932803493 461
269 iso_pu_bacteria 2932809354 2932813097 461
270 iso_pu_bacteria 2932818245 2932820987 461
271 iso_pu_bacteria 2932828146 2932835226 461
272 iso_pu_bacteria 2933577622 2933579192 461
273 iso_pu_bacteria 2935608549 2935611774 461
274 iso_pu_bacteria 2935616580 2935621605 461
275 iso_pu_bacteria 2935630451 2935633689 461
276 iso_pu_bacteria 2935638405 2935645538 461
277 iso_pu_bacteria 2935648319 2935651843 461
278 iso_pu_bacteria 2935656913 2935660653 461
279 iso_pu_bacteria 2935665750 2935667656 461
280 iso_pu_bacteria 2935675223 2935681818 461
281 iso_pu_bacteria 2935684952 2935688404 461
282 iso_pu_bacteria 2935694250 2935695748 461
283 iso_pu_bacteria 2935703347 2935706497 461
284 iso_pu_bacteria 2935713505 2935715423 461
285 iso_pu_bacteria 2935722832 2935726013 461
286 iso_pu_bacteria 2935732158 2935734242 461
287 iso_pu_bacteria 2935741537 2935743621 461
288 iso_pu_bacteria 2935750917 2935754342 461
289 iso_pu_bacteria 2935760218 2935768542 461
290 iso_pu_bacteria 2935769743 2935773997 461
291 iso_pu_bacteria 2935777560 2935780543 461
292 iso_pu_bacteria 2935785616 2935789609 461
293 iso_pu_bacteria 2935793552 2935797386 461
294 iso_pu_bacteria 2935801545 2935806536 461
295 iso_pu_bacteria 2935810662 2935813129 461
296 iso_pu_bacteria 2935819856 2935821252 461
297 iso_pu_bacteria 2935827899 2935830782 461
298 iso_pu_bacteria 2935837841 2935840808 461
299 iso_pu_bacteria 2935847175 2935850487 461
300 iso_pu_bacteria 2935855204 2935859852 461
301 iso_pu_bacteria 2935864058 2935869048 461
302 iso_pu_bacteria 2935873716 2935880732 461
303 iso_pu_bacteria 2935883170 2935886563 461
304 iso_pu_bacteria 2935908558 2935914091 461
305 iso_pu_bacteria 2935916978 2935921260 461
306 iso_pu_bacteria 2935926038 2935931720 461
307 iso_pu_bacteria 2935934488 2935940345 461
308 iso_pu_bacteria 2935942939 2935947830 461
309 iso_pu_bacteria 2935951376 2935956629 461
310 iso_pu_bacteria 2935959822 2935960441 461
311 iso_pu_bacteria 2935967501 2935973422 461
312 iso_pu_bacteria 2935975950 2935980963 461
313 iso_pu_bacteria 2935984226 2935989590 461
314 iso_pu_bacteria 2935992306 2935999380 461
315 iso_pu_bacteria 2936002035 2936006637 461
316 iso_pu_bacteria 2936011229 2936014709 461
317 iso_pu_bacteria 2936019824 2936023494 461
318 iso_pu_bacteria 2936028420 2936032522 461
319 iso_pu_bacteria 2936037263 2936043681 461
320 iso_pu_bacteria 2936046547 2936050450 461
321 iso_pu_bacteria 2936055302 2936059058 461
322 iso_pu_bacteria 2940556831 2940560282 461
323 iso_pu_bacteria 2941507105 2941510580 461
324 iso_pu_bacteria 2941515067 2941517681 461
325 iso_pu_bacteria 2941523033 2941525698 461
326 iso_pu_bacteria 2941531003 2941534148 461
327 iso_pu_bacteria 2941538514 2941541061 461
328 iso_pu_bacteria 3005474847 3005479600 461
329 iso_pu_bacteria 3005483717 3005489468 461
330 iso_pu_bacteria 3005506211 3005511897 461
331 iso_pu_bacteria 3005587118 3005588611 461
332 iso_pu_bacteria 3005594810 3005598479 461
333 iso_pu_bacteria 3005710791 3005714162 461
334 iso_pu_bacteria 3005718088 3005721668 461
335 iso_pu_bacteria 8006926726 8006928416 461
336 iso_pu_bacteria 8006933436 8006941526 461
337 iso_pu_bacteria 8006964411 8006967388 461
338 iso_pu_bacteria 8006973647 8006981235 461
339 iso_pu_bacteria 8006984368 8006988155 461
340 iso_pu_bacteria 8006994254 8006997703 461
341 iso_pu_bacteria 8016511872 8016514183 461
342 iso_pu_bacteria 8016522445 8016530378 461
343 iso_pu_bacteria 8016530956 8016535644 461
344 iso_pu_bacteria 8016539877 8016539928 461
345 iso_pu_bacteria 8016548790 8016553302 461
346 iso_pu_bacteria 8016557553 8016561680 461
347 iso_pu_bacteria 8016566248 8016573977 461
348 iso_pu_bacteria 8016575299 8016578099 461
349 iso_pu_bacteria 8016583857 8016592753 461
350 iso_pu_bacteria 8016595262 8016599516 461
351 iso_pu_bacteria 8016613128 8016622323 461
352 iso_pu_bacteria 8016622563 8016627567 461
353 iso_pu_bacteria 8016630954 8016631790 461
354 iso_pu_bacteria 8017057580 8017062235 461
355 iso_pu_bacteria 8019530166 8019535367 461
356 iso_pu_bacteria 8019538911 8019544131 461
357 iso_pu_bacteria 8019555841 8019557434 461
358 iso_pu_bacteria 8019565922 8019567866 461
359 iso_pu_bacteria 8019576017 8019581685 461
360 iso_pu_bacteria 8019586578 8019589350 461
361 iso_pu_bacteria 8019619141 8019627352 461
362 iso_pu_bacteria 8019629233 8019635219 461
363 iso_pu_bacteria 8019638758 8019644508 461
364 iso_pu_bacteria 8019648815 8019657526 461
365 iso_pu_bacteria 8019659431 8019663062 461
366 iso_pu_bacteria 8019678201 8019683502 461
367 iso_pu_bacteria 8055742211 8055747150 461
368 iso_pu_bacteria 8056673599 8056674494 461
369 iso_pu_bacteria 8056681323 8056685354 461
370 iso_pu_bacteria 8056689827 8056690155 461
371 iso_pu_bacteria 8056967851 8056972745 461
372 3300005355 Ga0070671_100012940 Ga0070671_1000129402 462
373 3300005367 Ga0070667_100016529 Ga0070667_1000165292 462
374 3300005434 Ga0070709_10053313 Ga0070709_100533132 462
375 3300005436 Ga0070713_100031831 Ga0070713_1000318313 462
376 3300005437 Ga0070710_10004824 Ga0070710_100048241 462
377 3300005439 Ga0070711_100021744 Ga0070711_1000217443 462
378 3300005577 Ga0068857_100073932 Ga0068857_1000739322 462
379 3300006048 Ga0075363_100064607 Ga0075363_1000646071 462
380 3300006177 Ga0075362_10063132 Ga0075362_100631322 462
381 3300006195 Ga0075366_10099394 Ga0075366_100993941 462
382 3300006353 Ga0075370_10009067 Ga0075370_100090672 462
383 3300009177 Ga0105248_10187241 Ga0105248_101872412 462
384 3300009545 Ga0105237_10049988 Ga0105237_100499884 462
385 3300009545 Ga0105237_10075472 Ga0105237_100754722 462
386 3300025253 Ga0209677_100736 Ga0209677_10073616 462
387 3300025261 Ga0209233_1000803 Ga0209233_10008039 462
388 3300025272 Ga0209455_1001378 Ga0209455_10013781 462
389 3300025273 Ga0209673_1018706 Ga0209673_10187062 462
390 3300025295 Ga0209564_1018381 Ga0209564_10183812 462
391 3300025297 Ga0209758_1002385 Ga0209758_10023853 462
392 3300025898 Ga0207692_10003004 Ga0207692_100030042 462
393 3300025906 Ga0207699_10030508 Ga0207699_100305082 462
394 3300025916 Ga0207663_10066220 Ga0207663_100662202 462
395 3300025928 Ga0207700_10028701 Ga0207700_100287012 462
396 3300025929 Ga0207664_10007415 Ga0207664_100074153 462
397 3300025942 Ga0207689_10138784 Ga0207689_101387841 462
398 3300026116 Ga0207674_10047125 Ga0207674_100471253 462
399 3300027296 Ga0209389_1000117 Ga0209389_100011764 462
400 3300027361 Ga0209489_109135 Ga0209489_1091354 462
401 3300027363 Ga0209700_100021 Ga0209700_10002166 462
402 3300039437 Ga0436365_1104495 Ga0436365_1104495_38_1465 462
403 3300039453 Ga0436362_0305815 Ga0436362_0305815_1033_2460 462
404 3300044694 Ga0466963_0007006 Ga0466963_0007006_4612_6048 462
405 3300047443 Ga0495687_022789 Ga0495687_022789_1521_2957 462
406 3300048905 Ga0496102_0024702 Ga0496102_0024702_2857_4293 462
407 3300048906 Ga0496103_0013728 Ga0496103_0013728_179_1615 462
408 3300048912 Ga0496109_0058819 Ga0496109_0058819_1263_2699 462
409 3300048915 Ga0496112_0013997 Ga0496112_0013997_873_2309 462
410 3300048921 Ga0496118_0020314 Ga0496118_0020314_1147_2574 462
411 3300048921 Ga0496118_0047558 Ga0496118_0047558_1207_2643 462
412 3300048924 Ga0496121_0088498 Ga0496121_0088498_12_1439 462
413 3300050494 nmdc:mga06z11_53824_c1 nmdc:mga06z11_53824_c1_199_1635 462
414 3300050496 nmdc:mga07m45_12559_c1 nmdc:mga07m45_12559_c1_1887_3323 462
415 3300053094 Ga0500566_0000187 Ga0500566_0000187_30075_31511 462
416 3300053136 Ga0500559_0007587 Ga0500559_0007587_2716_4143 462
417 3300053153 Ga0500616_0039823 Ga0500616_0039823_144_1580 462
418 3300053162 Ga0500638_026874 Ga0500638_026874_403_1839 463
419 3300053177 Ga0500636_0002827 Ga0500636_0002827_7075_8511 463
420 3300005435 Ga0070714_100082791 Ga0070714_1000827912 464
421 3300005436 Ga0070713_100070853 Ga0070713_1000708531 464
422 3300005439 Ga0070711_100019783 Ga0070711_1000197833 464
423 3300005983 Ga0081540_1038145 Ga0081540_10381451 464
424 3300007788 Ga0099795_10012866 Ga0099795_100128663 464
425 3300009093 Ga0105240_10073048 Ga0105240_100730482 464
426 3300009545 Ga0105237_10127856 Ga0105237_101278562 464
427 3300013105 Ga0157369_10064128 Ga0157369_100641283 464
428 3300013307 Ga0157372_10045680 Ga0157372_100456802 464
429 3300021384 Ga0213876_10048179 Ga0213876_100481792 464
430 3300025906 Ga0207699_10001664 Ga0207699_100016647 464
431 3300025913 Ga0207695_10129114 Ga0207695_101291142 464
432 3300025916 Ga0207663_10035734 Ga0207663_100357342 464
433 3300025939 Ga0207665_10067842 Ga0207665_100678421 464
434 3300026041 Ga0207639_10077405 Ga0207639_100774052 464
435 3300031616 Ga0307508_10000038 Ga0307508_1000003836 464
436 3300038443 Ga0395901_0144028 Ga0395901_0144028_823_2256 464
437 3300046460 Ga0495638_0017320 Ga0495638_0017320_188_1624 464
438 3300046475 Ga0495639_0059739 Ga0495639_0059739_30_1463 464
439 3300048915 Ga0496112_0000067 Ga0496112_0000067_67296_68729 464
440 3300048924 Ga0496121_0000812 Ga0496121_0000812_27777_29210 464
441 3300048929 Ga0496126_0005026 Ga0496126_0005026_4618_6051 464
442 3300048929 Ga0496126_0023550 Ga0496126_0023550_1202_2638 464
443 3300049568 Ga0501031_0000406 Ga0501031_0000406_4196_5629 464
444 3300049569 Ga0501032_0000228 Ga0501032_0000228_6330_7763 464
445 3300049570 Ga0501033_0000914 Ga0501033_0000914_1440_2873 464
446 3300049571 Ga0501034_0000175 Ga0501034_0000175_63879_65312 464
447 3300049571 Ga0501034_0131942 Ga0501034_0131942_363_1796 464
448 3300049572 Ga0501036_0000158 Ga0501036_0000158_13504_14937 464
449 3300049573 Ga0501037_0000126 Ga0501037_0000126_33158_34591 464
450 3300049575 Ga0501039_0002654 Ga0501039_0002654_1780_3213 464
451 3300049580 Ga0501046_0000575 Ga0501046_0000575_19651_21084 464
452 3300049581 Ga0501047_0001252 Ga0501047_0001252_13567_15000 464
453 3300049582 Ga0501048_0001161 Ga0501048_0001161_16798_18231 464
454 3300049583 Ga0501067_0000898 Ga0501067_0000898_1060_2493 464
455 3300049584 Ga0501068_0007196 Ga0501068_0007196_1621_3054 464
456 3300049585 Ga0501069_0073094 Ga0501069_0073094_111_1544 464
457 3300049587 Ga0501071_0036754 Ga0501071_0036754_1021_2454 464
458 3300049588 Ga0501072_0002976 Ga0501072_0002976_1266_2699 464
459 3300049589 Ga0501073_0000035 Ga0501073_0000035_17331_18764 464
460 3300049590 Ga0501074_0000266 Ga0501074_0000266_15265_16698 464
461 3300049741 Ga0501079_0014874 Ga0501079_0014874_524_1957 464
462 3300049742 Ga0501080_0029763 Ga0501080_0029763_836_2269 464
463 3300049744 Ga0501083_0014090 Ga0501083_0014090_2038_3471 464
464 3300049822 Ga0501035_0000319 Ga0501035_0000319_43474_44907 464
465 3300049823 Ga0501044_0000061 Ga0501044_0000061_23665_25098 464
466 3300049823 Ga0501044_0080479 Ga0501044_0080479_609_2042 464
467 3300049824 Ga0501045_0020936 Ga0501045_0020936_2572_4005 464
468 3300053084 Ga0495595_0025430 Ga0495595_0025430_939_2375 464
469 3300053105 Ga0500557_000050 Ga0500557_000050_2742_4178 464
470 3300053130 Ga0500642_0000065 Ga0500642_0000065_9955_11391 464
471 3300060353 Ga0501082_0008155 Ga0501082_0008155_4600_6033 464
472 3300005341 Ga0070691_10052439 Ga0070691_100524391 465
473 3300005356 Ga0070674_100155364 Ga0070674_1001553641 465
474 3300005435 Ga0070714_100141507 Ga0070714_1001415072 465
475 3300005436 Ga0070713_100010326 Ga0070713_1000103266 465
476 3300005437 Ga0070710_10001905 Ga0070710_1000190510 465
477 3300005439 Ga0070711_100001657 Ga0070711_10000165710 465
478 3300005445 Ga0070708_100137084 Ga0070708_1001370842 465
479 3300005456 Ga0070678_100031872 Ga0070678_1000318722 465
480 3300005459 Ga0068867_100043171 Ga0068867_1000431712 465
481 3300005539 Ga0068853_100153799 Ga0068853_1001537992 465
482 3300005614 Ga0068856_100000206 Ga0068856_10000020638 465
483 3300005615 Ga0070702_100080566 Ga0070702_1000805661 465
484 3300005843 Ga0068860_100000469 Ga0068860_10000046946 465
485 3300005981 Ga0081538_10040572 Ga0081538_100405722 465
486 3300005983 Ga0081540_1000108 Ga0081540_10001083 465
487 3300005983 Ga0081540_1015268 Ga0081540_10152684 465
488 3300005983 Ga0081540_1072766 Ga0081540_10727661 465
489 3300006038 Ga0075365_10011221 Ga0075365_100112212 465
490 3300006173 Ga0070716_100093956 Ga0070716_1000939561 465
491 3300006178 Ga0075367_10081370 Ga0075367_100813702 465
492 3300006881 Ga0068865_100103464 Ga0068865_1001034642 465
493 3300006942 Ga0099824_1017629 Ga0099824_10176293 465
494 3300006943 Ga0099822_1006195 Ga0099822_10061959 465
495 3300006944 Ga0099823_1036180 Ga0099823_10361803 465
496 3300007788 Ga0099795_10008603 Ga0099795_100086032 465
497 3300007788 Ga0099795_10013977 Ga0099795_100139772 465
498 3300009094 Ga0111539_10111307 Ga0111539_101113073 465
499 3300009148 Ga0105243_10104109 Ga0105243_101041092 465
500 3300009545 Ga0105237_10015902 Ga0105237_100159024 465
501 3300009545 Ga0105237_10031339 Ga0105237_100313392 465
502 3300009545 Ga0105237_10140240 Ga0105237_101402402 465
503 3300009551 Ga0105238_10173410 Ga0105238_101734101 465
504 3300013296 Ga0157374_10088521 Ga0157374_100885213 465
505 3300013308 Ga0157375_10023492 Ga0157375_100234923 465
506 3300014325 Ga0163163_10109880 Ga0163163_101098802 465
507 3300025261 Ga0209233_1003945 Ga0209233_10039452 465
508 3300025297 Ga0209758_1006399 Ga0209758_10063995 465
509 3300025297 Ga0209758_1016882 Ga0209758_10168823 465
510 3300025900 Ga0207710_10016928 Ga0207710_100169282 465
511 3300025906 Ga0207699_10011672 Ga0207699_100116722 465
512 3300025914 Ga0207671_10027041 Ga0207671_100270412 465
513 3300025915 Ga0207693_10055551 Ga0207693_100555513 465
514 3300025916 Ga0207663_10091336 Ga0207663_100913362 465
515 3300025924 Ga0207694_10060220 Ga0207694_100602203 465
516 3300025928 Ga0207700_10002197 Ga0207700_100021979 465
517 3300025928 Ga0207700_10019984 Ga0207700_100199843 465
518 3300025928 Ga0207700_10141910 Ga0207700_101419102 465
519 3300025929 Ga0207664_10028412 Ga0207664_100284123 465
520 3300025929 Ga0207664_10051334 Ga0207664_100513342 465
521 3300025933 Ga0207706_10030685 Ga0207706_100306852 465
522 3300025935 Ga0207709_10043830 Ga0207709_100438302 465
523 3300025939 Ga0207665_10062214 Ga0207665_100622141 465
524 3300026078 Ga0207702_10000516 Ga0207702_1000051638 465
525 3300026089 Ga0207648_10068146 Ga0207648_100681462 465
526 3300026116 Ga0207674_10229857 Ga0207674_102298572 465
527 3300026116 Ga0207674_10278882 Ga0207674_102788822 465
528 3300026142 Ga0207698_10167665 Ga0207698_101676652 465
529 3300027357 Ga0209589_1000003 Ga0209589_100000325 465
530 3300027361 Ga0209489_100003 Ga0209489_10000376 465
531 3300027363 Ga0209700_100003 Ga0209700_10000376 465
532 3300027512 Ga0209179_1003390 Ga0209179_10033902 465
533 3300027671 Ga0209588_1006465 Ga0209588_10064652 465
534 3300028381 Ga0268264_10000022 Ga0268264_10000022218 465
535 3300028786 Ga0307517_10000111 Ga0307517_1000011124 465
536 3300031616 Ga0307508_10098845 Ga0307508_100988453 465
537 3300031712 Ga0265342_10009668 Ga0265342_100096683 465
538 3300031730 Ga0307516_10129443 Ga0307516_101294432 465
539 3300033442 Ga0315911_1000001 Ga0315911_10000011034 465
540 3300035170 Ga0373943_0011104 Ga0373943_0011104_1316_2752 465
541 3300035695 Ga0373927_0119869 Ga0373927_0119869_37_1473 465
542 3300035725 Ga0373947_0088742 Ga0373947_0088742_79_1515 465
543 3300037418 Ga0395900_0197052 Ga0395900_0197052_454_1890 465
544 3300037466 Ga0395898_0056929 Ga0395898_0056929_2320_3756 465
545 3300037471 Ga0395905_0046632 Ga0395905_0046632_2095_3531 465
546 3300038443 Ga0395901_0246522 Ga0395901_0246522_261_1697 465
547 3300045049 Ga0466959_0014677 Ga0466959_0014677_1197_2633 465
548 3300046455 Ga0495603_0014796 Ga0495603_0014796_3257_4693 465
549 3300046477 Ga0495664_0065502 Ga0495664_0065502_529_1965 465
550 3300046477 Ga0495664_0091099 Ga0495664_0091099_295_1731 465
551 3300046513 Ga0495616_0043474 Ga0495616_0043474_711_2150 465
552 3300046524 Ga0495648_0003360 Ga0495648_0003360_10208_11644 465
553 3300047320 Ga0495672_0013871 Ga0495672_0013871_2558_3997 465
554 3300048904 Ga0496101_0037110 Ga0496101_0037110_1771_3210 465
555 3300048907 Ga0496104_0005723 Ga0496104_0005723_8984_10423 465
556 3300048909 Ga0496106_0000623 Ga0496106_0000623_4827_6263 465
557 3300048915 Ga0496112_0036148 Ga0496112_0036148_604_2043 465
558 3300048916 Ga0496113_0049307 Ga0496113_0049307_598_2037 465
559 3300048917 Ga0496114_0037512 Ga0496114_0037512_603_2042 465
560 3300048917 Ga0496114_0045233 Ga0496114_0045233_1902_3341 465
561 3300048918 Ga0496115_0016680 Ga0496115_0016680_2497_3933 465
562 3300048918 Ga0496115_0022078 Ga0496115_0022078_3456_4895 465
563 3300048921 Ga0496118_0011945 Ga0496118_0011945_4439_5875 465
564 3300048924 Ga0496121_0001595 Ga0496121_0001595_5727_7163 465
565 3300048927 Ga0496124_0001501 Ga0496124_0001501_28928_30364 465
566 3300048928 Ga0496125_0003378 Ga0496125_0003378_115_1551 465
567 3300048929 Ga0496126_0003507 Ga0496126_0003507_12978_14414 465
568 3300048929 Ga0496126_0051382 Ga0496126_0051382_1855_3291 465
569 3300048929 Ga0496126_0069587 Ga0496126_0069587_1190_2626 465
570 3300048929 Ga0496126_0227427 Ga0496126_0227427_49_1485 465
571 3300049581 Ga0501047_0092263 Ga0501047_0092263_698_2134 465
572 3300049586 Ga0501070_0129852 Ga0501070_0129852_410_1846 465
573 3300050492 nmdc:mga0yw44_15866_c1 nmdc:mga0yw44_15866_c1_25_1461 465
574 3300050494 nmdc:mga06z11_29249_c1 nmdc:mga06z11_29249_c1_246_1682 465
575 3300053080 Ga0500635_0011127 Ga0500635_0011127_11_1447 465
576 3300053091 Ga0500647_0079509 Ga0500647_0079509_88_1524 465
577 3300053094 Ga0500566_0012447 Ga0500566_0012447_3093_4529 465
578 3300053102 Ga0500554_004314 Ga0500554_004314_547_1983 465
579 3300053119 Ga0500595_002428 Ga0500595_002428_820_2256 465
580 3300053119 Ga0500595_004898 Ga0500595_004898_592_2028 465
581 3300053140 Ga0500573_0009413 Ga0500573_0009413_2323_3759 465
582 3300053150 Ga0500603_002047 Ga0500603_002047_1043_2479 465
583 3300053156 Ga0500622_0015979 Ga0500622_0015979_1236_2672 465
584 3300053162 Ga0500638_001948 Ga0500638_001948_395_1831 465
585 3300053735 Ga0500596_000735 Ga0500596_000735_1829_3265 465
586 3300055283 Ga0500661_000626 Ga0500661_000626_663_2099 465
587 3300003203 JGI25406J46586_10000681 JGI25406J46586_100006811 466
588 3300005985 Ga0081539_10000269 Ga0081539_1000026973 466
589 3300046507 Ga0495606_0004193 Ga0495606_0004193_12852_14291 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

126

406

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6khj-assembly1.cif.gz_B supercomplex for electron transfer 0.9356 10 463
8e9h-assembly1.cif.gz_N mycobacterial respiratory complex i, fully-inserted quinone 0.9312 9 462
3rko-assembly2.cif.gz_D crystal structure of the membrane domain of respiratory complex i from e. coli at 3.0 angstrom resolution 0.9293 10 458
7nyh-assembly1.cif.gz_N respiratory complex i from escherichia coli - focused refinement of membrane arm 0.9215 10 461
7p7l-assembly1.cif.gz_N complex i from e. coli, ddm/lmng-purified, with nadh and fmn, open state 0.9204 10 461
ID Description Score Start End Superfamily
af_P0CC63_1_145_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9145 11 122 1.10.287.3510
af_P0AFF0_1_121_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8952 10 120 1.10.287.3510
af_O21048_1_126_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8498 12 122 1.10.287.3510
af_P0AFF0_1_121_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7987 10 120 1.10.287.3510
af_O21048_1_126_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7505 12 122 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A6I3CR09-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9701 240 466 GO:0012505
GO:0016020
AF-A0A258J1T4-F1-model_v4 NADH-quinone oxidoreductase subunit N (EC 7.1.1.-) (NADH dehydrogenase I subunit N) (NDH-1 subunit N) 0.9678 4 466 GO:0005886
GO:0008137
GO:0012505
GO:0042773
GO:0048038
GO:0050136
AF-A0A1H8BIJ6-F1-model_v4 NADH-quinone oxidoreductase subunit N (EC 7.1.1.-) (NADH dehydrogenase I subunit N) (NDH-1 subunit N) 0.9654 10 465 GO:0005886
GO:0008137
GO:0012505
GO:0042773
GO:0048038
GO:0050136
AF-A0A845SAG4-F1-model_v4 NADH-quinone oxidoreductase subunit NuoN (EC 1.6.5.11) 0.9652 35 466 GO:0005886
GO:0008137
GO:0012505
GO:0042773
GO:0048038
GO:0050136
AF-A0A4Q5X295-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.965 95 463 GO:0008137
GO:0012505
GO:0016020
GO:0042773

Feature Viewer

pLDDT pTM Quality
82.26 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map