F466831
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 589 | 327 | 586 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300002739|JGI25158J39367_1000074|JGI25158J39367_10000749 |
| Length | 130 |
| Sequence | MANVTNRPLSPHLQIYKPIPTMVMSIVHRITGGALYFGTLLIAWWLIAAATGQAYYDWANWVLGSIIGKLVLLGYTWALIHHLLGGFRHFMWDLGHGFEKEFSTKLAIANIIGSLCLTVLVWVIGFIIRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 2 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 3 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 62 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 72 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 76 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 77 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 136 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 137 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 138 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 141 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 148 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 156 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 157 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 161 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 164 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 165 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 166 | 3300041495 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaT | Metatranscriptome | Unclassified |
| 167 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 168 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 169 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 170 | 3300041499 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT | Metatranscriptome | Unclassified |
| 171 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 172 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 173 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 174 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 175 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 176 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 177 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 178 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 179 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 182 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 183 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 184 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 185 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 186 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 187 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 249 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 305 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 314 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.76 |
| Metatranscriptomes | 3.74 |
| Isolates | 0.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.54 |
| Nodule | 1.02 |
| Rhizoplane | 5.43 |
| Rhizosphere | 54.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10108679 | 3300001989 | Bacteria | 833 |
| 2 | JGI24034J26672_10036575 | 3300002239 | Bacteria | 814 |
| 3 | JGI25158J39367_1000074 | 3300002739 | Bacteria | 22903 |
| 4 | JGI25152J39213_1000936 | 3300002773 | Bacteria | 14306 |
| 5 | JGI25152J39213_1003827 | 3300002773 | Bacteria | 4977 |
| 6 | JGI25152J39213_1006916 | 3300002773 | Bacteria | 2999 |
| 7 | JGI25152J39213_1008129 | 3300002773 | Bacteria | 2634 |
| 8 | JGI25152J39213_1009567 | 3300002773 | Bacteria | 2293 |
| 9 | JGI25152J39213_1047966 | 3300002773 | Bacteria | 568 |
| 10 | JGI25152J39213_1048043 | 3300002773 | Bacteria | 567 |
| 11 | JGI25150J39212_1000037 | 3300002774 | Bacteria | 88885 |
| 12 | JGI25150J39212_1008276 | 3300002774 | Bacteria | 2045 |
| 13 | JGI25150J39212_1014880 | 3300002774 | Bacteria | 1309 |
| 14 | JGI25159J45721_1000262 | 3300002987 | Bacteria | 24623 |
| 15 | JGI25151J46595_10000220 | 3300003187 | Bacteria | 67327 |
| 16 | JGI25151J46595_10001921 | 3300003187 | Bacteria | 13177 |
| 17 | JGI25151J46595_10005265 | 3300003187 | Bacteria | 6704 |
| 18 | JGI25153J46596_10019108 | 3300003215 | Bacteria | 2634 |
| 19 | JGI25153J46596_10020222 | 3300003215 | Bacteria | 2522 |
| 20 | JGI25153J46596_10127183 | 3300003215 | Bacteria | 568 |
| 21 | JGI25153J46596_10127263 | 3300003215 | Bacteria | 567 |
| 22 | JGI25160J50197_1023007 | 3300003354 | Bacteria | 1812 |
| 23 | JGI25161J50226_1000137 | 3300003374 | Bacteria | 50627 |
| 24 | JGI25161J50226_1006204 | 3300003374 | Bacteria | 2200 |
| 25 | Ga0006562J51391_1020867 | 3300003578 | Bacteria | 1373 |
| 26 | Ga0055526_1002794 | 3300003771 | Bacteria | 11559 |
| 27 | Ga0055524_1003375 | 3300003775 | Bacteria | 7777 |
| 28 | Ga0055524_1005991 | 3300003775 | Bacteria | 5341 |
| 29 | Ga0055524_1058744 | 3300003775 | Bacteria | 812 |
| 30 | Ga0055536_1008778 | 3300003781 | Bacteria | 4284 |
| 31 | Ga0055528_1008866 | 3300003790 | Bacteria | 4257 |
| 32 | Ga0055528_1027613 | 3300003790 | Bacteria | 1591 |
| 33 | Ga0055528_1036012 | 3300003790 | Bacteria | 1190 |
| 34 | Ga0055528_1084660 | 3300003790 | Bacteria | 552 |
| 35 | Ga0055528_1086390 | 3300003790 | Bacteria | 543 |
| 36 | Ga0055540_1002204 | 3300003792 | Bacteria | 10584 |
| 37 | Ga0055540_1015240 | 3300003792 | Bacteria | 2249 |
| 38 | Ga0055540_1018131 | 3300003792 | Bacteria | 1939 |
| 39 | Ga0055540_1104853 | 3300003792 | Bacteria | 525 |
| 40 | Ga0055531_10014492 | 3300003794 | Bacteria | 3544 |
| 41 | Ga0055543_1000321 | 3300004625 | Bacteria | 33172 |
| 42 | Ga0055543_1000609 | 3300004625 | Bacteria | 19299 |
| 43 | Ga0065165_1004116 | 3300005262 | Bacteria | 9358 |
| 44 | Ga0065165_1028090 | 3300005262 | Bacteria | 1822 |
| 45 | Ga0065165_1141942 | 3300005262 | Bacteria | 567 |
| 46 | Ga0065715_11157466 | 3300005293 | Bacteria | 507 |
| 47 | Ga0070676_10308788 | 3300005328 | Bacteria | 1075 |
| 48 | Ga0070690_100399077 | 3300005330 | Bacteria | 1010 |
| 49 | Ga0070670_100486886 | 3300005331 | Bacteria | 1096 |
| 50 | Ga0070677_10270542 | 3300005333 | Bacteria | 852 |
| 51 | Ga0070666_10236991 | 3300005335 | Bacteria | 1290 |
| 52 | Ga0070682_100211738 | 3300005337 | Bacteria | 1374 |
| 53 | Ga0068868_100169772 | 3300005338 | Bacteria | 1805 |
| 54 | Ga0070689_100104713 | 3300005340 | Bacteria | 2244 |
| 55 | Ga0070668_100624455 | 3300005347 | Bacteria | 945 |
| 56 | Ga0070668_100949319 | 3300005347 | Bacteria | 771 |
| 57 | Ga0070668_101108500 | 3300005347 | Bacteria | 714 |
| 58 | Ga0070671_100022749 | 3300005355 | Bacteria | 5120 |
| 59 | Ga0070671_100199081 | 3300005355 | Bacteria | 1698 |
| 60 | Ga0070673_100150029 | 3300005364 | Bacteria | 1974 |
| 61 | Ga0070688_100093224 | 3300005365 | Bacteria | 1972 |
| 62 | Ga0070667_100335334 | 3300005367 | Bacteria | 1367 |
| 63 | Ga0070700_100569676 | 3300005441 | Bacteria | 883 |
| 64 | Ga0070663_100124679 | 3300005455 | Bacteria | 1950 |
| 65 | Ga0068867_100083766 | 3300005459 | Bacteria | 2408 |
| 66 | Ga0070685_10401961 | 3300005466 | Bacteria | 949 |
| 67 | Ga0070672_100642674 | 3300005543 | Bacteria | 926 |
| 68 | Ga0070665_100013723 | 3300005548 | Bacteria | 8154 |
| 69 | Ga0070665_100118172 | 3300005548 | Bacteria | 2653 |
| 70 | Ga0068864_101358555 | 3300005618 | Bacteria | 712 |
| 71 | Ga0068870_10523834 | 3300005840 | Bacteria | 794 |
| 72 | Ga0068863_100450318 | 3300005841 | Bacteria | 1263 |
| 73 | Ga0068858_100320791 | 3300005842 | Bacteria | 1481 |
| 74 | Ga0075365_10036684 | 3300006038 | Bacteria | 3177 |
| 75 | Ga0075365_10108551 | 3300006038 | Bacteria | 1906 |
| 76 | Ga0075365_10336995 | 3300006038 | Bacteria | 1063 |
| 77 | Ga0075365_10580465 | 3300006038 | Bacteria | 793 |
| 78 | Ga0075368_10045362 | 3300006042 | Bacteria | 1736 |
| 79 | Ga0075368_10051726 | 3300006042 | Bacteria | 1633 |
| 80 | Ga0075368_10213366 | 3300006042 | Bacteria | 819 |
| 81 | Ga0075363_100097577 | 3300006048 | Bacteria | 1624 |
| 82 | Ga0075363_100192490 | 3300006048 | Bacteria | 1163 |
| 83 | Ga0075363_100224401 | 3300006048 | Bacteria | 1077 |
| 84 | Ga0075363_100309083 | 3300006048 | Bacteria | 918 |
| 85 | Ga0075363_100458228 | 3300006048 | Bacteria | 754 |
| 86 | Ga0075364_10148567 | 3300006051 | Bacteria | 1579 |
| 87 | Ga0075364_10180403 | 3300006051 | Bacteria | 1429 |
| 88 | Ga0075364_10205256 | 3300006051 | Bacteria | 1336 |
| 89 | Ga0075364_10206689 | 3300006051 | Bacteria | 1331 |
| 90 | Ga0075362_10191263 | 3300006177 | Bacteria | 994 |
| 91 | Ga0075367_10010829 | 3300006178 | Bacteria | 4805 |
| 92 | Ga0075367_10020031 | 3300006178 | Bacteria | 3720 |
| 93 | Ga0075367_10021315 | 3300006178 | Bacteria | 3620 |
| 94 | Ga0075367_10074474 | 3300006178 | Bacteria | 2047 |
| 95 | Ga0075367_10084840 | 3300006178 | Bacteria | 1921 |
| 96 | Ga0075367_10310886 | 3300006178 | Bacteria | 992 |
| 97 | Ga0075367_11124187 | 3300006178 | Bacteria | 502 |
| 98 | Ga0075367_11124189 | 3300006178 | Bacteria | 502 |
| 99 | Ga0075369_10009506 | 3300006186 | Bacteria | 3780 |
| 100 | Ga0075369_10027517 | 3300006186 | Bacteria | 2377 |
| 101 | Ga0075369_10109392 | 3300006186 | Bacteria | 1245 |
| 102 | Ga0075369_10144981 | 3300006186 | Bacteria | 1084 |
| 103 | Ga0075369_10206460 | 3300006186 | Bacteria | 907 |
| 104 | Ga0075366_10019025 | 3300006195 | Bacteria | 3969 |
| 105 | Ga0075366_10072620 | 3300006195 | Bacteria | 2050 |
| 106 | Ga0075366_10132505 | 3300006195 | Bacteria | 1504 |
| 107 | Ga0075370_10079998 | 3300006353 | Bacteria | 1877 |
| 108 | Ga0075370_10092194 | 3300006353 | Bacteria | 1748 |
| 109 | Ga0075370_10123019 | 3300006353 | Bacteria | 1511 |
| 110 | Ga0075370_10240308 | 3300006353 | Bacteria | 1072 |
| 111 | Ga0075370_10268065 | 3300006353 | Bacteria | 1013 |
| 112 | Ga0075428_100574323 | 3300006844 | Bacteria | 1205 |
| 113 | Ga0075430_100564270 | 3300006846 | Bacteria | 939 |
| 114 | Ga0075431_100004192 | 3300006847 | Bacteria | 14110 |
| 115 | Ga0075429_100383221 | 3300006880 | Bacteria | 1231 |
| 116 | Ga0068865_100013256 | 3300006881 | Bacteria | 5206 |
| 117 | Ga0068865_100445476 | 3300006881 | Bacteria | 1069 |
| 118 | Ga0079104_1008512 | 3300006946 | Bacteria | 3581 |
| 119 | Ga0099826_10030104 | 3300006948 | Bacteria | 3947 |
| 120 | Ga0105244_10164819 | 3300009036 | Bacteria | 1057 |
| 121 | Ga0111539_11129439 | 3300009094 | Bacteria | 911 |
| 122 | Ga0105245_11663788 | 3300009098 | Bacteria | 690 |
| 123 | Ga0114129_11013046 | 3300009147 | Bacteria | 1045 |
| 124 | Ga0105243_10018422 | 3300009148 | Bacteria | 5289 |
| 125 | Ga0105243_10289378 | 3300009148 | Bacteria | 1479 |
| 126 | Ga0105242_10425634 | 3300009176 | Bacteria | 1245 |
| 127 | Ga0105248_10019080 | 3300009177 | Bacteria | 7583 |
| 128 | Ga0105248_10051665 | 3300009177 | Bacteria | 4612 |
| 129 | Ga0105248_10097131 | 3300009177 | Bacteria | 3319 |
| 130 | Ga0105249_10188760 | 3300009553 | Bacteria | 2010 |
| 131 | Ga0105249_10906165 | 3300009553 | Bacteria | 949 |
| 132 | Ga0123341_1000009 | 3300009765 | Bacteria | 122597 |
| 133 | Ga0123341_1073508 | 3300009765 | Bacteria | 1444 |
| 134 | Ga0123342_1015560 | 3300009766 | Bacteria | 6884 |
| 135 | Ga0123342_1037816 | 3300009766 | Bacteria | 1914 |
| 136 | Ga0105239_10281926 | 3300010375 | Bacteria | 1871 |
| 137 | Ga0105246_10145766 | 3300011119 | Bacteria | 1786 |
| 138 | Ga0157322_1010465 | 3300012490 | Bacteria | 748 |
| 139 | Ga0157319_1003163 | 3300012497 | Bacteria | 1000 |
| 140 | Ga0157326_1022789 | 3300012513 | Bacteria | 784 |
| 141 | Ga0157373_10007612 | 3300013100 | Bacteria | 8048 |
| 142 | Ga0157373_10395052 | 3300013100 | Bacteria | 990 |
| 143 | Ga0157370_10302579 | 3300013104 | Bacteria | 1476 |
| 144 | Ga0157369_12672092 | 3300013105 | Bacteria | 503 |
| 145 | Ga0157375_10133840 | 3300013308 | Bacteria | 2601 |
| 146 | Ga0157375_11096275 | 3300013308 | Bacteria | 932 |
| 147 | Ga0163163_10126457 | 3300014325 | Bacteria | 2594 |
| 148 | Ga0163163_10941558 | 3300014325 | Bacteria | 927 |
| 149 | Ga0157380_10101899 | 3300014326 | Bacteria | 2393 |
| 150 | Ga0157379_10629323 | 3300014968 | Bacteria | 1003 |
| 151 | Ga0157379_11810046 | 3300014968 | Bacteria | 600 |
| 152 | Ga0163161_10098119 | 3300017792 | Bacteria | 2177 |
| 153 | Ga0209436_100299 | 3300025208 | Bacteria | 22971 |
| 154 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 155 | Ga0207425_1001864 | 3300025245 | Bacteria | 8100 |
| 156 | Ga0207425_1005340 | 3300025245 | Bacteria | 3678 |
| 157 | Ga0207425_1013468 | 3300025245 | Bacteria | 1889 |
| 158 | Ga0209129_1000094 | 3300025258 | Bacteria | 172051 |
| 159 | Ga0209129_1002128 | 3300025258 | Bacteria | 10070 |
| 160 | Ga0209129_1002500 | 3300025258 | Bacteria | 8964 |
| 161 | Ga0209129_1007959 | 3300025258 | Bacteria | 3035 |
| 162 | Ga0209129_1020837 | 3300025258 | Bacteria | 1212 |
| 163 | Ga0209565_1042042 | 3300025263 | Bacteria | 848 |
| 164 | Ga0209673_1000052 | 3300025273 | Bacteria | 279795 |
| 165 | Ga0209673_1000459 | 3300025273 | Bacteria | 68727 |
| 166 | Ga0209673_1002893 | 3300025273 | Bacteria | 10885 |
| 167 | Ga0209673_1010831 | 3300025273 | Bacteria | 3811 |
| 168 | Ga0209673_1016194 | 3300025273 | Bacteria | 2799 |
| 169 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 170 | Ga0209675_1035903 | 3300025291 | Bacteria | 1126 |
| 171 | Ga0209676_1024551 | 3300025292 | Bacteria | 1950 |
| 172 | Ga0209025_1000533 | 3300025294 | Bacteria | 72404 |
| 173 | Ga0209025_1001035 | 3300025294 | Bacteria | 40774 |
| 174 | Ga0209025_1004694 | 3300025294 | Bacteria | 11662 |
| 175 | Ga0209025_1017322 | 3300025294 | Bacteria | 4169 |
| 176 | Ga0209025_1032055 | 3300025294 | Bacteria | 2468 |
| 177 | Ga0209025_1083880 | 3300025294 | Bacteria | 1070 |
| 178 | Ga0209564_1000569 | 3300025295 | Bacteria | 58592 |
| 179 | Ga0209564_1005379 | 3300025295 | Bacteria | 7336 |
| 180 | Ga0209564_1006046 | 3300025295 | Bacteria | 6668 |
| 181 | Ga0209564_1011522 | 3300025295 | Bacteria | 3953 |
| 182 | Ga0209758_1000415 | 3300025297 | Bacteria | 72404 |
| 183 | Ga0209758_1002002 | 3300025297 | Bacteria | 21937 |
| 184 | Ga0209758_1005244 | 3300025297 | Bacteria | 10149 |
| 185 | Ga0209758_1006541 | 3300025297 | Bacteria | 8305 |
| 186 | Ga0209758_1012770 | 3300025297 | Bacteria | 4655 |
| 187 | Ga0209758_1056284 | 3300025297 | Bacteria | 1329 |
| 188 | Ga0209256_1002153 | 3300025299 | Bacteria | 16996 |
| 189 | Ga0209256_1003192 | 3300025299 | Bacteria | 11860 |
| 190 | Ga0209256_1010657 | 3300025299 | Bacteria | 3811 |
| 191 | Ga0209256_1035927 | 3300025299 | Bacteria | 1304 |
| 192 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 193 | Ga0207426_1000595 | 3300025302 | Bacteria | 47697 |
| 194 | Ga0207426_1000723 | 3300025302 | Bacteria | 38116 |
| 195 | Ga0209051_1000561 | 3300025303 | Bacteria | 45148 |
| 196 | Ga0209051_1013102 | 3300025303 | Bacteria | 3965 |
| 197 | Ga0209051_1013239 | 3300025303 | Bacteria | 3937 |
| 198 | Ga0209051_1014030 | 3300025303 | Bacteria | 3766 |
| 199 | Ga0209257_1003339 | 3300025304 | Bacteria | 13886 |
| 200 | Ga0209257_1113897 | 3300025304 | Bacteria | 641 |
| 201 | Ga0207713_1143688 | 3300025735 | Bacteria | 777 |
| 202 | Ga0207688_10074121 | 3300025901 | Bacteria | 1935 |
| 203 | Ga0207647_10380707 | 3300025904 | Bacteria | 797 |
| 204 | Ga0207699_10576060 | 3300025906 | Bacteria | 818 |
| 205 | Ga0207645_10173479 | 3300025907 | Bacteria | 1414 |
| 206 | Ga0207643_10176338 | 3300025908 | Bacteria | 1292 |
| 207 | Ga0207671_10144770 | 3300025914 | Bacteria | 1833 |
| 208 | Ga0207693_10055090 | 3300025915 | Bacteria | 3120 |
| 209 | Ga0207663_10184124 | 3300025916 | Bacteria | 1494 |
| 210 | Ga0207644_10126493 | 3300025931 | Bacteria | 1951 |
| 211 | Ga0207644_10268503 | 3300025931 | Bacteria | 1366 |
| 212 | Ga0207686_10242058 | 3300025934 | Bacteria | 1313 |
| 213 | Ga0207709_10052906 | 3300025935 | Bacteria | 2496 |
| 214 | Ga0207670_10080457 | 3300025936 | Bacteria | 2277 |
| 215 | Ga0207669_10015374 | 3300025937 | Bacteria | 3858 |
| 216 | Ga0207691_10565622 | 3300025940 | Bacteria | 963 |
| 217 | Ga0207711_10086222 | 3300025941 | Bacteria | 2752 |
| 218 | Ga0207711_10544747 | 3300025941 | Bacteria | 1082 |
| 219 | Ga0207651_10221568 | 3300025960 | Bacteria | 1529 |
| 220 | Ga0207668_10031492 | 3300025972 | Bacteria | 3494 |
| 221 | Ga0207668_10318406 | 3300025972 | Bacteria | 1290 |
| 222 | Ga0207668_10569945 | 3300025972 | Bacteria | 983 |
| 223 | Ga0207658_10845857 | 3300025986 | Bacteria | 832 |
| 224 | Ga0207678_10099898 | 3300026067 | Bacteria | 2479 |
| 225 | Ga0207678_10227704 | 3300026067 | Bacteria | 1596 |
| 226 | Ga0207678_11582696 | 3300026067 | Bacteria | 577 |
| 227 | Ga0207648_10071399 | 3300026089 | Bacteria | 3026 |
| 228 | Ga0207675_100446088 | 3300026118 | Bacteria | 1282 |
| 229 | Ga0207683_10261257 | 3300026121 | Bacteria | 1581 |
| 230 | Ga0209371_1077771 | 3300027312 | Bacteria | 578 |
| 231 | Ga0209813_10060814 | 3300027866 | Bacteria | 1205 |
| 232 | Ga0209813_10147959 | 3300027866 | Bacteria | 839 |
| 233 | Ga0268266_10148689 | 3300028379 | Bacteria | 2109 |
| 234 | Ga0268266_11138166 | 3300028379 | Bacteria | 755 |
| 235 | Ga0268266_11376941 | 3300028379 | Bacteria | 681 |
| 236 | Ga0268265_10104189 | 3300028380 | Bacteria | 2299 |
| 237 | Ga0265319_1270635 | 3300028563 | Bacteria | 517 |
| 238 | Ga0307515_10000377 | 3300028794 | Bacteria | 109082 |
| 239 | Ga0265340_10467940 | 3300031247 | Bacteria | 555 |
| 240 | Ga0307513_10001888 | 3300031456 | Bacteria | 29770 |
| 241 | Ga0265342_10323547 | 3300031712 | Bacteria | 808 |
| 242 | Ga0307405_10011182 | 3300031731 | Bacteria | 4687 |
| 243 | Ga0307412_10077356 | 3300031911 | Bacteria | 2288 |
| 244 | Ga0373930_0009261 | 3300034816 | Bacteria | 1740 |
| 245 | Ga0373959_0011942 | 3300034820 | Bacteria | 1542 |
| 246 | Ga0373929_0009398 | 3300035085 | Bacteria | 1812 |
| 247 | Ga0373951_0006615 | 3300035091 | Bacteria | 2649 |
| 248 | Ga0373932_0017412 | 3300035112 | Bacteria | 1844 |
| 249 | Ga0373939_0202558 | 3300035114 | Bacteria | 751 |
| 250 | Ga0373960_0055492 | 3300035121 | Bacteria | 1188 |
| 251 | Ga0373943_0634149 | 3300035170 | Bacteria | 631 |
| 252 | Ga0373961_0224373 | 3300035241 | Bacteria | 671 |
| 253 | Ga0373962_0026300 | 3300035242 | Bacteria | 1568 |
| 254 | Ga0373931_0094116 | 3300035691 | Bacteria | 1674 |
| 255 | Ga0373931_0185170 | 3300035691 | Bacteria | 1235 |
| 256 | Ga0373935_0031290 | 3300035692 | Bacteria | 3302 |
| 257 | Ga0373933_0521303 | 3300035724 | Bacteria | 779 |
| 258 | Ga0373947_0146575 | 3300035725 | Bacteria | 1518 |
| 259 | Ga0373937_0876017 | 3300036401 | Bacteria | 847 |
| 260 | Ga0373925_0786609 | 3300037068 | Bacteria | 784 |
| 261 | Ga0395900_0000086 | 3300037418 | Bacteria | 171749 |
| 262 | Ga0395898_0000285 | 3300037466 | Bacteria | 122279 |
| 263 | Ga0395905_0000133 | 3300037471 | Bacteria | 123500 |
| 264 | Ga0395901_0000092 | 3300038443 | Bacteria | 121976 |
| 265 | Ga0436360_0686328 | 3300039438 | Bacteria | 502 |
| 266 | Ga0436361_0074042 | 3300039447 | Bacteria | 7292 |
| 267 | Ga0439436_0220862 | 3300041404 | Bacteria | 545 |
| 268 | Ga0439465_0088966 | 3300041413 | Bacteria | 1054 |
| 269 | Ga0439465_0253293 | 3300041413 | Bacteria | 651 |
| 270 | Ga0451787_378896 | 3300041441 | Bacteria | 2658 |
| 271 | Ga0451794_55478 | 3300041446 | Bacteria | 590 |
| 272 | Ga0451798_0974414 | 3300041458 | Bacteria | 2577 |
| 273 | Ga0451800_1470819 | 3300041459 | Bacteria | 887 |
| 274 | Ga0451833_0329526 | 3300041491 | Bacteria | 906 |
| 275 | Ga0451835_0314534 | 3300041492 | Bacteria | 3744 |
| 276 | Ga0451835_0469899 | 3300041492 | Bacteria | 652 |
| 277 | Ga0451837_0376117 | 3300041494 | Bacteria | 1275 |
| 278 | Ga0451838_05673 | 3300041495 | Bacteria | 542 |
| 279 | Ga0451839_0967922 | 3300041496 | Bacteria | 2018 |
| 280 | Ga0451839_0969815 | 3300041496 | Bacteria | 899 |
| 281 | Ga0451840_04176 | 3300041497 | Bacteria | 2034 |
| 282 | Ga0451841_1441855 | 3300041498 | Bacteria | 1915 |
| 283 | Ga0451842_0538 | 3300041499 | Bacteria | 511 |
| 284 | Ga0451845_0289069 | 3300041501 | Bacteria | 1093 |
| 285 | Ga0451845_0293700 | 3300041501 | Bacteria | 2307 |
| 286 | Ga0451845_0940612 | 3300041501 | Bacteria | 589 |
| 287 | Ga0451846_27217 | 3300041502 | Bacteria | 1742 |
| 288 | Ga0451847_0429826 | 3300041503 | Bacteria | 2741 |
| 289 | Ga0451847_0470876 | 3300041503 | Bacteria | 574 |
| 290 | Ga0451849_0832956 | 3300041505 | Bacteria | 575 |
| 291 | Ga0451850_30014 | 3300041506 | Bacteria | 1069 |
| 292 | Ga0451851_0866658 | 3300041507 | Bacteria | 1100 |
| 293 | Ga0451843_0940602 | 3300041509 | Bacteria | 884 |
| 294 | Ga0451854_30958 | 3300041510 | Bacteria | 612 |
| 295 | Ga0451855_1135233 | 3300041511 | Bacteria | 1003 |
| 296 | Ga0451853_1760736 | 3300041512 | Bacteria | 978 |
| 297 | Ga0451853_2301802 | 3300041512 | Bacteria | 525 |
| 298 | Ga0452268_50754 | 3300041907 | Bacteria | 519 |
| 299 | Ga0452271_63270 | 3300041916 | Bacteria | 964 |
| 300 | Ga0439431_0085186 | 3300041997 | Bacteria | 856 |
| 301 | Ga0439432_023866 | 3300042006 | Bacteria | 2012 |
| 302 | Ga0450920_029847 | 3300042122 | Bacteria | 1071 |
| 303 | Ga0450923_012073 | 3300042125 | Bacteria | 1567 |
| 304 | Ga0495617_057102 | 3300046452 | Bacteria | 1294 |
| 305 | Ga0495627_070163 | 3300046453 | Bacteria | 1025 |
| 306 | Ga0495638_0051177 | 3300046460 | Bacteria | 2577 |
| 307 | Ga0495650_0041533 | 3300046471 | Bacteria | 1966 |
| 308 | Ga0495605_0037125 | 3300046474 | Bacteria | 2453 |
| 309 | Ga0495664_0521232 | 3300046477 | Bacteria | 709 |
| 310 | Ga0495584_0150149 | 3300046491 | Bacteria | 1184 |
| 311 | Ga0495585_0210906 | 3300046492 | Bacteria | 984 |
| 312 | Ga0495596_0168171 | 3300046500 | Bacteria | 852 |
| 313 | Ga0495607_0131841 | 3300046501 | Bacteria | 1299 |
| 314 | Ga0495583_0050550 | 3300046506 | Bacteria | 1899 |
| 315 | Ga0495583_0052252 | 3300046506 | Bacteria | 1860 |
| 316 | Ga0495583_0054461 | 3300046506 | Bacteria | 1811 |
| 317 | Ga0495606_0062227 | 3300046507 | Bacteria | 2383 |
| 318 | Ga0495606_0092616 | 3300046507 | Bacteria | 1856 |
| 319 | Ga0495606_0337178 | 3300046507 | Bacteria | 805 |
| 320 | Ga0495610_0002597 | 3300046512 | Bacteria | 14977 |
| 321 | Ga0495610_0038438 | 3300046512 | Bacteria | 2429 |
| 322 | Ga0495620_0016883 | 3300046515 | Bacteria | 3651 |
| 323 | Ga0495620_0019875 | 3300046515 | Bacteria | 3290 |
| 324 | Ga0495620_0049658 | 3300046515 | Bacteria | 1794 |
| 325 | Ga0495631_0001859 | 3300046518 | Bacteria | 12472 |
| 326 | Ga0495631_0237934 | 3300046518 | Bacteria | 776 |
| 327 | Ga0495632_0051998 | 3300046519 | Bacteria | 2015 |
| 328 | Ga0495632_0205869 | 3300046519 | Bacteria | 894 |
| 329 | Ga0495643_0063995 | 3300046522 | Bacteria | 1944 |
| 330 | Ga0495643_0069570 | 3300046522 | Bacteria | 1849 |
| 331 | Ga0495643_0083782 | 3300046522 | Bacteria | 1655 |
| 332 | Ga0495648_0078976 | 3300046524 | Bacteria | 1880 |
| 333 | Ga0495648_0237044 | 3300046524 | Bacteria | 889 |
| 334 | Ga0495652_0429806 | 3300046529 | Bacteria | 929 |
| 335 | Ga0495654_0114381 | 3300046530 | Bacteria | 1228 |
| 336 | Ga0495609_0012502 | 3300046538 | Bacteria | 4027 |
| 337 | Ga0495597_0062015 | 3300046542 | Bacteria | 1627 |
| 338 | Ga0495645_0221100 | 3300046543 | Bacteria | 1274 |
| 339 | Ga0495633_0037169 | 3300046558 | Bacteria | 2330 |
| 340 | Ga0495611_0022113 | 3300046648 | Bacteria | 2750 |
| 341 | Ga0495625_0029614 | 3300046660 | Bacteria | 4091 |
| 342 | Ga0495625_0453772 | 3300046660 | Bacteria | 791 |
| 343 | Ga0495625_0528743 | 3300046660 | Bacteria | 717 |
| 344 | Ga0495625_0751316 | 3300046660 | Bacteria | 571 |
| 345 | Ga0495635_0163203 | 3300046663 | Bacteria | 1516 |
| 346 | Ga0495659_0133795 | 3300046664 | Bacteria | 985 |
| 347 | Ga0495670_0013208 | 3300046691 | Bacteria | 4062 |
| 348 | Ga0495670_0028226 | 3300046691 | Bacteria | 2782 |
| 349 | Ga0495671_0233430 | 3300046692 | Bacteria | 889 |
| 350 | Ga0495671_0411444 | 3300046692 | Bacteria | 647 |
| 351 | Ga0495660_0100952 | 3300046810 | Bacteria | 1485 |
| 352 | Ga0495604_0520353 | 3300047317 | Bacteria | 770 |
| 353 | Ga0495636_0083962 | 3300047318 | Bacteria | 1375 |
| 354 | Ga0495674_0207536 | 3300047319 | Bacteria | 1624 |
| 355 | Ga0495672_0063095 | 3300047320 | Bacteria | 2128 |
| 356 | Ga0495683_0120848 | 3300047323 | Bacteria | 1243 |
| 357 | Ga0495687_102180 | 3300047443 | Bacteria | 1073 |
| 358 | Ga0495675_0470589 | 3300047444 | Bacteria | 725 |
| 359 | Ga0495673_0104998 | 3300047469 | Bacteria | 1137 |
| 360 | Ga0495673_0225322 | 3300047469 | Bacteria | 692 |
| 361 | Ga0495681_0088867 | 3300047470 | Bacteria | 1367 |
| 362 | Ga0495686_0035155 | 3300047472 | Bacteria | 3223 |
| 363 | Ga0495686_0039215 | 3300047472 | Bacteria | 3026 |
| 364 | Ga0495615_0032759 | 3300048090 | Bacteria | 1255 |
| 365 | Ga0495626_0144810 | 3300048091 | Bacteria | 1005 |
| 366 | Ga0496101_0040152 | 3300048904 | Bacteria | 3332 |
| 367 | Ga0496101_0061585 | 3300048904 | Bacteria | 2726 |
| 368 | Ga0496101_0657113 | 3300048904 | Bacteria | 828 |
| 369 | Ga0496102_0161327 | 3300048905 | Bacteria | 2109 |
| 370 | Ga0496103_0146964 | 3300048906 | Bacteria | 1509 |
| 371 | Ga0496104_0017656 | 3300048907 | Bacteria | 6503 |
| 372 | Ga0496104_0035286 | 3300048907 | Bacteria | 4670 |
| 373 | Ga0496105_0002552 | 3300048908 | Bacteria | 13213 |
| 374 | Ga0496105_0388388 | 3300048908 | Bacteria | 1110 |
| 375 | Ga0496106_0059539 | 3300048909 | Bacteria | 2893 |
| 376 | Ga0496106_0236866 | 3300048909 | Bacteria | 1458 |
| 377 | Ga0496106_0741126 | 3300048909 | Bacteria | 781 |
| 378 | Ga0496107_0099059 | 3300048910 | Bacteria | 2135 |
| 379 | Ga0496108_0154143 | 3300048911 | Bacteria | 1983 |
| 380 | Ga0496108_0478376 | 3300048911 | Bacteria | 1088 |
| 381 | Ga0496108_1403551 | 3300048911 | Bacteria | 584 |
| 382 | Ga0496109_0020836 | 3300048912 | Bacteria | 5793 |
| 383 | Ga0496109_0046632 | 3300048912 | Bacteria | 3937 |
| 384 | Ga0496109_0051984 | 3300048912 | Bacteria | 3733 |
| 385 | Ga0496110_0082721 | 3300048913 | Bacteria | 2863 |
| 386 | Ga0496111_0213519 | 3300048914 | Bacteria | 1433 |
| 387 | Ga0496112_0068188 | 3300048915 | Bacteria | 3512 |
| 388 | Ga0496112_0132345 | 3300048915 | Bacteria | 2465 |
| 389 | Ga0496113_1207262 | 3300048916 | Bacteria | 590 |
| 390 | Ga0496114_0737440 | 3300048917 | Bacteria | 862 |
| 391 | Ga0496114_1009851 | 3300048917 | Bacteria | 715 |
| 392 | Ga0496115_0339802 | 3300048918 | Bacteria | 1225 |
| 393 | Ga0496115_0523947 | 3300048918 | Bacteria | 950 |
| 394 | Ga0496116_0004280 | 3300048919 | Bacteria | 13687 |
| 395 | Ga0496116_0046812 | 3300048919 | Bacteria | 2916 |
| 396 | Ga0496116_0249122 | 3300048919 | Bacteria | 885 |
| 397 | Ga0496117_0236272 | 3300048920 | Bacteria | 1006 |
| 398 | Ga0496118_0004259 | 3300048921 | Bacteria | 17116 |
| 399 | Ga0496118_0030757 | 3300048921 | Bacteria | 4469 |
| 400 | Ga0496118_0074368 | 3300048921 | Bacteria | 2429 |
| 401 | Ga0496118_0234925 | 3300048921 | Bacteria | 1054 |
| 402 | Ga0496119_0085907 | 3300048922 | Bacteria | 1800 |
| 403 | Ga0496119_0133296 | 3300048922 | Bacteria | 1351 |
| 404 | Ga0496119_0152870 | 3300048922 | Bacteria | 1235 |
| 405 | Ga0496120_0164987 | 3300048923 | Bacteria | 1101 |
| 406 | Ga0496121_0020154 | 3300048924 | Bacteria | 6620 |
| 407 | Ga0496121_0150988 | 3300048924 | Bacteria | 1709 |
| 408 | Ga0496122_0054408 | 3300048925 | Bacteria | 3007 |
| 409 | Ga0496122_0096365 | 3300048925 | Bacteria | 1995 |
| 410 | Ga0496123_0053721 | 3300048926 | Bacteria | 2660 |
| 411 | Ga0496124_0059610 | 3300048927 | Bacteria | 3205 |
| 412 | Ga0496124_0432963 | 3300048927 | Bacteria | 902 |
| 413 | Ga0496124_0852308 | 3300048927 | Bacteria | 558 |
| 414 | Ga0496125_0005653 | 3300048928 | Bacteria | 13797 |
| 415 | Ga0496125_0108719 | 3300048928 | Bacteria | 2016 |
| 416 | Ga0496126_0009461 | 3300048929 | Bacteria | 10344 |
| 417 | Ga0496126_0302079 | 3300048929 | Bacteria | 1320 |
| 418 | Ga0496126_0632440 | 3300048929 | Bacteria | 839 |
| 419 | Ga0495678_018645 | 3300049459 | Bacteria | 3115 |
| 420 | Ga0495678_105214 | 3300049459 | Bacteria | 972 |
| 421 | Ga0495678_110088 | 3300049459 | Bacteria | 940 |
| 422 | Ga0501031_0113989 | 3300049568 | Bacteria | 1765 |
| 423 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 424 | Ga0501032_0025474 | 3300049569 | Bacteria | 4077 |
| 425 | Ga0501032_0100662 | 3300049569 | Bacteria | 1915 |
| 426 | Ga0501032_0111392 | 3300049569 | Bacteria | 1811 |
| 427 | Ga0501032_0595506 | 3300049569 | Bacteria | 703 |
| 428 | Ga0501033_0000077 | 3300049570 | Bacteria | 92696 |
| 429 | Ga0501033_0000518 | 3300049570 | Bacteria | 36156 |
| 430 | Ga0501033_0024123 | 3300049570 | Bacteria | 4590 |
| 431 | Ga0501034_0000023 | 3300049571 | Bacteria | 263892 |
| 432 | Ga0501034_0093609 | 3300049571 | Bacteria | 3001 |
| 433 | Ga0501034_0132612 | 3300049571 | Bacteria | 2474 |
| 434 | Ga0501034_0632150 | 3300049571 | Bacteria | 973 |
| 435 | Ga0501034_0952595 | 3300049571 | Bacteria | 744 |
| 436 | Ga0501034_1012336 | 3300049571 | Bacteria | 714 |
| 437 | Ga0501036_0002867 | 3300049572 | Bacteria | 13677 |
| 438 | Ga0501036_0029398 | 3300049572 | Bacteria | 4642 |
| 439 | Ga0501036_0131873 | 3300049572 | Bacteria | 2109 |
| 440 | Ga0501036_0183137 | 3300049572 | Bacteria | 1763 |
| 441 | Ga0501036_0630825 | 3300049572 | Bacteria | 888 |
| 442 | Ga0501037_0002051 | 3300049573 | Bacteria | 14606 |
| 443 | Ga0501037_0014865 | 3300049573 | Bacteria | 5726 |
| 444 | Ga0501037_0097077 | 3300049573 | Bacteria | 2129 |
| 445 | Ga0501037_0373107 | 3300049573 | Bacteria | 981 |
| 446 | Ga0501038_0000043 | 3300049574 | Bacteria | 113010 |
| 447 | Ga0501038_0018994 | 3300049574 | Bacteria | 6202 |
| 448 | Ga0501038_0020653 | 3300049574 | Bacteria | 5919 |
| 449 | Ga0501039_0000022 | 3300049575 | Bacteria | 160858 |
| 450 | Ga0501039_0020733 | 3300049575 | Bacteria | 5036 |
| 451 | Ga0501039_0144559 | 3300049575 | Bacteria | 1869 |
| 452 | Ga0501039_0454066 | 3300049575 | Bacteria | 1006 |
| 453 | Ga0501041_0248110 | 3300049577 | Bacteria | 1119 |
| 454 | Ga0501042_0021056 | 3300049578 | Bacteria | 4541 |
| 455 | Ga0501042_0311365 | 3300049578 | Bacteria | 1137 |
| 456 | Ga0501043_0000019 | 3300049579 | Bacteria | 155347 |
| 457 | Ga0501043_0037611 | 3300049579 | Bacteria | 3806 |
| 458 | Ga0501043_0194651 | 3300049579 | Bacteria | 1575 |
| 459 | Ga0501043_0209713 | 3300049579 | Bacteria | 1510 |
| 460 | Ga0501043_0684467 | 3300049579 | Bacteria | 750 |
| 461 | Ga0501046_0040118 | 3300049580 | Bacteria | 3743 |
| 462 | Ga0501046_0238214 | 3300049580 | Bacteria | 1343 |
| 463 | Ga0501046_0376233 | 3300049580 | Bacteria | 1028 |
| 464 | Ga0501047_0019478 | 3300049581 | Bacteria | 6508 |
| 465 | Ga0501047_0078900 | 3300049581 | Bacteria | 3166 |
| 466 | Ga0501047_0147286 | 3300049581 | Bacteria | 2231 |
| 467 | Ga0501047_0180021 | 3300049581 | Bacteria | 1980 |
| 468 | Ga0501047_0216666 | 3300049581 | Bacteria | 1771 |
| 469 | Ga0501047_0433300 | 3300049581 | Bacteria | 1145 |
| 470 | Ga0501047_0894714 | 3300049581 | Bacteria | 701 |
| 471 | Ga0501048_0716458 | 3300049582 | Bacteria | 718 |
| 472 | Ga0501067_0012240 | 3300049583 | Bacteria | 4754 |
| 473 | Ga0501067_0188315 | 3300049583 | Bacteria | 1149 |
| 474 | Ga0501068_0130403 | 3300049584 | Bacteria | 1572 |
| 475 | Ga0501068_0136506 | 3300049584 | Bacteria | 1536 |
| 476 | Ga0501068_0219532 | 3300049584 | Bacteria | 1208 |
| 477 | Ga0501069_0004912 | 3300049585 | Bacteria | 6928 |
| 478 | Ga0501069_0185149 | 3300049585 | Bacteria | 1204 |
| 479 | Ga0501070_0009601 | 3300049586 | Bacteria | 8172 |
| 480 | Ga0501070_0026104 | 3300049586 | Bacteria | 4901 |
| 481 | Ga0501070_0626926 | 3300049586 | Bacteria | 855 |
| 482 | Ga0501070_0975296 | 3300049586 | Bacteria | 658 |
| 483 | Ga0501071_0032969 | 3300049587 | Bacteria | 3681 |
| 484 | Ga0501072_0184710 | 3300049588 | Bacteria | 1663 |
| 485 | Ga0501072_0202567 | 3300049588 | Bacteria | 1582 |
| 486 | Ga0501073_0033221 | 3300049589 | Bacteria | 3674 |
| 487 | Ga0501073_0107021 | 3300049589 | Bacteria | 1940 |
| 488 | Ga0501074_0015342 | 3300049590 | Bacteria | 5568 |
| 489 | Ga0501074_0087925 | 3300049590 | Bacteria | 2225 |
| 490 | Ga0501076_1463652 | 3300049592 | Bacteria | 561 |
| 491 | Ga0501227_140501 | 3300049665 | Bacteria | 662 |
| 492 | Ga0501080_0015238 | 3300049742 | Bacteria | 7085 |
| 493 | Ga0501080_0034931 | 3300049742 | Bacteria | 4694 |
| 494 | Ga0501080_0176011 | 3300049742 | Bacteria | 1971 |
| 495 | Ga0501083_0011274 | 3300049744 | Bacteria | 6271 |
| 496 | Ga0501083_0016060 | 3300049744 | Bacteria | 5243 |
| 497 | Ga0501083_0040593 | 3300049744 | Bacteria | 3158 |
| 498 | Ga0501083_0058721 | 3300049744 | Bacteria | 2574 |
| 499 | Ga0501083_0134395 | 3300049744 | Bacteria | 1621 |
| 500 | Ga0501035_0000316 | 3300049822 | Bacteria | 55833 |
| 501 | Ga0501035_0000997 | 3300049822 | Bacteria | 29896 |
| 502 | Ga0501035_0060569 | 3300049822 | Bacteria | 3369 |
| 503 | Ga0501035_0201336 | 3300049822 | Bacteria | 1707 |
| 504 | Ga0501035_0252485 | 3300049822 | Bacteria | 1497 |
| 505 | Ga0501035_0313930 | 3300049822 | Bacteria | 1318 |
| 506 | Ga0501035_1264024 | 3300049822 | Bacteria | 570 |
| 507 | Ga0501044_0041587 | 3300049823 | Bacteria | 4785 |
| 508 | Ga0501044_0044139 | 3300049823 | Bacteria | 4629 |
| 509 | Ga0501044_0051525 | 3300049823 | Bacteria | 4243 |
| 510 | Ga0501044_0066428 | 3300049823 | Bacteria | 3677 |
| 511 | Ga0501044_0096226 | 3300049823 | Bacteria | 2982 |
| 512 | Ga0501044_0851816 | 3300049823 | Bacteria | 788 |
| 513 | Ga0501044_0954393 | 3300049823 | Bacteria | 730 |
| 514 | Ga0501045_0013385 | 3300049824 | Bacteria | 5793 |
| 515 | Ga0501045_0386405 | 3300049824 | Bacteria | 1042 |
| 516 | nmdc:mga03683_49273_c1 | 3300050489 | Bacteria | 1753 |
| 517 | nmdc:mga03683_80981_c1 | 3300050489 | Bacteria | 1402 |
| 518 | nmdc:mga03n38_130743_c1 | 3300050490 | Bacteria | 1244 |
| 519 | nmdc:mga03n38_131231_c1 | 3300050490 | Bacteria | 1242 |
| 520 | nmdc:mga00v17_147288_c1 | 3300050491 | Bacteria | 1511 |
| 521 | nmdc:mga00v17_302357_c1 | 3300050491 | Bacteria | 1039 |
| 522 | nmdc:mga0yw44_105992_c1 | 3300050492 | Bacteria | 1796 |
| 523 | nmdc:mga0yw44_285429_c1 | 3300050492 | Bacteria | 1104 |
| 524 | nmdc:mga0yw44_445410_c1 | 3300050492 | Bacteria | 877 |
| 525 | nmdc:mga0yw44_91916_c1 | 3300050492 | Bacteria | 1920 |
| 526 | nmdc:mga0k408_135325_c1 | 3300050493 | Bacteria | 1464 |
| 527 | nmdc:mga06z11_293298_c1 | 3300050494 | Bacteria | 966 |
| 528 | nmdc:mga06z11_298204_c1 | 3300050494 | Bacteria | 958 |
| 529 | nmdc:mga06z11_471459_c1 | 3300050494 | Bacteria | 760 |
| 530 | nmdc:mga06z11_529759_c1 | 3300050494 | Bacteria | 715 |
| 531 | nmdc:mga04h51_171203_c1 | 3300050495 | Bacteria | 841 |
| 532 | nmdc:mga04h51_50484_c1 | 3300050495 | Bacteria | 1394 |
| 533 | nmdc:mga04h51_516155_c1 | 3300050495 | Bacteria | 512 |
| 534 | nmdc:mga04h51_56565_c1 | 3300050495 | Bacteria | 1332 |
| 535 | nmdc:mga07m45_101697_c1 | 3300050496 | Bacteria | 1650 |
| 536 | nmdc:mga07m45_102547_c1 | 3300050496 | Bacteria | 1644 |
| 537 | nmdc:mga07m45_14866_c1 | 3300050496 | Bacteria | 4155 |
| 538 | nmdc:mga07m45_95795_c1 | 3300050496 | Bacteria | 1703 |
| 539 | nmdc:mga09592_51612_c1 | 3300050508 | Bacteria | 3470 |
| 540 | nmdc:mga0qj67_234958_c1 | 3300050509 | Bacteria | 1487 |
| 541 | nmdc:mga0qj67_610590_c1 | 3300050509 | Bacteria | 872 |
| 542 | nmdc:mga06r32_18149_c1 | 3300050510 | Bacteria | 6437 |
| 543 | nmdc:mga06r32_906483_c1 | 3300050510 | Bacteria | 838 |
| 544 | nmdc:mga0sz30_124127_c1 | 3300050516 | Bacteria | 1135 |
| 545 | nmdc:mga0sz30_28305_c1 | 3300050516 | Bacteria | 1607 |
| 546 | nmdc:mga0sz30_32740_c1 | 3300050516 | Bacteria | 2157 |
| 547 | nmdc:mga0sz30_63064_c1 | 3300050516 | Bacteria | 1586 |
| 548 | Ga0495601_0088815 | 3300053077 | Bacteria | 1987 |
| 549 | Ga0495595_0059070 | 3300053084 | Bacteria | 1792 |
| 550 | Ga0495619_0056591 | 3300053085 | Bacteria | 2600 |
| 551 | Ga0500578_0143727 | 3300053086 | Bacteria | 1490 |
| 552 | Ga0500650_0158611 | 3300053098 | Bacteria | 1044 |
| 553 | Ga0500562_023027 | 3300053108 | Bacteria | 1625 |
| 554 | Ga0500569_007712 | 3300053109 | Bacteria | 2428 |
| 555 | Ga0500594_0009824 | 3300053118 | Bacteria | 2210 |
| 556 | Ga0500608_101911 | 3300053122 | Bacteria | 1329 |
| 557 | Ga0500642_0423300 | 3300053130 | Bacteria | 577 |
| 558 | Ga0500658_0008278 | 3300053134 | Bacteria | 3842 |
| 559 | Ga0500568_0001609 | 3300053139 | Bacteria | 14286 |
| 560 | Ga0500568_0190088 | 3300053139 | Bacteria | 754 |
| 561 | Ga0500577_0236841 | 3300053142 | Bacteria | 792 |
| 562 | Ga0500588_0143308 | 3300053146 | Bacteria | 860 |
| 563 | Ga0500616_0047391 | 3300053153 | Bacteria | 2282 |
| 564 | Ga0500616_0051370 | 3300053153 | Bacteria | 2172 |
| 565 | Ga0500616_0082737 | 3300053153 | Bacteria | 1609 |
| 566 | Ga0500622_0001966 | 3300053156 | Bacteria | 15471 |
| 567 | Ga0500611_043715 | 3300053727 | Bacteria | 996 |
| 568 | Ga0501084_0540501 | 3300054114 | Bacteria | 985 |
| 569 | Ga0501084_1039140 | 3300054114 | Bacteria | 688 |
| 570 | Ga0587070_135389 | 3300059491 | Bacteria | 604 |
| 571 | Ga0587073_0088647 | 3300059492 | Bacteria | 782 |
| 572 | Ga0587080_019117 | 3300059503 | Bacteria | 1106 |
| 573 | Ga0587083_0018824 | 3300059505 | Bacteria | 1254 |
| 574 | Ga0587088_051021 | 3300059508 | Bacteria | 810 |
| 575 | Ga0587090_041206 | 3300059510 | Bacteria | 813 |
| 576 | Ga0587092_104135 | 3300059512 | Bacteria | 588 |
| 577 | Ga0587106_165529 | 3300059605 | Bacteria | 501 |
| 578 | Ga0587068_022656 | 3300059641 | Bacteria | 1042 |
| 579 | Ga0587071_022486 | 3300060344 | Bacteria | 1164 |
| 580 | Ga0587111_0119265 | 3300060346 | Bacteria | 678 |
| 581 | Ga0587111_0146678 | 3300060346 | Bacteria | 630 |
| 582 | Ga0501082_0025124 | 3300060353 | Bacteria | 5133 |
| 583 | Ga0501082_0037839 | 3300060353 | Bacteria | 4161 |
| 584 | Ga0501082_0055900 | 3300060353 | Bacteria | 3399 |
| 585 | Ga0501082_0315421 | 3300060353 | Bacteria | 1362 |
| 586 | Ga0501082_0884503 | 3300060353 | Bacteria | 781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2510917030 | 2511198235 | 126 |
| 2 | iso_pu_bacteria | 2582581298 | 2585223862 | 126 |
| 3 | iso_pu_bacteria | 2585427529 | 2585549085 | 126 |
| 4 | 3300048917 | Ga0496114_1009851 | Ga0496114_1009851_225_629 | 127 |
| 5 | 3300041404 | Ga0439436_0220862 | Ga0439436_0220862_94_492 | 128 |
| 6 | 3300050510 | nmdc:mga06r32_906483_c1 | nmdc:mga06r32_906483_c1_83_487 | 128 |
| 7 | 3300006038 | Ga0075365_10336995 | Ga0075365_103369952 | 129 |
| 8 | 3300006042 | Ga0075368_10045362 | Ga0075368_100453623 | 129 |
| 9 | 3300006048 | Ga0075363_100097577 | Ga0075363_1000975773 | 129 |
| 10 | 3300006051 | Ga0075364_10180403 | Ga0075364_101804033 | 129 |
| 11 | 3300006178 | Ga0075367_10020031 | Ga0075367_100200313 | 129 |
| 12 | 3300006178 | Ga0075367_10074474 | Ga0075367_100744743 | 129 |
| 13 | 3300006186 | Ga0075369_10109392 | Ga0075369_101093922 | 129 |
| 14 | 3300006195 | Ga0075366_10019025 | Ga0075366_100190254 | 129 |
| 15 | 3300014326 | Ga0157380_10101899 | Ga0157380_101018993 | 129 |
| 16 | 3300025906 | Ga0207699_10576060 | Ga0207699_105760601 | 129 |
| 17 | 3300025915 | Ga0207693_10055090 | Ga0207693_100550901 | 129 |
| 18 | 3300025916 | Ga0207663_10184124 | Ga0207663_101841242 | 129 |
| 19 | 3300027866 | Ga0209813_10060814 | Ga0209813_100608142 | 129 |
| 20 | 3300039447 | Ga0436361_0074042 | Ga0436361_0074042_3187_3597 | 129 |
| 21 | 3300041501 | Ga0451845_0940612 | Ga0451845_0940612_155_571 | 129 |
| 22 | 3300046491 | Ga0495584_0150149 | Ga0495584_0150149_315_722 | 129 |
| 23 | 3300046664 | Ga0495659_0133795 | Ga0495659_0133795_387_794 | 129 |
| 24 | 3300048904 | Ga0496101_0061585 | Ga0496101_0061585_947_1363 | 129 |
| 25 | 3300048907 | Ga0496104_0035286 | Ga0496104_0035286_2271_2687 | 129 |
| 26 | 3300048908 | Ga0496105_0388388 | Ga0496105_0388388_423_839 | 129 |
| 27 | 3300048909 | Ga0496106_0741126 | Ga0496106_0741126_231_647 | 129 |
| 28 | 3300048911 | Ga0496108_0478376 | Ga0496108_0478376_64_480 | 129 |
| 29 | 3300048912 | Ga0496109_0051984 | Ga0496109_0051984_2108_2524 | 129 |
| 30 | 3300048915 | Ga0496112_0132345 | Ga0496112_0132345_1243_1659 | 129 |
| 31 | 3300048917 | Ga0496114_0737440 | Ga0496114_0737440_236_652 | 129 |
| 32 | 3300048918 | Ga0496115_0523947 | Ga0496115_0523947_149_565 | 129 |
| 33 | 3300049571 | Ga0501034_0132612 | Ga0501034_0132612_125_535 | 129 |
| 34 | 3300049577 | Ga0501041_0248110 | Ga0501041_0248110_17_418 | 129 |
| 35 | 3300050490 | nmdc:mga03n38_130743_c1 | nmdc:mga03n38_130743_c1_711_1118 | 129 |
| 36 | 3300050492 | nmdc:mga0yw44_285429_c1 | nmdc:mga0yw44_285429_c1_375_782 | 129 |
| 37 | 3300050493 | nmdc:mga0k408_135325_c1 | nmdc:mga0k408_135325_c1_645_1052 | 129 |
| 38 | 3300050494 | nmdc:mga06z11_298204_c1 | nmdc:mga06z11_298204_c1_427_834 | 129 |
| 39 | 3300050495 | nmdc:mga04h51_50484_c1 | nmdc:mga04h51_50484_c1_384_791 | 129 |
| 40 | 3300050496 | nmdc:mga07m45_14866_c1 | nmdc:mga07m45_14866_c1_3474_3881 | 129 |
| 41 | 3300050509 | nmdc:mga0qj67_234958_c1 | nmdc:mga0qj67_234958_c1_576_980 | 129 |
| 42 | 3300002739 | JGI25158J39367_1000074 | JGI25158J39367_10000749 | 130 |
| 43 | 3300002773 | JGI25152J39213_1008129 | JGI25152J39213_10081295 | 130 |
| 44 | 3300002773 | JGI25152J39213_1047966 | JGI25152J39213_10479661 | 130 |
| 45 | 3300002773 | JGI25152J39213_1048043 | JGI25152J39213_10480431 | 130 |
| 46 | 3300002774 | JGI25150J39212_1008276 | JGI25150J39212_10082762 | 130 |
| 47 | 3300002987 | JGI25159J45721_1000262 | JGI25159J45721_100026220 | 130 |
| 48 | 3300003187 | JGI25151J46595_10005265 | JGI25151J46595_100052654 | 130 |
| 49 | 3300003215 | JGI25153J46596_10019108 | JGI25153J46596_100191085 | 130 |
| 50 | 3300003215 | JGI25153J46596_10127183 | JGI25153J46596_101271831 | 130 |
| 51 | 3300003215 | JGI25153J46596_10127263 | JGI25153J46596_101272631 | 130 |
| 52 | 3300003354 | JGI25160J50197_1023007 | JGI25160J50197_10230073 | 130 |
| 53 | 3300003374 | JGI25161J50226_1000137 | JGI25161J50226_100013744 | 130 |
| 54 | 3300003771 | Ga0055526_1002794 | Ga0055526_100279410 | 130 |
| 55 | 3300003775 | Ga0055524_1005991 | Ga0055524_10059912 | 130 |
| 56 | 3300003781 | Ga0055536_1008778 | Ga0055536_10087784 | 130 |
| 57 | 3300003790 | Ga0055528_1027613 | Ga0055528_10276133 | 130 |
| 58 | 3300003790 | Ga0055528_1036012 | Ga0055528_10360121 | 130 |
| 59 | 3300003792 | Ga0055540_1015240 | Ga0055540_10152403 | 130 |
| 60 | 3300003792 | Ga0055540_1018131 | Ga0055540_10181312 | 130 |
| 61 | 3300003794 | Ga0055531_10014492 | Ga0055531_100144923 | 130 |
| 62 | 3300004625 | Ga0055543_1000321 | Ga0055543_10003217 | 130 |
| 63 | 3300005262 | Ga0065165_1028090 | Ga0065165_10280901 | 130 |
| 64 | 3300005262 | Ga0065165_1141942 | Ga0065165_11419421 | 130 |
| 65 | 3300005331 | Ga0070670_100486886 | Ga0070670_1004868861 | 130 |
| 66 | 3300005337 | Ga0070682_100211738 | Ga0070682_1002117383 | 130 |
| 67 | 3300005347 | Ga0070668_100624455 | Ga0070668_1006244551 | 130 |
| 68 | 3300005548 | Ga0070665_100013723 | Ga0070665_1000137235 | 130 |
| 69 | 3300005548 | Ga0070665_100118172 | Ga0070665_1001181722 | 130 |
| 70 | 3300006042 | Ga0075368_10213366 | Ga0075368_102133661 | 130 |
| 71 | 3300006048 | Ga0075363_100458228 | Ga0075363_1004582282 | 130 |
| 72 | 3300006178 | Ga0075367_10021315 | Ga0075367_100213153 | 130 |
| 73 | 3300006186 | Ga0075369_10027517 | Ga0075369_100275173 | 130 |
| 74 | 3300006195 | Ga0075366_10072620 | Ga0075366_100726204 | 130 |
| 75 | 3300006353 | Ga0075370_10092194 | Ga0075370_100921944 | 130 |
| 76 | 3300006946 | Ga0079104_1008512 | Ga0079104_10085122 | 130 |
| 77 | 3300006948 | Ga0099826_10030104 | Ga0099826_100301045 | 130 |
| 78 | 3300009036 | Ga0105244_10164819 | Ga0105244_101648193 | 130 |
| 79 | 3300009098 | Ga0105245_11663788 | Ga0105245_116637882 | 130 |
| 80 | 3300009148 | Ga0105243_10018422 | Ga0105243_100184223 | 130 |
| 81 | 3300012497 | Ga0157319_1003163 | Ga0157319_10031631 | 130 |
| 82 | 3300012513 | Ga0157326_1022789 | Ga0157326_10227891 | 130 |
| 83 | 3300013100 | Ga0157373_10007612 | Ga0157373_100076123 | 130 |
| 84 | 3300013104 | Ga0157370_10302579 | Ga0157370_103025793 | 130 |
| 85 | 3300013105 | Ga0157369_12672092 | Ga0157369_126720922 | 130 |
| 86 | 3300013308 | Ga0157375_11096275 | Ga0157375_110962752 | 130 |
| 87 | 3300014968 | Ga0157379_11810046 | Ga0157379_118100461 | 130 |
| 88 | 3300025208 | Ga0209436_100299 | Ga0209436_10029919 | 130 |
| 89 | 3300025245 | Ga0207425_1001864 | Ga0207425_10018647 | 130 |
| 90 | 3300025245 | Ga0207425_1013468 | Ga0207425_10134683 | 130 |
| 91 | 3300025258 | Ga0209129_1002128 | Ga0209129_10021287 | 130 |
| 92 | 3300025258 | Ga0209129_1007959 | Ga0209129_10079591 | 130 |
| 93 | 3300025273 | Ga0209673_1016194 | Ga0209673_10161943 | 130 |
| 94 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009327 | 130 |
| 95 | 3300025294 | Ga0209025_1017322 | Ga0209025_10173223 | 130 |
| 96 | 3300025294 | Ga0209025_1083880 | Ga0209025_10838802 | 130 |
| 97 | 3300025295 | Ga0209564_1006046 | Ga0209564_10060465 | 130 |
| 98 | 3300025297 | Ga0209758_1005244 | Ga0209758_10052447 | 130 |
| 99 | 3300025297 | Ga0209758_1012770 | Ga0209758_10127701 | 130 |
| 100 | 3300025299 | Ga0209256_1002153 | Ga0209256_100215312 | 130 |
| 101 | 3300025302 | Ga0207426_1000041 | Ga0207426_1000041265 | 130 |
| 102 | 3300025303 | Ga0209051_1013102 | Ga0209051_10131025 | 130 |
| 103 | 3300025972 | Ga0207668_10569945 | Ga0207668_105699452 | 130 |
| 104 | 3300028379 | Ga0268266_10148689 | Ga0268266_101486893 | 130 |
| 105 | 3300028563 | Ga0265319_1270635 | Ga0265319_12706351 | 130 |
| 106 | 3300031247 | Ga0265340_10467940 | Ga0265340_104679401 | 130 |
| 107 | 3300041413 | Ga0439465_0253293 | Ga0439465_0253293_186_578 | 130 |
| 108 | 3300042125 | Ga0450923_012073 | Ga0450923_012073_49_462 | 130 |
| 109 | 3300046506 | Ga0495583_0054461 | Ga0495583_0054461_508_900 | 130 |
| 110 | 3300046507 | Ga0495606_0337178 | Ga0495606_0337178_263_655 | 130 |
| 111 | 3300046512 | Ga0495610_0038438 | Ga0495610_0038438_1241_1633 | 130 |
| 112 | 3300046522 | Ga0495643_0083782 | Ga0495643_0083782_507_899 | 130 |
| 113 | 3300046692 | Ga0495671_0233430 | Ga0495671_0233430_61_453 | 130 |
| 114 | 3300048905 | Ga0496102_0161327 | Ga0496102_0161327_484_876 | 130 |
| 115 | 3300048909 | Ga0496106_0236866 | Ga0496106_0236866_88_525 | 130 |
| 116 | 3300048919 | Ga0496116_0046812 | Ga0496116_0046812_853_1245 | 130 |
| 117 | 3300048921 | Ga0496118_0074368 | Ga0496118_0074368_1474_1923 | 130 |
| 118 | 3300048921 | Ga0496118_0234925 | Ga0496118_0234925_314_706 | 130 |
| 119 | 3300048922 | Ga0496119_0152870 | Ga0496119_0152870_677_1114 | 130 |
| 120 | 3300048924 | Ga0496121_0020154 | Ga0496121_0020154_4199_4636 | 130 |
| 121 | 3300048925 | Ga0496122_0096365 | Ga0496122_0096365_684_1121 | 130 |
| 122 | 3300048926 | Ga0496123_0053721 | Ga0496123_0053721_1984_2376 | 130 |
| 123 | 3300048927 | Ga0496124_0059610 | Ga0496124_0059610_1246_1638 | 130 |
| 124 | 3300048927 | Ga0496124_0852308 | Ga0496124_0852308_115_507 | 130 |
| 125 | 3300048928 | Ga0496125_0108719 | Ga0496125_0108719_1160_1552 | 130 |
| 126 | 3300048929 | Ga0496126_0009461 | Ga0496126_0009461_8319_8711 | 130 |
| 127 | 3300048929 | Ga0496126_0632440 | Ga0496126_0632440_264_701 | 130 |
| 128 | 3300049568 | Ga0501031_0113989 | Ga0501031_0113989_1318_1728 | 130 |
| 129 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_26514_26924 | 130 |
| 130 | 3300049569 | Ga0501032_0111392 | Ga0501032_0111392_1337_1729 | 130 |
| 131 | 3300049569 | Ga0501032_0595506 | Ga0501032_0595506_152_550 | 130 |
| 132 | 3300049570 | Ga0501033_0000077 | Ga0501033_0000077_53090_53500 | 130 |
| 133 | 3300049570 | Ga0501033_0000518 | Ga0501033_0000518_7771_8232 | 130 |
| 134 | 3300049571 | Ga0501034_0000023 | Ga0501034_0000023_120166_120576 | 130 |
| 135 | 3300049571 | Ga0501034_0093609 | Ga0501034_0093609_202_600 | 130 |
| 136 | 3300049571 | Ga0501034_0632150 | Ga0501034_0632150_377_775 | 130 |
| 137 | 3300049571 | Ga0501034_1012336 | Ga0501034_1012336_92_490 | 130 |
| 138 | 3300049572 | Ga0501036_0002867 | Ga0501036_0002867_3755_4165 | 130 |
| 139 | 3300049572 | Ga0501036_0131873 | Ga0501036_0131873_1496_1894 | 130 |
| 140 | 3300049573 | Ga0501037_0002051 | Ga0501037_0002051_10929_11339 | 130 |
| 141 | 3300049573 | Ga0501037_0097077 | Ga0501037_0097077_1334_1732 | 130 |
| 142 | 3300049573 | Ga0501037_0373107 | Ga0501037_0373107_503_901 | 130 |
| 143 | 3300049574 | Ga0501038_0000043 | Ga0501038_0000043_22267_22677 | 130 |
| 144 | 3300049574 | Ga0501038_0018994 | Ga0501038_0018994_5637_6035 | 130 |
| 145 | 3300049575 | Ga0501039_0000022 | Ga0501039_0000022_151637_152047 | 130 |
| 146 | 3300049575 | Ga0501039_0144559 | Ga0501039_0144559_73_471 | 130 |
| 147 | 3300049575 | Ga0501039_0454066 | Ga0501039_0454066_191_589 | 130 |
| 148 | 3300049578 | Ga0501042_0311365 | Ga0501042_0311365_682_1092 | 130 |
| 149 | 3300049579 | Ga0501043_0000019 | Ga0501043_0000019_21794_22204 | 130 |
| 150 | 3300049579 | Ga0501043_0209713 | Ga0501043_0209713_404_802 | 130 |
| 151 | 3300049580 | Ga0501046_0040118 | Ga0501046_0040118_2758_3168 | 130 |
| 152 | 3300049580 | Ga0501046_0238214 | Ga0501046_0238214_421_813 | 130 |
| 153 | 3300049581 | Ga0501047_0147286 | Ga0501047_0147286_1248_1646 | 130 |
| 154 | 3300049581 | Ga0501047_0180021 | Ga0501047_0180021_1421_1819 | 130 |
| 155 | 3300049581 | Ga0501047_0433300 | Ga0501047_0433300_496_906 | 130 |
| 156 | 3300049583 | Ga0501067_0188315 | Ga0501067_0188315_170_568 | 130 |
| 157 | 3300049584 | Ga0501068_0136506 | Ga0501068_0136506_1025_1423 | 130 |
| 158 | 3300049584 | Ga0501068_0219532 | Ga0501068_0219532_790_1182 | 130 |
| 159 | 3300049585 | Ga0501069_0185149 | Ga0501069_0185149_161_559 | 130 |
| 160 | 3300049586 | Ga0501070_0009601 | Ga0501070_0009601_7630_8028 | 130 |
| 161 | 3300049586 | Ga0501070_0626926 | Ga0501070_0626926_300_698 | 130 |
| 162 | 3300049588 | Ga0501072_0202567 | Ga0501072_0202567_183_581 | 130 |
| 163 | 3300049589 | Ga0501073_0107021 | Ga0501073_0107021_1379_1777 | 130 |
| 164 | 3300049590 | Ga0501074_0087925 | Ga0501074_0087925_1250_1648 | 130 |
| 165 | 3300049742 | Ga0501080_0015238 | Ga0501080_0015238_6246_6644 | 130 |
| 166 | 3300049744 | Ga0501083_0040593 | Ga0501083_0040593_1526_1918 | 130 |
| 167 | 3300049744 | Ga0501083_0058721 | Ga0501083_0058721_698_1093 | 130 |
| 168 | 3300049744 | Ga0501083_0134395 | Ga0501083_0134395_798_1193 | 130 |
| 169 | 3300049822 | Ga0501035_0000316 | Ga0501035_0000316_26740_27201 | 130 |
| 170 | 3300049822 | Ga0501035_0000997 | Ga0501035_0000997_28051_28461 | 130 |
| 171 | 3300049822 | Ga0501035_0313930 | Ga0501035_0313930_828_1226 | 130 |
| 172 | 3300049822 | Ga0501035_1264024 | Ga0501035_1264024_27_425 | 130 |
| 173 | 3300049823 | Ga0501044_0044139 | Ga0501044_0044139_3196_3606 | 130 |
| 174 | 3300049823 | Ga0501044_0051525 | Ga0501044_0051525_133_531 | 130 |
| 175 | 3300049823 | Ga0501044_0851816 | Ga0501044_0851816_254_652 | 130 |
| 176 | 3300049823 | Ga0501044_0954393 | Ga0501044_0954393_26_424 | 130 |
| 177 | 3300050491 | nmdc:mga00v17_147288_c1 | nmdc:mga00v17_147288_c1_786_1235 | 130 |
| 178 | 3300050516 | nmdc:mga0sz30_32740_c1 | nmdc:mga0sz30_32740_c1_697_1089 | 130 |
| 179 | 3300053139 | Ga0500568_0190088 | Ga0500568_0190088_332_724 | 130 |
| 180 | 3300053156 | Ga0500622_0001966 | Ga0500622_0001966_1249_1641 | 130 |
| 181 | 3300053727 | Ga0500611_043715 | Ga0500611_043715_568_963 | 130 |
| 182 | 3300054114 | Ga0501084_1039140 | Ga0501084_1039140_225_620 | 130 |
| 183 | 3300059508 | Ga0587088_051021 | Ga0587088_051021_63_455 | 130 |
| 184 | 3300059605 | Ga0587106_165529 | Ga0587106_165529_32_424 | 130 |
| 185 | 3300060353 | Ga0501082_0055900 | Ga0501082_0055900_2754_3146 | 130 |
| 186 | 3300060353 | Ga0501082_0884503 | Ga0501082_0884503_127_525 | 130 |
| 187 | 3300001989 | JGI24739J22299_10108679 | JGI24739J22299_101086791 | 131 |
| 188 | 3300002239 | JGI24034J26672_10036575 | JGI24034J26672_100365752 | 131 |
| 189 | 3300002773 | JGI25152J39213_1000936 | JGI25152J39213_10009363 | 131 |
| 190 | 3300002773 | JGI25152J39213_1003827 | JGI25152J39213_10038276 | 131 |
| 191 | 3300002773 | JGI25152J39213_1006916 | JGI25152J39213_10069163 | 131 |
| 192 | 3300002773 | JGI25152J39213_1009567 | JGI25152J39213_10095673 | 131 |
| 193 | 3300002774 | JGI25150J39212_1000037 | JGI25150J39212_100003772 | 131 |
| 194 | 3300002774 | JGI25150J39212_1014880 | JGI25150J39212_10148803 | 131 |
| 195 | 3300003187 | JGI25151J46595_10000220 | JGI25151J46595_100002203 | 131 |
| 196 | 3300003187 | JGI25151J46595_10001921 | JGI25151J46595_1000192113 | 131 |
| 197 | 3300003215 | JGI25153J46596_10020222 | JGI25153J46596_100202223 | 131 |
| 198 | 3300003374 | JGI25161J50226_1006204 | JGI25161J50226_10062043 | 131 |
| 199 | 3300003578 | Ga0006562J51391_1020867 | Ga0006562J51391_10208671 | 131 |
| 200 | 3300003775 | Ga0055524_1003375 | Ga0055524_10033755 | 131 |
| 201 | 3300003775 | Ga0055524_1058744 | Ga0055524_10587441 | 131 |
| 202 | 3300003790 | Ga0055528_1008866 | Ga0055528_10088661 | 131 |
| 203 | 3300003790 | Ga0055528_1084660 | Ga0055528_10846601 | 131 |
| 204 | 3300003790 | Ga0055528_1086390 | Ga0055528_10863901 | 131 |
| 205 | 3300003792 | Ga0055540_1002204 | Ga0055540_10022049 | 131 |
| 206 | 3300003792 | Ga0055540_1104853 | Ga0055540_11048531 | 131 |
| 207 | 3300004625 | Ga0055543_1000609 | Ga0055543_10006099 | 131 |
| 208 | 3300005262 | Ga0065165_1004116 | Ga0065165_10041164 | 131 |
| 209 | 3300005293 | Ga0065715_11157466 | Ga0065715_111574661 | 131 |
| 210 | 3300005328 | Ga0070676_10308788 | Ga0070676_103087881 | 131 |
| 211 | 3300005330 | Ga0070690_100399077 | Ga0070690_1003990772 | 131 |
| 212 | 3300005333 | Ga0070677_10270542 | Ga0070677_102705421 | 131 |
| 213 | 3300005335 | Ga0070666_10236991 | Ga0070666_102369913 | 131 |
| 214 | 3300005338 | Ga0068868_100169772 | Ga0068868_1001697723 | 131 |
| 215 | 3300005340 | Ga0070689_100104713 | Ga0070689_1001047133 | 131 |
| 216 | 3300005347 | Ga0070668_100949319 | Ga0070668_1009493191 | 131 |
| 217 | 3300005347 | Ga0070668_101108500 | Ga0070668_1011085002 | 131 |
| 218 | 3300005355 | Ga0070671_100022749 | Ga0070671_1000227497 | 131 |
| 219 | 3300005355 | Ga0070671_100199081 | Ga0070671_1001990813 | 131 |
| 220 | 3300005364 | Ga0070673_100150029 | Ga0070673_1001500293 | 131 |
| 221 | 3300005365 | Ga0070688_100093224 | Ga0070688_1000932243 | 131 |
| 222 | 3300005367 | Ga0070667_100335334 | Ga0070667_1003353343 | 131 |
| 223 | 3300005441 | Ga0070700_100569676 | Ga0070700_1005696762 | 131 |
| 224 | 3300005455 | Ga0070663_100124679 | Ga0070663_1001246793 | 131 |
| 225 | 3300005459 | Ga0068867_100083766 | Ga0068867_1000837663 | 131 |
| 226 | 3300005466 | Ga0070685_10401961 | Ga0070685_104019611 | 131 |
| 227 | 3300005543 | Ga0070672_100642674 | Ga0070672_1006426742 | 131 |
| 228 | 3300005618 | Ga0068864_101358555 | Ga0068864_1013585551 | 131 |
| 229 | 3300005840 | Ga0068870_10523834 | Ga0068870_105238341 | 131 |
| 230 | 3300005841 | Ga0068863_100450318 | Ga0068863_1004503182 | 131 |
| 231 | 3300005842 | Ga0068858_100320791 | Ga0068858_1003207912 | 131 |
| 232 | 3300006038 | Ga0075365_10036684 | Ga0075365_100366843 | 131 |
| 233 | 3300006038 | Ga0075365_10108551 | Ga0075365_101085513 | 131 |
| 234 | 3300006038 | Ga0075365_10580465 | Ga0075365_105804652 | 131 |
| 235 | 3300006042 | Ga0075368_10051726 | Ga0075368_100517263 | 131 |
| 236 | 3300006048 | Ga0075363_100192490 | Ga0075363_1001924903 | 131 |
| 237 | 3300006048 | Ga0075363_100224401 | Ga0075363_1002244013 | 131 |
| 238 | 3300006048 | Ga0075363_100309083 | Ga0075363_1003090831 | 131 |
| 239 | 3300006051 | Ga0075364_10148567 | Ga0075364_101485671 | 131 |
| 240 | 3300006051 | Ga0075364_10205256 | Ga0075364_102052562 | 131 |
| 241 | 3300006051 | Ga0075364_10206689 | Ga0075364_102066893 | 131 |
| 242 | 3300006177 | Ga0075362_10191263 | Ga0075362_101912631 | 131 |
| 243 | 3300006178 | Ga0075367_10010829 | Ga0075367_100108293 | 131 |
| 244 | 3300006178 | Ga0075367_10084840 | Ga0075367_100848402 | 131 |
| 245 | 3300006178 | Ga0075367_10310886 | Ga0075367_103108862 | 131 |
| 246 | 3300006178 | Ga0075367_11124187 | Ga0075367_111241871 | 131 |
| 247 | 3300006178 | Ga0075367_11124189 | Ga0075367_111241891 | 131 |
| 248 | 3300006186 | Ga0075369_10009506 | Ga0075369_100095067 | 131 |
| 249 | 3300006186 | Ga0075369_10144981 | Ga0075369_101449813 | 131 |
| 250 | 3300006186 | Ga0075369_10206460 | Ga0075369_102064602 | 131 |
| 251 | 3300006195 | Ga0075366_10132505 | Ga0075366_101325051 | 131 |
| 252 | 3300006353 | Ga0075370_10079998 | Ga0075370_100799982 | 131 |
| 253 | 3300006353 | Ga0075370_10123019 | Ga0075370_101230193 | 131 |
| 254 | 3300006353 | Ga0075370_10240308 | Ga0075370_102403082 | 131 |
| 255 | 3300006353 | Ga0075370_10268065 | Ga0075370_102680653 | 131 |
| 256 | 3300006844 | Ga0075428_100574323 | Ga0075428_1005743232 | 131 |
| 257 | 3300006846 | Ga0075430_100564270 | Ga0075430_1005642701 | 131 |
| 258 | 3300006847 | Ga0075431_100004192 | Ga0075431_1000041927 | 131 |
| 259 | 3300006880 | Ga0075429_100383221 | Ga0075429_1003832212 | 131 |
| 260 | 3300006881 | Ga0068865_100013256 | Ga0068865_1000132563 | 131 |
| 261 | 3300006881 | Ga0068865_100445476 | Ga0068865_1004454762 | 131 |
| 262 | 3300009094 | Ga0111539_11129439 | Ga0111539_111294392 | 131 |
| 263 | 3300009147 | Ga0114129_11013046 | Ga0114129_110130462 | 131 |
| 264 | 3300009148 | Ga0105243_10289378 | Ga0105243_102893783 | 131 |
| 265 | 3300009176 | Ga0105242_10425634 | Ga0105242_104256342 | 131 |
| 266 | 3300009177 | Ga0105248_10019080 | Ga0105248_100190803 | 131 |
| 267 | 3300009177 | Ga0105248_10051665 | Ga0105248_100516656 | 131 |
| 268 | 3300009177 | Ga0105248_10097131 | Ga0105248_100971314 | 131 |
| 269 | 3300009553 | Ga0105249_10188760 | Ga0105249_101887603 | 131 |
| 270 | 3300009553 | Ga0105249_10906165 | Ga0105249_109061652 | 131 |
| 271 | 3300009765 | Ga0123341_1000009 | Ga0123341_100000920 | 131 |
| 272 | 3300009765 | Ga0123341_1073508 | Ga0123341_10735083 | 131 |
| 273 | 3300009766 | Ga0123342_1015560 | Ga0123342_10155608 | 131 |
| 274 | 3300009766 | Ga0123342_1037816 | Ga0123342_10378161 | 131 |
| 275 | 3300010375 | Ga0105239_10281926 | Ga0105239_102819262 | 131 |
| 276 | 3300011119 | Ga0105246_10145766 | Ga0105246_101457663 | 131 |
| 277 | 3300012490 | Ga0157322_1010465 | Ga0157322_10104652 | 131 |
| 278 | 3300013100 | Ga0157373_10395052 | Ga0157373_103950521 | 131 |
| 279 | 3300013308 | Ga0157375_10133840 | Ga0157375_101338404 | 131 |
| 280 | 3300014325 | Ga0163163_10126457 | Ga0163163_101264573 | 131 |
| 281 | 3300014325 | Ga0163163_10941558 | Ga0163163_109415581 | 131 |
| 282 | 3300014968 | Ga0157379_10629323 | Ga0157379_106293232 | 131 |
| 283 | 3300017792 | Ga0163161_10098119 | Ga0163161_100981192 | 131 |
| 284 | 3300025245 | Ga0207425_1000034 | Ga0207425_100003471 | 131 |
| 285 | 3300025245 | Ga0207425_1005340 | Ga0207425_10053404 | 131 |
| 286 | 3300025258 | Ga0209129_1000094 | Ga0209129_100009416 | 131 |
| 287 | 3300025258 | Ga0209129_1002500 | Ga0209129_10025009 | 131 |
| 288 | 3300025258 | Ga0209129_1020837 | Ga0209129_10208372 | 131 |
| 289 | 3300025263 | Ga0209565_1042042 | Ga0209565_10420422 | 131 |
| 290 | 3300025273 | Ga0209673_1000052 | Ga0209673_100005268 | 131 |
| 291 | 3300025273 | Ga0209673_1000459 | Ga0209673_10004599 | 131 |
| 292 | 3300025273 | Ga0209673_1002893 | Ga0209673_10028936 | 131 |
| 293 | 3300025273 | Ga0209673_1010831 | Ga0209673_10108314 | 131 |
| 294 | 3300025291 | Ga0209675_1035903 | Ga0209675_10359032 | 131 |
| 295 | 3300025292 | Ga0209676_1024551 | Ga0209676_10245512 | 131 |
| 296 | 3300025294 | Ga0209025_1000533 | Ga0209025_10005336 | 131 |
| 297 | 3300025294 | Ga0209025_1001035 | Ga0209025_100103541 | 131 |
| 298 | 3300025294 | Ga0209025_1004694 | Ga0209025_10046948 | 131 |
| 299 | 3300025294 | Ga0209025_1032055 | Ga0209025_10320553 | 131 |
| 300 | 3300025295 | Ga0209564_1000569 | Ga0209564_100056951 | 131 |
| 301 | 3300025295 | Ga0209564_1005379 | Ga0209564_10053792 | 131 |
| 302 | 3300025295 | Ga0209564_1011522 | Ga0209564_10115224 | 131 |
| 303 | 3300025297 | Ga0209758_1000415 | Ga0209758_10004156 | 131 |
| 304 | 3300025297 | Ga0209758_1002002 | Ga0209758_100200220 | 131 |
| 305 | 3300025297 | Ga0209758_1006541 | Ga0209758_100654110 | 131 |
| 306 | 3300025297 | Ga0209758_1056284 | Ga0209758_10562843 | 131 |
| 307 | 3300025299 | Ga0209256_1003192 | Ga0209256_100319211 | 131 |
| 308 | 3300025299 | Ga0209256_1010657 | Ga0209256_10106574 | 131 |
| 309 | 3300025299 | Ga0209256_1035927 | Ga0209256_10359271 | 131 |
| 310 | 3300025302 | Ga0207426_1000595 | Ga0207426_100059519 | 131 |
| 311 | 3300025302 | Ga0207426_1000723 | Ga0207426_100072319 | 131 |
| 312 | 3300025303 | Ga0209051_1000561 | Ga0209051_100056114 | 131 |
| 313 | 3300025303 | Ga0209051_1013239 | Ga0209051_10132394 | 131 |
| 314 | 3300025303 | Ga0209051_1014030 | Ga0209051_10140305 | 131 |
| 315 | 3300025304 | Ga0209257_1003339 | Ga0209257_100333911 | 131 |
| 316 | 3300025304 | Ga0209257_1113897 | Ga0209257_11138971 | 131 |
| 317 | 3300025735 | Ga0207713_1143688 | Ga0207713_11436882 | 131 |
| 318 | 3300025901 | Ga0207688_10074121 | Ga0207688_100741212 | 131 |
| 319 | 3300025904 | Ga0207647_10380707 | Ga0207647_103807072 | 131 |
| 320 | 3300025907 | Ga0207645_10173479 | Ga0207645_101734791 | 131 |
| 321 | 3300025908 | Ga0207643_10176338 | Ga0207643_101763383 | 131 |
| 322 | 3300025914 | Ga0207671_10144770 | Ga0207671_101447703 | 131 |
| 323 | 3300025931 | Ga0207644_10126493 | Ga0207644_101264933 | 131 |
| 324 | 3300025931 | Ga0207644_10268503 | Ga0207644_102685032 | 131 |
| 325 | 3300025934 | Ga0207686_10242058 | Ga0207686_102420582 | 131 |
| 326 | 3300025935 | Ga0207709_10052906 | Ga0207709_100529063 | 131 |
| 327 | 3300025936 | Ga0207670_10080457 | Ga0207670_100804573 | 131 |
| 328 | 3300025937 | Ga0207669_10015374 | Ga0207669_100153743 | 131 |
| 329 | 3300025940 | Ga0207691_10565622 | Ga0207691_105656222 | 131 |
| 330 | 3300025941 | Ga0207711_10086222 | Ga0207711_100862223 | 131 |
| 331 | 3300025941 | Ga0207711_10544747 | Ga0207711_105447472 | 131 |
| 332 | 3300025960 | Ga0207651_10221568 | Ga0207651_102215681 | 131 |
| 333 | 3300025972 | Ga0207668_10031492 | Ga0207668_100314921 | 131 |
| 334 | 3300025972 | Ga0207668_10318406 | Ga0207668_103184062 | 131 |
| 335 | 3300025986 | Ga0207658_10845857 | Ga0207658_108458572 | 131 |
| 336 | 3300026067 | Ga0207678_10099898 | Ga0207678_100998983 | 131 |
| 337 | 3300026067 | Ga0207678_10227704 | Ga0207678_102277043 | 131 |
| 338 | 3300026067 | Ga0207678_11582696 | Ga0207678_115826961 | 131 |
| 339 | 3300026089 | Ga0207648_10071399 | Ga0207648_100713993 | 131 |
| 340 | 3300026118 | Ga0207675_100446088 | Ga0207675_1004460882 | 131 |
| 341 | 3300026121 | Ga0207683_10261257 | Ga0207683_102612572 | 131 |
| 342 | 3300027312 | Ga0209371_1077771 | Ga0209371_10777711 | 131 |
| 343 | 3300027866 | Ga0209813_10147959 | Ga0209813_101479592 | 131 |
| 344 | 3300028379 | Ga0268266_11138166 | Ga0268266_111381662 | 131 |
| 345 | 3300028379 | Ga0268266_11376941 | Ga0268266_113769412 | 131 |
| 346 | 3300028380 | Ga0268265_10104189 | Ga0268265_101041892 | 131 |
| 347 | 3300028794 | Ga0307515_10000377 | Ga0307515_1000037729 | 131 |
| 348 | 3300031456 | Ga0307513_10001888 | Ga0307513_1000188823 | 131 |
| 349 | 3300031712 | Ga0265342_10323547 | Ga0265342_103235471 | 131 |
| 350 | 3300031731 | Ga0307405_10011182 | Ga0307405_100111821 | 131 |
| 351 | 3300031911 | Ga0307412_10077356 | Ga0307412_100773563 | 131 |
| 352 | 3300034816 | Ga0373930_0009261 | Ga0373930_0009261_951_1370 | 131 |
| 353 | 3300034820 | Ga0373959_0011942 | Ga0373959_0011942_580_999 | 131 |
| 354 | 3300035085 | Ga0373929_0009398 | Ga0373929_0009398_495_914 | 131 |
| 355 | 3300035091 | Ga0373951_0006615 | Ga0373951_0006615_57_473 | 131 |
| 356 | 3300035112 | Ga0373932_0017412 | Ga0373932_0017412_845_1264 | 131 |
| 357 | 3300035114 | Ga0373939_0202558 | Ga0373939_0202558_130_549 | 131 |
| 358 | 3300035121 | Ga0373960_0055492 | Ga0373960_0055492_553_972 | 131 |
| 359 | 3300035170 | Ga0373943_0634149 | Ga0373943_0634149_12_431 | 131 |
| 360 | 3300035241 | Ga0373961_0224373 | Ga0373961_0224373_226_642 | 131 |
| 361 | 3300035242 | Ga0373962_0026300 | Ga0373962_0026300_1075_1494 | 131 |
| 362 | 3300035691 | Ga0373931_0094116 | Ga0373931_0094116_910_1326 | 131 |
| 363 | 3300035691 | Ga0373931_0185170 | Ga0373931_0185170_33_452 | 131 |
| 364 | 3300035692 | Ga0373935_0031290 | Ga0373935_0031290_660_1079 | 131 |
| 365 | 3300035724 | Ga0373933_0521303 | Ga0373933_0521303_130_549 | 131 |
| 366 | 3300035725 | Ga0373947_0146575 | Ga0373947_0146575_897_1316 | 131 |
| 367 | 3300036401 | Ga0373937_0876017 | Ga0373937_0876017_12_431 | 131 |
| 368 | 3300037068 | Ga0373925_0786609 | Ga0373925_0786609_73_492 | 131 |
| 369 | 3300037418 | Ga0395900_0000086 | Ga0395900_0000086_59679_60101 | 131 |
| 370 | 3300037466 | Ga0395898_0000285 | Ga0395898_0000285_111649_112071 | 131 |
| 371 | 3300037471 | Ga0395905_0000133 | Ga0395905_0000133_11430_11852 | 131 |
| 372 | 3300038443 | Ga0395901_0000092 | Ga0395901_0000092_9906_10328 | 131 |
| 373 | 3300039438 | Ga0436360_0686328 | Ga0436360_0686328_62_478 | 131 |
| 374 | 3300041413 | Ga0439465_0088966 | Ga0439465_0088966_24_419 | 131 |
| 375 | 3300041441 | Ga0451787_378896 | Ga0451787_378896_140_535 | 131 |
| 376 | 3300041446 | Ga0451794_55478 | Ga0451794_55478_81_476 | 131 |
| 377 | 3300041458 | Ga0451798_0974414 | Ga0451798_0974414_1239_1634 | 131 |
| 378 | 3300041459 | Ga0451800_1470819 | Ga0451800_1470819_75_515 | 131 |
| 379 | 3300041491 | Ga0451833_0329526 | Ga0451833_0329526_328_768 | 131 |
| 380 | 3300041492 | Ga0451835_0314534 | Ga0451835_0314534_1541_1936 | 131 |
| 381 | 3300041492 | Ga0451835_0469899 | Ga0451835_0469899_85_480 | 131 |
| 382 | 3300041494 | Ga0451837_0376117 | Ga0451837_0376117_306_701 | 131 |
| 383 | 3300041495 | Ga0451838_05673 | Ga0451838_05673_77_472 | 131 |
| 384 | 3300041496 | Ga0451839_0967922 | Ga0451839_0967922_1553_1948 | 131 |
| 385 | 3300041496 | Ga0451839_0969815 | Ga0451839_0969815_328_723 | 131 |
| 386 | 3300041497 | Ga0451840_04176 | Ga0451840_04176_1555_1950 | 131 |
| 387 | 3300041498 | Ga0451841_1441855 | Ga0451841_1441855_338_778 | 131 |
| 388 | 3300041499 | Ga0451842_0538 | Ga0451842_0538_45_485 | 131 |
| 389 | 3300041501 | Ga0451845_0289069 | Ga0451845_0289069_595_990 | 131 |
| 390 | 3300041501 | Ga0451845_0293700 | Ga0451845_0293700_1809_2204 | 131 |
| 391 | 3300041502 | Ga0451846_27217 | Ga0451846_27217_1264_1659 | 131 |
| 392 | 3300041503 | Ga0451847_0429826 | Ga0451847_0429826_130_525 | 131 |
| 393 | 3300041503 | Ga0451847_0470876 | Ga0451847_0470876_49_489 | 131 |
| 394 | 3300041505 | Ga0451849_0832956 | Ga0451849_0832956_96_491 | 131 |
| 395 | 3300041506 | Ga0451850_30014 | Ga0451850_30014_32_472 | 131 |
| 396 | 3300041507 | Ga0451851_0866658 | Ga0451851_0866658_514_909 | 131 |
| 397 | 3300041509 | Ga0451843_0940602 | Ga0451843_0940602_318_713 | 131 |
| 398 | 3300041510 | Ga0451854_30958 | Ga0451854_30958_134_529 | 131 |
| 399 | 3300041511 | Ga0451855_1135233 | Ga0451855_1135233_49_444 | 131 |
| 400 | 3300041512 | Ga0451853_1760736 | Ga0451853_1760736_284_679 | 131 |
| 401 | 3300041512 | Ga0451853_2301802 | Ga0451853_2301802_77_472 | 131 |
| 402 | 3300041907 | Ga0452268_50754 | Ga0452268_50754_76_471 | 131 |
| 403 | 3300041916 | Ga0452271_63270 | Ga0452271_63270_146_541 | 131 |
| 404 | 3300041997 | Ga0439431_0085186 | Ga0439431_0085186_225_620 | 131 |
| 405 | 3300042006 | Ga0439432_023866 | Ga0439432_023866_43_438 | 131 |
| 406 | 3300042122 | Ga0450920_029847 | Ga0450920_029847_472_912 | 131 |
| 407 | 3300046452 | Ga0495617_057102 | Ga0495617_057102_687_1142 | 131 |
| 408 | 3300046453 | Ga0495627_070163 | Ga0495627_070163_503_991 | 131 |
| 409 | 3300046460 | Ga0495638_0051177 | Ga0495638_0051177_1733_2173 | 131 |
| 410 | 3300046471 | Ga0495650_0041533 | Ga0495650_0041533_953_1393 | 131 |
| 411 | 3300046474 | Ga0495605_0037125 | Ga0495605_0037125_1037_1432 | 131 |
| 412 | 3300046477 | Ga0495664_0521232 | Ga0495664_0521232_82_501 | 131 |
| 413 | 3300046492 | Ga0495585_0210906 | Ga0495585_0210906_487_882 | 131 |
| 414 | 3300046500 | Ga0495596_0168171 | Ga0495596_0168171_162_557 | 131 |
| 415 | 3300046501 | Ga0495607_0131841 | Ga0495607_0131841_874_1269 | 131 |
| 416 | 3300046506 | Ga0495583_0050550 | Ga0495583_0050550_450_845 | 131 |
| 417 | 3300046506 | Ga0495583_0052252 | Ga0495583_0052252_415_870 | 131 |
| 418 | 3300046507 | Ga0495606_0062227 | Ga0495606_0062227_1029_1424 | 131 |
| 419 | 3300046507 | Ga0495606_0092616 | Ga0495606_0092616_726_1148 | 131 |
| 420 | 3300046512 | Ga0495610_0002597 | Ga0495610_0002597_1202_1624 | 131 |
| 421 | 3300046515 | Ga0495620_0016883 | Ga0495620_0016883_34_522 | 131 |
| 422 | 3300046515 | Ga0495620_0019875 | Ga0495620_0019875_588_983 | 131 |
| 423 | 3300046515 | Ga0495620_0049658 | Ga0495620_0049658_562_984 | 131 |
| 424 | 3300046518 | Ga0495631_0001859 | Ga0495631_0001859_529_984 | 131 |
| 425 | 3300046518 | Ga0495631_0237934 | Ga0495631_0237934_152_547 | 131 |
| 426 | 3300046519 | Ga0495632_0051998 | Ga0495632_0051998_1370_1765 | 131 |
| 427 | 3300046519 | Ga0495632_0205869 | Ga0495632_0205869_266_688 | 131 |
| 428 | 3300046522 | Ga0495643_0063995 | Ga0495643_0063995_1232_1654 | 131 |
| 429 | 3300046522 | Ga0495643_0069570 | Ga0495643_0069570_385_780 | 131 |
| 430 | 3300046524 | Ga0495648_0078976 | Ga0495648_0078976_1349_1744 | 131 |
| 431 | 3300046524 | Ga0495648_0237044 | Ga0495648_0237044_172_567 | 131 |
| 432 | 3300046529 | Ga0495652_0429806 | Ga0495652_0429806_179_598 | 131 |
| 433 | 3300046530 | Ga0495654_0114381 | Ga0495654_0114381_757_1152 | 131 |
| 434 | 3300046538 | Ga0495609_0012502 | Ga0495609_0012502_3260_3715 | 131 |
| 435 | 3300046542 | Ga0495597_0062015 | Ga0495597_0062015_381_776 | 131 |
| 436 | 3300046543 | Ga0495645_0221100 | Ga0495645_0221100_825_1244 | 131 |
| 437 | 3300046558 | Ga0495633_0037169 | Ga0495633_0037169_474_869 | 131 |
| 438 | 3300046648 | Ga0495611_0022113 | Ga0495611_0022113_523_978 | 131 |
| 439 | 3300046660 | Ga0495625_0029614 | Ga0495625_0029614_439_894 | 131 |
| 440 | 3300046660 | Ga0495625_0453772 | Ga0495625_0453772_234_674 | 131 |
| 441 | 3300046660 | Ga0495625_0528743 | Ga0495625_0528743_38_460 | 131 |
| 442 | 3300046660 | Ga0495625_0751316 | Ga0495625_0751316_162_557 | 131 |
| 443 | 3300046663 | Ga0495635_0163203 | Ga0495635_0163203_950_1366 | 131 |
| 444 | 3300046691 | Ga0495670_0013208 | Ga0495670_0013208_201_656 | 131 |
| 445 | 3300046691 | Ga0495670_0028226 | Ga0495670_0028226_922_1317 | 131 |
| 446 | 3300046692 | Ga0495671_0411444 | Ga0495671_0411444_95_517 | 131 |
| 447 | 3300046810 | Ga0495660_0100952 | Ga0495660_0100952_134_529 | 131 |
| 448 | 3300047317 | Ga0495604_0520353 | Ga0495604_0520353_193_612 | 131 |
| 449 | 3300047318 | Ga0495636_0083962 | Ga0495636_0083962_135_530 | 131 |
| 450 | 3300047319 | Ga0495674_0207536 | Ga0495674_0207536_530_949 | 131 |
| 451 | 3300047320 | Ga0495672_0063095 | Ga0495672_0063095_609_1016 | 131 |
| 452 | 3300047323 | Ga0495683_0120848 | Ga0495683_0120848_644_1084 | 131 |
| 453 | 3300047443 | Ga0495687_102180 | Ga0495687_102180_311_751 | 131 |
| 454 | 3300047444 | Ga0495675_0470589 | Ga0495675_0470589_163_582 | 131 |
| 455 | 3300047469 | Ga0495673_0104998 | Ga0495673_0104998_617_1105 | 131 |
| 456 | 3300047469 | Ga0495673_0225322 | Ga0495673_0225322_114_536 | 131 |
| 457 | 3300047470 | Ga0495681_0088867 | Ga0495681_0088867_781_1176 | 131 |
| 458 | 3300047472 | Ga0495686_0035155 | Ga0495686_0035155_1136_1558 | 131 |
| 459 | 3300047472 | Ga0495686_0039215 | Ga0495686_0039215_1222_1617 | 131 |
| 460 | 3300048090 | Ga0495615_0032759 | Ga0495615_0032759_689_1084 | 131 |
| 461 | 3300048091 | Ga0495626_0144810 | Ga0495626_0144810_288_683 | 131 |
| 462 | 3300048904 | Ga0496101_0040152 | Ga0496101_0040152_770_1189 | 131 |
| 463 | 3300048904 | Ga0496101_0657113 | Ga0496101_0657113_377_772 | 131 |
| 464 | 3300048906 | Ga0496103_0146964 | Ga0496103_0146964_345_764 | 131 |
| 465 | 3300048907 | Ga0496104_0017656 | Ga0496104_0017656_5418_5837 | 131 |
| 466 | 3300048908 | Ga0496105_0002552 | Ga0496105_0002552_12486_12905 | 131 |
| 467 | 3300048909 | Ga0496106_0059539 | Ga0496106_0059539_1045_1464 | 131 |
| 468 | 3300048910 | Ga0496107_0099059 | Ga0496107_0099059_534_950 | 131 |
| 469 | 3300048911 | Ga0496108_0154143 | Ga0496108_0154143_506_925 | 131 |
| 470 | 3300048911 | Ga0496108_1403551 | Ga0496108_1403551_148_555 | 131 |
| 471 | 3300048912 | Ga0496109_0020836 | Ga0496109_0020836_4751_5170 | 131 |
| 472 | 3300048912 | Ga0496109_0046632 | Ga0496109_0046632_1843_2262 | 131 |
| 473 | 3300048913 | Ga0496110_0082721 | Ga0496110_0082721_2220_2639 | 131 |
| 474 | 3300048914 | Ga0496111_0213519 | Ga0496111_0213519_938_1357 | 131 |
| 475 | 3300048915 | Ga0496112_0068188 | Ga0496112_0068188_1353_1772 | 131 |
| 476 | 3300048916 | Ga0496113_1207262 | Ga0496113_1207262_80_499 | 131 |
| 477 | 3300048918 | Ga0496115_0339802 | Ga0496115_0339802_178_597 | 131 |
| 478 | 3300048919 | Ga0496116_0004280 | Ga0496116_0004280_71_514 | 131 |
| 479 | 3300048919 | Ga0496116_0249122 | Ga0496116_0249122_91_579 | 131 |
| 480 | 3300048920 | Ga0496117_0236272 | Ga0496117_0236272_184_627 | 131 |
| 481 | 3300048921 | Ga0496118_0004259 | Ga0496118_0004259_15933_16328 | 131 |
| 482 | 3300048921 | Ga0496118_0030757 | Ga0496118_0030757_23_466 | 131 |
| 483 | 3300048922 | Ga0496119_0085907 | Ga0496119_0085907_514_957 | 131 |
| 484 | 3300048922 | Ga0496119_0133296 | Ga0496119_0133296_259_681 | 131 |
| 485 | 3300048923 | Ga0496120_0164987 | Ga0496120_0164987_451_939 | 131 |
| 486 | 3300048924 | Ga0496121_0150988 | Ga0496121_0150988_931_1374 | 131 |
| 487 | 3300048925 | Ga0496122_0054408 | Ga0496122_0054408_1578_2069 | 131 |
| 488 | 3300048927 | Ga0496124_0432963 | Ga0496124_0432963_65_487 | 131 |
| 489 | 3300048928 | Ga0496125_0005653 | Ga0496125_0005653_938_1381 | 131 |
| 490 | 3300048929 | Ga0496126_0302079 | Ga0496126_0302079_857_1300 | 131 |
| 491 | 3300049459 | Ga0495678_018645 | Ga0495678_018645_11_466 | 131 |
| 492 | 3300049459 | Ga0495678_105214 | Ga0495678_105214_420_815 | 131 |
| 493 | 3300049459 | Ga0495678_110088 | Ga0495678_110088_434_856 | 131 |
| 494 | 3300049569 | Ga0501032_0025474 | Ga0501032_0025474_1355_1786 | 131 |
| 495 | 3300049569 | Ga0501032_0100662 | Ga0501032_0100662_418_825 | 131 |
| 496 | 3300049570 | Ga0501033_0024123 | Ga0501033_0024123_2824_3231 | 131 |
| 497 | 3300049571 | Ga0501034_0952595 | Ga0501034_0952595_99_506 | 131 |
| 498 | 3300049572 | Ga0501036_0029398 | Ga0501036_0029398_2850_3281 | 131 |
| 499 | 3300049572 | Ga0501036_0183137 | Ga0501036_0183137_748_1233 | 131 |
| 500 | 3300049572 | Ga0501036_0630825 | Ga0501036_0630825_265_672 | 131 |
| 501 | 3300049573 | Ga0501037_0014865 | Ga0501037_0014865_2090_2521 | 131 |
| 502 | 3300049574 | Ga0501038_0020653 | Ga0501038_0020653_729_1160 | 131 |
| 503 | 3300049575 | Ga0501039_0020733 | Ga0501039_0020733_2854_3285 | 131 |
| 504 | 3300049578 | Ga0501042_0021056 | Ga0501042_0021056_2418_2849 | 131 |
| 505 | 3300049579 | Ga0501043_0037611 | Ga0501043_0037611_2615_3022 | 131 |
| 506 | 3300049579 | Ga0501043_0194651 | Ga0501043_0194651_451_882 | 131 |
| 507 | 3300049579 | Ga0501043_0684467 | Ga0501043_0684467_274_714 | 131 |
| 508 | 3300049580 | Ga0501046_0376233 | Ga0501046_0376233_545_976 | 131 |
| 509 | 3300049581 | Ga0501047_0019478 | Ga0501047_0019478_3709_4140 | 131 |
| 510 | 3300049581 | Ga0501047_0078900 | Ga0501047_0078900_1017_1502 | 131 |
| 511 | 3300049581 | Ga0501047_0216666 | Ga0501047_0216666_324_731 | 131 |
| 512 | 3300049581 | Ga0501047_0894714 | Ga0501047_0894714_65_472 | 131 |
| 513 | 3300049582 | Ga0501048_0716458 | Ga0501048_0716458_52_483 | 131 |
| 514 | 3300049583 | Ga0501067_0012240 | Ga0501067_0012240_1813_2244 | 131 |
| 515 | 3300049584 | Ga0501068_0130403 | Ga0501068_0130403_664_1149 | 131 |
| 516 | 3300049585 | Ga0501069_0004912 | Ga0501069_0004912_2136_2567 | 131 |
| 517 | 3300049586 | Ga0501070_0026104 | Ga0501070_0026104_545_976 | 131 |
| 518 | 3300049586 | Ga0501070_0975296 | Ga0501070_0975296_164_571 | 131 |
| 519 | 3300049587 | Ga0501071_0032969 | Ga0501071_0032969_2467_2898 | 131 |
| 520 | 3300049588 | Ga0501072_0184710 | Ga0501072_0184710_561_992 | 131 |
| 521 | 3300049589 | Ga0501073_0033221 | Ga0501073_0033221_2515_2946 | 131 |
| 522 | 3300049590 | Ga0501074_0015342 | Ga0501074_0015342_2491_2922 | 131 |
| 523 | 3300049592 | Ga0501076_1463652 | Ga0501076_1463652_47_469 | 131 |
| 524 | 3300049665 | Ga0501227_140501 | Ga0501227_140501_168_563 | 131 |
| 525 | 3300049742 | Ga0501080_0034931 | Ga0501080_0034931_2216_2647 | 131 |
| 526 | 3300049742 | Ga0501080_0176011 | Ga0501080_0176011_1378_1785 | 131 |
| 527 | 3300049744 | Ga0501083_0011274 | Ga0501083_0011274_4693_5094 | 131 |
| 528 | 3300049744 | Ga0501083_0016060 | Ga0501083_0016060_2658_3089 | 131 |
| 529 | 3300049822 | Ga0501035_0060569 | Ga0501035_0060569_2594_3025 | 131 |
| 530 | 3300049822 | Ga0501035_0201336 | Ga0501035_0201336_674_1081 | 131 |
| 531 | 3300049822 | Ga0501035_0252485 | Ga0501035_0252485_41_436 | 131 |
| 532 | 3300049823 | Ga0501044_0041587 | Ga0501044_0041587_1248_1733 | 131 |
| 533 | 3300049823 | Ga0501044_0066428 | Ga0501044_0066428_2377_2784 | 131 |
| 534 | 3300049823 | Ga0501044_0096226 | Ga0501044_0096226_451_882 | 131 |
| 535 | 3300049824 | Ga0501045_0013385 | Ga0501045_0013385_2680_3111 | 131 |
| 536 | 3300049824 | Ga0501045_0386405 | Ga0501045_0386405_562_984 | 131 |
| 537 | 3300050489 | nmdc:mga03683_49273_c1 | nmdc:mga03683_49273_c1_812_1207 | 131 |
| 538 | 3300050489 | nmdc:mga03683_80981_c1 | nmdc:mga03683_80981_c1_477_893 | 131 |
| 539 | 3300050490 | nmdc:mga03n38_131231_c1 | nmdc:mga03n38_131231_c1_446_841 | 131 |
| 540 | 3300050491 | nmdc:mga00v17_302357_c1 | nmdc:mga00v17_302357_c1_461_856 | 131 |
| 541 | 3300050492 | nmdc:mga0yw44_105992_c1 | nmdc:mga0yw44_105992_c1_410_850 | 131 |
| 542 | 3300050492 | nmdc:mga0yw44_445410_c1 | nmdc:mga0yw44_445410_c1_190_609 | 131 |
| 543 | 3300050492 | nmdc:mga0yw44_91916_c1 | nmdc:mga0yw44_91916_c1_744_1160 | 131 |
| 544 | 3300050494 | nmdc:mga06z11_293298_c1 | nmdc:mga06z11_293298_c1_106_522 | 131 |
| 545 | 3300050494 | nmdc:mga06z11_471459_c1 | nmdc:mga06z11_471459_c1_328_723 | 131 |
| 546 | 3300050494 | nmdc:mga06z11_529759_c1 | nmdc:mga06z11_529759_c1_137_553 | 131 |
| 547 | 3300050495 | nmdc:mga04h51_171203_c1 | nmdc:mga04h51_171203_c1_173_589 | 131 |
| 548 | 3300050495 | nmdc:mga04h51_516155_c1 | nmdc:mga04h51_516155_c1_38_478 | 131 |
| 549 | 3300050495 | nmdc:mga04h51_56565_c1 | nmdc:mga04h51_56565_c1_195_611 | 131 |
| 550 | 3300050496 | nmdc:mga07m45_101697_c1 | nmdc:mga07m45_101697_c1_322_738 | 131 |
| 551 | 3300050496 | nmdc:mga07m45_102547_c1 | nmdc:mga07m45_102547_c1_150_566 | 131 |
| 552 | 3300050496 | nmdc:mga07m45_95795_c1 | nmdc:mga07m45_95795_c1_1218_1613 | 131 |
| 553 | 3300050508 | nmdc:mga09592_51612_c1 | nmdc:mga09592_51612_c1_2727_3134 | 131 |
| 554 | 3300050509 | nmdc:mga0qj67_610590_c1 | nmdc:mga0qj67_610590_c1_287_694 | 131 |
| 555 | 3300050510 | nmdc:mga06r32_18149_c1 | nmdc:mga06r32_18149_c1_5110_5517 | 131 |
| 556 | 3300050516 | nmdc:mga0sz30_124127_c1 | nmdc:mga0sz30_124127_c1_362_769 | 131 |
| 557 | 3300050516 | nmdc:mga0sz30_28305_c1 | nmdc:mga0sz30_28305_c1_1033_1449 | 131 |
| 558 | 3300050516 | nmdc:mga0sz30_63064_c1 | nmdc:mga0sz30_63064_c1_928_1368 | 131 |
| 559 | 3300053077 | Ga0495601_0088815 | Ga0495601_0088815_649_1068 | 131 |
| 560 | 3300053084 | Ga0495595_0059070 | Ga0495595_0059070_267_686 | 131 |
| 561 | 3300053085 | Ga0495619_0056591 | Ga0495619_0056591_253_672 | 131 |
| 562 | 3300053086 | Ga0500578_0143727 | Ga0500578_0143727_229_624 | 131 |
| 563 | 3300053098 | Ga0500650_0158611 | Ga0500650_0158611_558_974 | 131 |
| 564 | 3300053108 | Ga0500562_023027 | Ga0500562_023027_1181_1597 | 131 |
| 565 | 3300053109 | Ga0500569_007712 | Ga0500569_007712_1168_1563 | 131 |
| 566 | 3300053118 | Ga0500594_0009824 | Ga0500594_0009824_495_890 | 131 |
| 567 | 3300053122 | Ga0500608_101911 | Ga0500608_101911_421_816 | 131 |
| 568 | 3300053130 | Ga0500642_0423300 | Ga0500642_0423300_68_484 | 131 |
| 569 | 3300053134 | Ga0500658_0008278 | Ga0500658_0008278_2117_2512 | 131 |
| 570 | 3300053139 | Ga0500568_0001609 | Ga0500568_0001609_12421_12879 | 131 |
| 571 | 3300053142 | Ga0500577_0236841 | Ga0500577_0236841_191_586 | 131 |
| 572 | 3300053146 | Ga0500588_0143308 | Ga0500588_0143308_375_791 | 131 |
| 573 | 3300053153 | Ga0500616_0047391 | Ga0500616_0047391_649_1071 | 131 |
| 574 | 3300053153 | Ga0500616_0051370 | Ga0500616_0051370_1594_1989 | 131 |
| 575 | 3300053153 | Ga0500616_0082737 | Ga0500616_0082737_872_1330 | 131 |
| 576 | 3300054114 | Ga0501084_0540501 | Ga0501084_0540501_482_889 | 131 |
| 577 | 3300059491 | Ga0587070_135389 | Ga0587070_135389_102_497 | 131 |
| 578 | 3300059492 | Ga0587073_0088647 | Ga0587073_0088647_320_760 | 131 |
| 579 | 3300059503 | Ga0587080_019117 | Ga0587080_019117_21_461 | 131 |
| 580 | 3300059505 | Ga0587083_0018824 | Ga0587083_0018824_785_1180 | 131 |
| 581 | 3300059510 | Ga0587090_041206 | Ga0587090_041206_62_457 | 131 |
| 582 | 3300059512 | Ga0587092_104135 | Ga0587092_104135_72_467 | 131 |
| 583 | 3300059641 | Ga0587068_022656 | Ga0587068_022656_70_465 | 131 |
| 584 | 3300060344 | Ga0587071_022486 | Ga0587071_022486_24_464 | 131 |
| 585 | 3300060346 | Ga0587111_0119265 | Ga0587111_0119265_127_522 | 131 |
| 586 | 3300060346 | Ga0587111_0146678 | Ga0587111_0146678_77_472 | 131 |
| 587 | 3300060353 | Ga0501082_0025124 | Ga0501082_0025124_2180_2611 | 131 |
| 588 | 3300060353 | Ga0501082_0037839 | Ga0501082_0037839_442_843 | 131 |
| 589 | 3300060353 | Ga0501082_0315421 | Ga0501082_0315421_323_808 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wu2-assembly3.cif.gz_K | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant | 0.8688 | 8 | 125 |
| 2wdv-assembly1.cif.gz_C | e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket | 0.8631 | 8 | 125 |
| 7jz2-assembly1.cif.gz_C | succinate: quinone oxidoreductase sqr from e.coli k12 | 0.8484 | 4 | 125 |
| 2wdv-assembly1.cif.gz_C | e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket | 0.8373 | 8 | 125 |
| 2wu2-assembly3.cif.gz_K | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant | 0.8364 | 8 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ws3C00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.863 | 8 | 125 | 1.20.1300.10 |
| 2wdvK00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.862 | 8 | 125 | 1.20.1300.10 |
| 2wdrC00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8611 | 8 | 125 | 1.20.1300.10 |
| 2ws3C00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8373 | 8 | 125 | 1.20.1300.10 |
| 2wdvK00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8368 | 8 | 125 | 1.20.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8QNA5-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.976 | 26 | 126 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-V4NFK4-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9756 | 23 | 130 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A2H0EV89-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9745 | 23 | 125 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A382QPX9-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9731 | 53 | 129 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A357CJD6-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9719 | 35 | 130 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar