F466831

General Info

Members Datasets Scaffolds Average Seq Length
589 327 586 136

Family's Representative Sequence

Representative Sequence 3300002739|JGI25158J39367_1000074|JGI25158J39367_10000749
Length 130
Sequence MANVTNRPLSPHLQIYKPIPTMVMSIVHRITGGALYFGTLLIAWWLIAAATGQAYYDWANWVLGSIIGKLVLLGYTWALIHHLLGGFRHFMWDLGHGFEKEFSTKLAIANIIGSLCLTVLVWVIGFIIRF

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
3 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
72 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
76 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
77 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
160 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
161 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300041495 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaT Metatranscriptome Unclassified
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041499 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaT Metatranscriptome Unclassified
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
173 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
176 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
177 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
178 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
179 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
182 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
302 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
311 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 3.74
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.54
Nodule 1.02
Rhizoplane 5.43
Rhizosphere 54.84
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10108679 3300001989 Bacteria 833
2 JGI24034J26672_10036575 3300002239 Bacteria 814
3 JGI25158J39367_1000074 3300002739 Bacteria 22903
4 JGI25152J39213_1000936 3300002773 Bacteria 14306
5 JGI25152J39213_1003827 3300002773 Bacteria 4977
6 JGI25152J39213_1006916 3300002773 Bacteria 2999
7 JGI25152J39213_1008129 3300002773 Bacteria 2634
8 JGI25152J39213_1009567 3300002773 Bacteria 2293
9 JGI25152J39213_1047966 3300002773 Bacteria 568
10 JGI25152J39213_1048043 3300002773 Bacteria 567
11 JGI25150J39212_1000037 3300002774 Bacteria 88885
12 JGI25150J39212_1008276 3300002774 Bacteria 2045
13 JGI25150J39212_1014880 3300002774 Bacteria 1309
14 JGI25159J45721_1000262 3300002987 Bacteria 24623
15 JGI25151J46595_10000220 3300003187 Bacteria 67327
16 JGI25151J46595_10001921 3300003187 Bacteria 13177
17 JGI25151J46595_10005265 3300003187 Bacteria 6704
18 JGI25153J46596_10019108 3300003215 Bacteria 2634
19 JGI25153J46596_10020222 3300003215 Bacteria 2522
20 JGI25153J46596_10127183 3300003215 Bacteria 568
21 JGI25153J46596_10127263 3300003215 Bacteria 567
22 JGI25160J50197_1023007 3300003354 Bacteria 1812
23 JGI25161J50226_1000137 3300003374 Bacteria 50627
24 JGI25161J50226_1006204 3300003374 Bacteria 2200
25 Ga0006562J51391_1020867 3300003578 Bacteria 1373
26 Ga0055526_1002794 3300003771 Bacteria 11559
27 Ga0055524_1003375 3300003775 Bacteria 7777
28 Ga0055524_1005991 3300003775 Bacteria 5341
29 Ga0055524_1058744 3300003775 Bacteria 812
30 Ga0055536_1008778 3300003781 Bacteria 4284
31 Ga0055528_1008866 3300003790 Bacteria 4257
32 Ga0055528_1027613 3300003790 Bacteria 1591
33 Ga0055528_1036012 3300003790 Bacteria 1190
34 Ga0055528_1084660 3300003790 Bacteria 552
35 Ga0055528_1086390 3300003790 Bacteria 543
36 Ga0055540_1002204 3300003792 Bacteria 10584
37 Ga0055540_1015240 3300003792 Bacteria 2249
38 Ga0055540_1018131 3300003792 Bacteria 1939
39 Ga0055540_1104853 3300003792 Bacteria 525
40 Ga0055531_10014492 3300003794 Bacteria 3544
41 Ga0055543_1000321 3300004625 Bacteria 33172
42 Ga0055543_1000609 3300004625 Bacteria 19299
43 Ga0065165_1004116 3300005262 Bacteria 9358
44 Ga0065165_1028090 3300005262 Bacteria 1822
45 Ga0065165_1141942 3300005262 Bacteria 567
46 Ga0065715_11157466 3300005293 Bacteria 507
47 Ga0070676_10308788 3300005328 Bacteria 1075
48 Ga0070690_100399077 3300005330 Bacteria 1010
49 Ga0070670_100486886 3300005331 Bacteria 1096
50 Ga0070677_10270542 3300005333 Bacteria 852
51 Ga0070666_10236991 3300005335 Bacteria 1290
52 Ga0070682_100211738 3300005337 Bacteria 1374
53 Ga0068868_100169772 3300005338 Bacteria 1805
54 Ga0070689_100104713 3300005340 Bacteria 2244
55 Ga0070668_100624455 3300005347 Bacteria 945
56 Ga0070668_100949319 3300005347 Bacteria 771
57 Ga0070668_101108500 3300005347 Bacteria 714
58 Ga0070671_100022749 3300005355 Bacteria 5120
59 Ga0070671_100199081 3300005355 Bacteria 1698
60 Ga0070673_100150029 3300005364 Bacteria 1974
61 Ga0070688_100093224 3300005365 Bacteria 1972
62 Ga0070667_100335334 3300005367 Bacteria 1367
63 Ga0070700_100569676 3300005441 Bacteria 883
64 Ga0070663_100124679 3300005455 Bacteria 1950
65 Ga0068867_100083766 3300005459 Bacteria 2408
66 Ga0070685_10401961 3300005466 Bacteria 949
67 Ga0070672_100642674 3300005543 Bacteria 926
68 Ga0070665_100013723 3300005548 Bacteria 8154
69 Ga0070665_100118172 3300005548 Bacteria 2653
70 Ga0068864_101358555 3300005618 Bacteria 712
71 Ga0068870_10523834 3300005840 Bacteria 794
72 Ga0068863_100450318 3300005841 Bacteria 1263
73 Ga0068858_100320791 3300005842 Bacteria 1481
74 Ga0075365_10036684 3300006038 Bacteria 3177
75 Ga0075365_10108551 3300006038 Bacteria 1906
76 Ga0075365_10336995 3300006038 Bacteria 1063
77 Ga0075365_10580465 3300006038 Bacteria 793
78 Ga0075368_10045362 3300006042 Bacteria 1736
79 Ga0075368_10051726 3300006042 Bacteria 1633
80 Ga0075368_10213366 3300006042 Bacteria 819
81 Ga0075363_100097577 3300006048 Bacteria 1624
82 Ga0075363_100192490 3300006048 Bacteria 1163
83 Ga0075363_100224401 3300006048 Bacteria 1077
84 Ga0075363_100309083 3300006048 Bacteria 918
85 Ga0075363_100458228 3300006048 Bacteria 754
86 Ga0075364_10148567 3300006051 Bacteria 1579
87 Ga0075364_10180403 3300006051 Bacteria 1429
88 Ga0075364_10205256 3300006051 Bacteria 1336
89 Ga0075364_10206689 3300006051 Bacteria 1331
90 Ga0075362_10191263 3300006177 Bacteria 994
91 Ga0075367_10010829 3300006178 Bacteria 4805
92 Ga0075367_10020031 3300006178 Bacteria 3720
93 Ga0075367_10021315 3300006178 Bacteria 3620
94 Ga0075367_10074474 3300006178 Bacteria 2047
95 Ga0075367_10084840 3300006178 Bacteria 1921
96 Ga0075367_10310886 3300006178 Bacteria 992
97 Ga0075367_11124187 3300006178 Bacteria 502
98 Ga0075367_11124189 3300006178 Bacteria 502
99 Ga0075369_10009506 3300006186 Bacteria 3780
100 Ga0075369_10027517 3300006186 Bacteria 2377
101 Ga0075369_10109392 3300006186 Bacteria 1245
102 Ga0075369_10144981 3300006186 Bacteria 1084
103 Ga0075369_10206460 3300006186 Bacteria 907
104 Ga0075366_10019025 3300006195 Bacteria 3969
105 Ga0075366_10072620 3300006195 Bacteria 2050
106 Ga0075366_10132505 3300006195 Bacteria 1504
107 Ga0075370_10079998 3300006353 Bacteria 1877
108 Ga0075370_10092194 3300006353 Bacteria 1748
109 Ga0075370_10123019 3300006353 Bacteria 1511
110 Ga0075370_10240308 3300006353 Bacteria 1072
111 Ga0075370_10268065 3300006353 Bacteria 1013
112 Ga0075428_100574323 3300006844 Bacteria 1205
113 Ga0075430_100564270 3300006846 Bacteria 939
114 Ga0075431_100004192 3300006847 Bacteria 14110
115 Ga0075429_100383221 3300006880 Bacteria 1231
116 Ga0068865_100013256 3300006881 Bacteria 5206
117 Ga0068865_100445476 3300006881 Bacteria 1069
118 Ga0079104_1008512 3300006946 Bacteria 3581
119 Ga0099826_10030104 3300006948 Bacteria 3947
120 Ga0105244_10164819 3300009036 Bacteria 1057
121 Ga0111539_11129439 3300009094 Bacteria 911
122 Ga0105245_11663788 3300009098 Bacteria 690
123 Ga0114129_11013046 3300009147 Bacteria 1045
124 Ga0105243_10018422 3300009148 Bacteria 5289
125 Ga0105243_10289378 3300009148 Bacteria 1479
126 Ga0105242_10425634 3300009176 Bacteria 1245
127 Ga0105248_10019080 3300009177 Bacteria 7583
128 Ga0105248_10051665 3300009177 Bacteria 4612
129 Ga0105248_10097131 3300009177 Bacteria 3319
130 Ga0105249_10188760 3300009553 Bacteria 2010
131 Ga0105249_10906165 3300009553 Bacteria 949
132 Ga0123341_1000009 3300009765 Bacteria 122597
133 Ga0123341_1073508 3300009765 Bacteria 1444
134 Ga0123342_1015560 3300009766 Bacteria 6884
135 Ga0123342_1037816 3300009766 Bacteria 1914
136 Ga0105239_10281926 3300010375 Bacteria 1871
137 Ga0105246_10145766 3300011119 Bacteria 1786
138 Ga0157322_1010465 3300012490 Bacteria 748
139 Ga0157319_1003163 3300012497 Bacteria 1000
140 Ga0157326_1022789 3300012513 Bacteria 784
141 Ga0157373_10007612 3300013100 Bacteria 8048
142 Ga0157373_10395052 3300013100 Bacteria 990
143 Ga0157370_10302579 3300013104 Bacteria 1476
144 Ga0157369_12672092 3300013105 Bacteria 503
145 Ga0157375_10133840 3300013308 Bacteria 2601
146 Ga0157375_11096275 3300013308 Bacteria 932
147 Ga0163163_10126457 3300014325 Bacteria 2594
148 Ga0163163_10941558 3300014325 Bacteria 927
149 Ga0157380_10101899 3300014326 Bacteria 2393
150 Ga0157379_10629323 3300014968 Bacteria 1003
151 Ga0157379_11810046 3300014968 Bacteria 600
152 Ga0163161_10098119 3300017792 Bacteria 2177
153 Ga0209436_100299 3300025208 Bacteria 22971
154 Ga0207425_1000034 3300025245 Bacteria 227886
155 Ga0207425_1001864 3300025245 Bacteria 8100
156 Ga0207425_1005340 3300025245 Bacteria 3678
157 Ga0207425_1013468 3300025245 Bacteria 1889
158 Ga0209129_1000094 3300025258 Bacteria 172051
159 Ga0209129_1002128 3300025258 Bacteria 10070
160 Ga0209129_1002500 3300025258 Bacteria 8964
161 Ga0209129_1007959 3300025258 Bacteria 3035
162 Ga0209129_1020837 3300025258 Bacteria 1212
163 Ga0209565_1042042 3300025263 Bacteria 848
164 Ga0209673_1000052 3300025273 Bacteria 279795
165 Ga0209673_1000459 3300025273 Bacteria 68727
166 Ga0209673_1002893 3300025273 Bacteria 10885
167 Ga0209673_1010831 3300025273 Bacteria 3811
168 Ga0209673_1016194 3300025273 Bacteria 2799
169 Ga0209130_1000009 3300025284 Bacteria 498952
170 Ga0209675_1035903 3300025291 Bacteria 1126
171 Ga0209676_1024551 3300025292 Bacteria 1950
172 Ga0209025_1000533 3300025294 Bacteria 72404
173 Ga0209025_1001035 3300025294 Bacteria 40774
174 Ga0209025_1004694 3300025294 Bacteria 11662
175 Ga0209025_1017322 3300025294 Bacteria 4169
176 Ga0209025_1032055 3300025294 Bacteria 2468
177 Ga0209025_1083880 3300025294 Bacteria 1070
178 Ga0209564_1000569 3300025295 Bacteria 58592
179 Ga0209564_1005379 3300025295 Bacteria 7336
180 Ga0209564_1006046 3300025295 Bacteria 6668
181 Ga0209564_1011522 3300025295 Bacteria 3953
182 Ga0209758_1000415 3300025297 Bacteria 72404
183 Ga0209758_1002002 3300025297 Bacteria 21937
184 Ga0209758_1005244 3300025297 Bacteria 10149
185 Ga0209758_1006541 3300025297 Bacteria 8305
186 Ga0209758_1012770 3300025297 Bacteria 4655
187 Ga0209758_1056284 3300025297 Bacteria 1329
188 Ga0209256_1002153 3300025299 Bacteria 16996
189 Ga0209256_1003192 3300025299 Bacteria 11860
190 Ga0209256_1010657 3300025299 Bacteria 3811
191 Ga0209256_1035927 3300025299 Bacteria 1304
192 Ga0207426_1000041 3300025302 Bacteria 433536
193 Ga0207426_1000595 3300025302 Bacteria 47697
194 Ga0207426_1000723 3300025302 Bacteria 38116
195 Ga0209051_1000561 3300025303 Bacteria 45148
196 Ga0209051_1013102 3300025303 Bacteria 3965
197 Ga0209051_1013239 3300025303 Bacteria 3937
198 Ga0209051_1014030 3300025303 Bacteria 3766
199 Ga0209257_1003339 3300025304 Bacteria 13886
200 Ga0209257_1113897 3300025304 Bacteria 641
201 Ga0207713_1143688 3300025735 Bacteria 777
202 Ga0207688_10074121 3300025901 Bacteria 1935
203 Ga0207647_10380707 3300025904 Bacteria 797
204 Ga0207699_10576060 3300025906 Bacteria 818
205 Ga0207645_10173479 3300025907 Bacteria 1414
206 Ga0207643_10176338 3300025908 Bacteria 1292
207 Ga0207671_10144770 3300025914 Bacteria 1833
208 Ga0207693_10055090 3300025915 Bacteria 3120
209 Ga0207663_10184124 3300025916 Bacteria 1494
210 Ga0207644_10126493 3300025931 Bacteria 1951
211 Ga0207644_10268503 3300025931 Bacteria 1366
212 Ga0207686_10242058 3300025934 Bacteria 1313
213 Ga0207709_10052906 3300025935 Bacteria 2496
214 Ga0207670_10080457 3300025936 Bacteria 2277
215 Ga0207669_10015374 3300025937 Bacteria 3858
216 Ga0207691_10565622 3300025940 Bacteria 963
217 Ga0207711_10086222 3300025941 Bacteria 2752
218 Ga0207711_10544747 3300025941 Bacteria 1082
219 Ga0207651_10221568 3300025960 Bacteria 1529
220 Ga0207668_10031492 3300025972 Bacteria 3494
221 Ga0207668_10318406 3300025972 Bacteria 1290
222 Ga0207668_10569945 3300025972 Bacteria 983
223 Ga0207658_10845857 3300025986 Bacteria 832
224 Ga0207678_10099898 3300026067 Bacteria 2479
225 Ga0207678_10227704 3300026067 Bacteria 1596
226 Ga0207678_11582696 3300026067 Bacteria 577
227 Ga0207648_10071399 3300026089 Bacteria 3026
228 Ga0207675_100446088 3300026118 Bacteria 1282
229 Ga0207683_10261257 3300026121 Bacteria 1581
230 Ga0209371_1077771 3300027312 Bacteria 578
231 Ga0209813_10060814 3300027866 Bacteria 1205
232 Ga0209813_10147959 3300027866 Bacteria 839
233 Ga0268266_10148689 3300028379 Bacteria 2109
234 Ga0268266_11138166 3300028379 Bacteria 755
235 Ga0268266_11376941 3300028379 Bacteria 681
236 Ga0268265_10104189 3300028380 Bacteria 2299
237 Ga0265319_1270635 3300028563 Bacteria 517
238 Ga0307515_10000377 3300028794 Bacteria 109082
239 Ga0265340_10467940 3300031247 Bacteria 555
240 Ga0307513_10001888 3300031456 Bacteria 29770
241 Ga0265342_10323547 3300031712 Bacteria 808
242 Ga0307405_10011182 3300031731 Bacteria 4687
243 Ga0307412_10077356 3300031911 Bacteria 2288
244 Ga0373930_0009261 3300034816 Bacteria 1740
245 Ga0373959_0011942 3300034820 Bacteria 1542
246 Ga0373929_0009398 3300035085 Bacteria 1812
247 Ga0373951_0006615 3300035091 Bacteria 2649
248 Ga0373932_0017412 3300035112 Bacteria 1844
249 Ga0373939_0202558 3300035114 Bacteria 751
250 Ga0373960_0055492 3300035121 Bacteria 1188
251 Ga0373943_0634149 3300035170 Bacteria 631
252 Ga0373961_0224373 3300035241 Bacteria 671
253 Ga0373962_0026300 3300035242 Bacteria 1568
254 Ga0373931_0094116 3300035691 Bacteria 1674
255 Ga0373931_0185170 3300035691 Bacteria 1235
256 Ga0373935_0031290 3300035692 Bacteria 3302
257 Ga0373933_0521303 3300035724 Bacteria 779
258 Ga0373947_0146575 3300035725 Bacteria 1518
259 Ga0373937_0876017 3300036401 Bacteria 847
260 Ga0373925_0786609 3300037068 Bacteria 784
261 Ga0395900_0000086 3300037418 Bacteria 171749
262 Ga0395898_0000285 3300037466 Bacteria 122279
263 Ga0395905_0000133 3300037471 Bacteria 123500
264 Ga0395901_0000092 3300038443 Bacteria 121976
265 Ga0436360_0686328 3300039438 Bacteria 502
266 Ga0436361_0074042 3300039447 Bacteria 7292
267 Ga0439436_0220862 3300041404 Bacteria 545
268 Ga0439465_0088966 3300041413 Bacteria 1054
269 Ga0439465_0253293 3300041413 Bacteria 651
270 Ga0451787_378896 3300041441 Bacteria 2658
271 Ga0451794_55478 3300041446 Bacteria 590
272 Ga0451798_0974414 3300041458 Bacteria 2577
273 Ga0451800_1470819 3300041459 Bacteria 887
274 Ga0451833_0329526 3300041491 Bacteria 906
275 Ga0451835_0314534 3300041492 Bacteria 3744
276 Ga0451835_0469899 3300041492 Bacteria 652
277 Ga0451837_0376117 3300041494 Bacteria 1275
278 Ga0451838_05673 3300041495 Bacteria 542
279 Ga0451839_0967922 3300041496 Bacteria 2018
280 Ga0451839_0969815 3300041496 Bacteria 899
281 Ga0451840_04176 3300041497 Bacteria 2034
282 Ga0451841_1441855 3300041498 Bacteria 1915
283 Ga0451842_0538 3300041499 Bacteria 511
284 Ga0451845_0289069 3300041501 Bacteria 1093
285 Ga0451845_0293700 3300041501 Bacteria 2307
286 Ga0451845_0940612 3300041501 Bacteria 589
287 Ga0451846_27217 3300041502 Bacteria 1742
288 Ga0451847_0429826 3300041503 Bacteria 2741
289 Ga0451847_0470876 3300041503 Bacteria 574
290 Ga0451849_0832956 3300041505 Bacteria 575
291 Ga0451850_30014 3300041506 Bacteria 1069
292 Ga0451851_0866658 3300041507 Bacteria 1100
293 Ga0451843_0940602 3300041509 Bacteria 884
294 Ga0451854_30958 3300041510 Bacteria 612
295 Ga0451855_1135233 3300041511 Bacteria 1003
296 Ga0451853_1760736 3300041512 Bacteria 978
297 Ga0451853_2301802 3300041512 Bacteria 525
298 Ga0452268_50754 3300041907 Bacteria 519
299 Ga0452271_63270 3300041916 Bacteria 964
300 Ga0439431_0085186 3300041997 Bacteria 856
301 Ga0439432_023866 3300042006 Bacteria 2012
302 Ga0450920_029847 3300042122 Bacteria 1071
303 Ga0450923_012073 3300042125 Bacteria 1567
304 Ga0495617_057102 3300046452 Bacteria 1294
305 Ga0495627_070163 3300046453 Bacteria 1025
306 Ga0495638_0051177 3300046460 Bacteria 2577
307 Ga0495650_0041533 3300046471 Bacteria 1966
308 Ga0495605_0037125 3300046474 Bacteria 2453
309 Ga0495664_0521232 3300046477 Bacteria 709
310 Ga0495584_0150149 3300046491 Bacteria 1184
311 Ga0495585_0210906 3300046492 Bacteria 984
312 Ga0495596_0168171 3300046500 Bacteria 852
313 Ga0495607_0131841 3300046501 Bacteria 1299
314 Ga0495583_0050550 3300046506 Bacteria 1899
315 Ga0495583_0052252 3300046506 Bacteria 1860
316 Ga0495583_0054461 3300046506 Bacteria 1811
317 Ga0495606_0062227 3300046507 Bacteria 2383
318 Ga0495606_0092616 3300046507 Bacteria 1856
319 Ga0495606_0337178 3300046507 Bacteria 805
320 Ga0495610_0002597 3300046512 Bacteria 14977
321 Ga0495610_0038438 3300046512 Bacteria 2429
322 Ga0495620_0016883 3300046515 Bacteria 3651
323 Ga0495620_0019875 3300046515 Bacteria 3290
324 Ga0495620_0049658 3300046515 Bacteria 1794
325 Ga0495631_0001859 3300046518 Bacteria 12472
326 Ga0495631_0237934 3300046518 Bacteria 776
327 Ga0495632_0051998 3300046519 Bacteria 2015
328 Ga0495632_0205869 3300046519 Bacteria 894
329 Ga0495643_0063995 3300046522 Bacteria 1944
330 Ga0495643_0069570 3300046522 Bacteria 1849
331 Ga0495643_0083782 3300046522 Bacteria 1655
332 Ga0495648_0078976 3300046524 Bacteria 1880
333 Ga0495648_0237044 3300046524 Bacteria 889
334 Ga0495652_0429806 3300046529 Bacteria 929
335 Ga0495654_0114381 3300046530 Bacteria 1228
336 Ga0495609_0012502 3300046538 Bacteria 4027
337 Ga0495597_0062015 3300046542 Bacteria 1627
338 Ga0495645_0221100 3300046543 Bacteria 1274
339 Ga0495633_0037169 3300046558 Bacteria 2330
340 Ga0495611_0022113 3300046648 Bacteria 2750
341 Ga0495625_0029614 3300046660 Bacteria 4091
342 Ga0495625_0453772 3300046660 Bacteria 791
343 Ga0495625_0528743 3300046660 Bacteria 717
344 Ga0495625_0751316 3300046660 Bacteria 571
345 Ga0495635_0163203 3300046663 Bacteria 1516
346 Ga0495659_0133795 3300046664 Bacteria 985
347 Ga0495670_0013208 3300046691 Bacteria 4062
348 Ga0495670_0028226 3300046691 Bacteria 2782
349 Ga0495671_0233430 3300046692 Bacteria 889
350 Ga0495671_0411444 3300046692 Bacteria 647
351 Ga0495660_0100952 3300046810 Bacteria 1485
352 Ga0495604_0520353 3300047317 Bacteria 770
353 Ga0495636_0083962 3300047318 Bacteria 1375
354 Ga0495674_0207536 3300047319 Bacteria 1624
355 Ga0495672_0063095 3300047320 Bacteria 2128
356 Ga0495683_0120848 3300047323 Bacteria 1243
357 Ga0495687_102180 3300047443 Bacteria 1073
358 Ga0495675_0470589 3300047444 Bacteria 725
359 Ga0495673_0104998 3300047469 Bacteria 1137
360 Ga0495673_0225322 3300047469 Bacteria 692
361 Ga0495681_0088867 3300047470 Bacteria 1367
362 Ga0495686_0035155 3300047472 Bacteria 3223
363 Ga0495686_0039215 3300047472 Bacteria 3026
364 Ga0495615_0032759 3300048090 Bacteria 1255
365 Ga0495626_0144810 3300048091 Bacteria 1005
366 Ga0496101_0040152 3300048904 Bacteria 3332
367 Ga0496101_0061585 3300048904 Bacteria 2726
368 Ga0496101_0657113 3300048904 Bacteria 828
369 Ga0496102_0161327 3300048905 Bacteria 2109
370 Ga0496103_0146964 3300048906 Bacteria 1509
371 Ga0496104_0017656 3300048907 Bacteria 6503
372 Ga0496104_0035286 3300048907 Bacteria 4670
373 Ga0496105_0002552 3300048908 Bacteria 13213
374 Ga0496105_0388388 3300048908 Bacteria 1110
375 Ga0496106_0059539 3300048909 Bacteria 2893
376 Ga0496106_0236866 3300048909 Bacteria 1458
377 Ga0496106_0741126 3300048909 Bacteria 781
378 Ga0496107_0099059 3300048910 Bacteria 2135
379 Ga0496108_0154143 3300048911 Bacteria 1983
380 Ga0496108_0478376 3300048911 Bacteria 1088
381 Ga0496108_1403551 3300048911 Bacteria 584
382 Ga0496109_0020836 3300048912 Bacteria 5793
383 Ga0496109_0046632 3300048912 Bacteria 3937
384 Ga0496109_0051984 3300048912 Bacteria 3733
385 Ga0496110_0082721 3300048913 Bacteria 2863
386 Ga0496111_0213519 3300048914 Bacteria 1433
387 Ga0496112_0068188 3300048915 Bacteria 3512
388 Ga0496112_0132345 3300048915 Bacteria 2465
389 Ga0496113_1207262 3300048916 Bacteria 590
390 Ga0496114_0737440 3300048917 Bacteria 862
391 Ga0496114_1009851 3300048917 Bacteria 715
392 Ga0496115_0339802 3300048918 Bacteria 1225
393 Ga0496115_0523947 3300048918 Bacteria 950
394 Ga0496116_0004280 3300048919 Bacteria 13687
395 Ga0496116_0046812 3300048919 Bacteria 2916
396 Ga0496116_0249122 3300048919 Bacteria 885
397 Ga0496117_0236272 3300048920 Bacteria 1006
398 Ga0496118_0004259 3300048921 Bacteria 17116
399 Ga0496118_0030757 3300048921 Bacteria 4469
400 Ga0496118_0074368 3300048921 Bacteria 2429
401 Ga0496118_0234925 3300048921 Bacteria 1054
402 Ga0496119_0085907 3300048922 Bacteria 1800
403 Ga0496119_0133296 3300048922 Bacteria 1351
404 Ga0496119_0152870 3300048922 Bacteria 1235
405 Ga0496120_0164987 3300048923 Bacteria 1101
406 Ga0496121_0020154 3300048924 Bacteria 6620
407 Ga0496121_0150988 3300048924 Bacteria 1709
408 Ga0496122_0054408 3300048925 Bacteria 3007
409 Ga0496122_0096365 3300048925 Bacteria 1995
410 Ga0496123_0053721 3300048926 Bacteria 2660
411 Ga0496124_0059610 3300048927 Bacteria 3205
412 Ga0496124_0432963 3300048927 Bacteria 902
413 Ga0496124_0852308 3300048927 Bacteria 558
414 Ga0496125_0005653 3300048928 Bacteria 13797
415 Ga0496125_0108719 3300048928 Bacteria 2016
416 Ga0496126_0009461 3300048929 Bacteria 10344
417 Ga0496126_0302079 3300048929 Bacteria 1320
418 Ga0496126_0632440 3300048929 Bacteria 839
419 Ga0495678_018645 3300049459 Bacteria 3115
420 Ga0495678_105214 3300049459 Bacteria 972
421 Ga0495678_110088 3300049459 Bacteria 940
422 Ga0501031_0113989 3300049568 Bacteria 1765
423 Ga0501032_0000001 3300049569 Bacteria 422097
424 Ga0501032_0025474 3300049569 Bacteria 4077
425 Ga0501032_0100662 3300049569 Bacteria 1915
426 Ga0501032_0111392 3300049569 Bacteria 1811
427 Ga0501032_0595506 3300049569 Bacteria 703
428 Ga0501033_0000077 3300049570 Bacteria 92696
429 Ga0501033_0000518 3300049570 Bacteria 36156
430 Ga0501033_0024123 3300049570 Bacteria 4590
431 Ga0501034_0000023 3300049571 Bacteria 263892
432 Ga0501034_0093609 3300049571 Bacteria 3001
433 Ga0501034_0132612 3300049571 Bacteria 2474
434 Ga0501034_0632150 3300049571 Bacteria 973
435 Ga0501034_0952595 3300049571 Bacteria 744
436 Ga0501034_1012336 3300049571 Bacteria 714
437 Ga0501036_0002867 3300049572 Bacteria 13677
438 Ga0501036_0029398 3300049572 Bacteria 4642
439 Ga0501036_0131873 3300049572 Bacteria 2109
440 Ga0501036_0183137 3300049572 Bacteria 1763
441 Ga0501036_0630825 3300049572 Bacteria 888
442 Ga0501037_0002051 3300049573 Bacteria 14606
443 Ga0501037_0014865 3300049573 Bacteria 5726
444 Ga0501037_0097077 3300049573 Bacteria 2129
445 Ga0501037_0373107 3300049573 Bacteria 981
446 Ga0501038_0000043 3300049574 Bacteria 113010
447 Ga0501038_0018994 3300049574 Bacteria 6202
448 Ga0501038_0020653 3300049574 Bacteria 5919
449 Ga0501039_0000022 3300049575 Bacteria 160858
450 Ga0501039_0020733 3300049575 Bacteria 5036
451 Ga0501039_0144559 3300049575 Bacteria 1869
452 Ga0501039_0454066 3300049575 Bacteria 1006
453 Ga0501041_0248110 3300049577 Bacteria 1119
454 Ga0501042_0021056 3300049578 Bacteria 4541
455 Ga0501042_0311365 3300049578 Bacteria 1137
456 Ga0501043_0000019 3300049579 Bacteria 155347
457 Ga0501043_0037611 3300049579 Bacteria 3806
458 Ga0501043_0194651 3300049579 Bacteria 1575
459 Ga0501043_0209713 3300049579 Bacteria 1510
460 Ga0501043_0684467 3300049579 Bacteria 750
461 Ga0501046_0040118 3300049580 Bacteria 3743
462 Ga0501046_0238214 3300049580 Bacteria 1343
463 Ga0501046_0376233 3300049580 Bacteria 1028
464 Ga0501047_0019478 3300049581 Bacteria 6508
465 Ga0501047_0078900 3300049581 Bacteria 3166
466 Ga0501047_0147286 3300049581 Bacteria 2231
467 Ga0501047_0180021 3300049581 Bacteria 1980
468 Ga0501047_0216666 3300049581 Bacteria 1771
469 Ga0501047_0433300 3300049581 Bacteria 1145
470 Ga0501047_0894714 3300049581 Bacteria 701
471 Ga0501048_0716458 3300049582 Bacteria 718
472 Ga0501067_0012240 3300049583 Bacteria 4754
473 Ga0501067_0188315 3300049583 Bacteria 1149
474 Ga0501068_0130403 3300049584 Bacteria 1572
475 Ga0501068_0136506 3300049584 Bacteria 1536
476 Ga0501068_0219532 3300049584 Bacteria 1208
477 Ga0501069_0004912 3300049585 Bacteria 6928
478 Ga0501069_0185149 3300049585 Bacteria 1204
479 Ga0501070_0009601 3300049586 Bacteria 8172
480 Ga0501070_0026104 3300049586 Bacteria 4901
481 Ga0501070_0626926 3300049586 Bacteria 855
482 Ga0501070_0975296 3300049586 Bacteria 658
483 Ga0501071_0032969 3300049587 Bacteria 3681
484 Ga0501072_0184710 3300049588 Bacteria 1663
485 Ga0501072_0202567 3300049588 Bacteria 1582
486 Ga0501073_0033221 3300049589 Bacteria 3674
487 Ga0501073_0107021 3300049589 Bacteria 1940
488 Ga0501074_0015342 3300049590 Bacteria 5568
489 Ga0501074_0087925 3300049590 Bacteria 2225
490 Ga0501076_1463652 3300049592 Bacteria 561
491 Ga0501227_140501 3300049665 Bacteria 662
492 Ga0501080_0015238 3300049742 Bacteria 7085
493 Ga0501080_0034931 3300049742 Bacteria 4694
494 Ga0501080_0176011 3300049742 Bacteria 1971
495 Ga0501083_0011274 3300049744 Bacteria 6271
496 Ga0501083_0016060 3300049744 Bacteria 5243
497 Ga0501083_0040593 3300049744 Bacteria 3158
498 Ga0501083_0058721 3300049744 Bacteria 2574
499 Ga0501083_0134395 3300049744 Bacteria 1621
500 Ga0501035_0000316 3300049822 Bacteria 55833
501 Ga0501035_0000997 3300049822 Bacteria 29896
502 Ga0501035_0060569 3300049822 Bacteria 3369
503 Ga0501035_0201336 3300049822 Bacteria 1707
504 Ga0501035_0252485 3300049822 Bacteria 1497
505 Ga0501035_0313930 3300049822 Bacteria 1318
506 Ga0501035_1264024 3300049822 Bacteria 570
507 Ga0501044_0041587 3300049823 Bacteria 4785
508 Ga0501044_0044139 3300049823 Bacteria 4629
509 Ga0501044_0051525 3300049823 Bacteria 4243
510 Ga0501044_0066428 3300049823 Bacteria 3677
511 Ga0501044_0096226 3300049823 Bacteria 2982
512 Ga0501044_0851816 3300049823 Bacteria 788
513 Ga0501044_0954393 3300049823 Bacteria 730
514 Ga0501045_0013385 3300049824 Bacteria 5793
515 Ga0501045_0386405 3300049824 Bacteria 1042
516 nmdc:mga03683_49273_c1 3300050489 Bacteria 1753
517 nmdc:mga03683_80981_c1 3300050489 Bacteria 1402
518 nmdc:mga03n38_130743_c1 3300050490 Bacteria 1244
519 nmdc:mga03n38_131231_c1 3300050490 Bacteria 1242
520 nmdc:mga00v17_147288_c1 3300050491 Bacteria 1511
521 nmdc:mga00v17_302357_c1 3300050491 Bacteria 1039
522 nmdc:mga0yw44_105992_c1 3300050492 Bacteria 1796
523 nmdc:mga0yw44_285429_c1 3300050492 Bacteria 1104
524 nmdc:mga0yw44_445410_c1 3300050492 Bacteria 877
525 nmdc:mga0yw44_91916_c1 3300050492 Bacteria 1920
526 nmdc:mga0k408_135325_c1 3300050493 Bacteria 1464
527 nmdc:mga06z11_293298_c1 3300050494 Bacteria 966
528 nmdc:mga06z11_298204_c1 3300050494 Bacteria 958
529 nmdc:mga06z11_471459_c1 3300050494 Bacteria 760
530 nmdc:mga06z11_529759_c1 3300050494 Bacteria 715
531 nmdc:mga04h51_171203_c1 3300050495 Bacteria 841
532 nmdc:mga04h51_50484_c1 3300050495 Bacteria 1394
533 nmdc:mga04h51_516155_c1 3300050495 Bacteria 512
534 nmdc:mga04h51_56565_c1 3300050495 Bacteria 1332
535 nmdc:mga07m45_101697_c1 3300050496 Bacteria 1650
536 nmdc:mga07m45_102547_c1 3300050496 Bacteria 1644
537 nmdc:mga07m45_14866_c1 3300050496 Bacteria 4155
538 nmdc:mga07m45_95795_c1 3300050496 Bacteria 1703
539 nmdc:mga09592_51612_c1 3300050508 Bacteria 3470
540 nmdc:mga0qj67_234958_c1 3300050509 Bacteria 1487
541 nmdc:mga0qj67_610590_c1 3300050509 Bacteria 872
542 nmdc:mga06r32_18149_c1 3300050510 Bacteria 6437
543 nmdc:mga06r32_906483_c1 3300050510 Bacteria 838
544 nmdc:mga0sz30_124127_c1 3300050516 Bacteria 1135
545 nmdc:mga0sz30_28305_c1 3300050516 Bacteria 1607
546 nmdc:mga0sz30_32740_c1 3300050516 Bacteria 2157
547 nmdc:mga0sz30_63064_c1 3300050516 Bacteria 1586
548 Ga0495601_0088815 3300053077 Bacteria 1987
549 Ga0495595_0059070 3300053084 Bacteria 1792
550 Ga0495619_0056591 3300053085 Bacteria 2600
551 Ga0500578_0143727 3300053086 Bacteria 1490
552 Ga0500650_0158611 3300053098 Bacteria 1044
553 Ga0500562_023027 3300053108 Bacteria 1625
554 Ga0500569_007712 3300053109 Bacteria 2428
555 Ga0500594_0009824 3300053118 Bacteria 2210
556 Ga0500608_101911 3300053122 Bacteria 1329
557 Ga0500642_0423300 3300053130 Bacteria 577
558 Ga0500658_0008278 3300053134 Bacteria 3842
559 Ga0500568_0001609 3300053139 Bacteria 14286
560 Ga0500568_0190088 3300053139 Bacteria 754
561 Ga0500577_0236841 3300053142 Bacteria 792
562 Ga0500588_0143308 3300053146 Bacteria 860
563 Ga0500616_0047391 3300053153 Bacteria 2282
564 Ga0500616_0051370 3300053153 Bacteria 2172
565 Ga0500616_0082737 3300053153 Bacteria 1609
566 Ga0500622_0001966 3300053156 Bacteria 15471
567 Ga0500611_043715 3300053727 Bacteria 996
568 Ga0501084_0540501 3300054114 Bacteria 985
569 Ga0501084_1039140 3300054114 Bacteria 688
570 Ga0587070_135389 3300059491 Bacteria 604
571 Ga0587073_0088647 3300059492 Bacteria 782
572 Ga0587080_019117 3300059503 Bacteria 1106
573 Ga0587083_0018824 3300059505 Bacteria 1254
574 Ga0587088_051021 3300059508 Bacteria 810
575 Ga0587090_041206 3300059510 Bacteria 813
576 Ga0587092_104135 3300059512 Bacteria 588
577 Ga0587106_165529 3300059605 Bacteria 501
578 Ga0587068_022656 3300059641 Bacteria 1042
579 Ga0587071_022486 3300060344 Bacteria 1164
580 Ga0587111_0119265 3300060346 Bacteria 678
581 Ga0587111_0146678 3300060346 Bacteria 630
582 Ga0501082_0025124 3300060353 Bacteria 5133
583 Ga0501082_0037839 3300060353 Bacteria 4161
584 Ga0501082_0055900 3300060353 Bacteria 3399
585 Ga0501082_0315421 3300060353 Bacteria 1362
586 Ga0501082_0884503 3300060353 Bacteria 781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917030 2511198235 126
2 iso_pu_bacteria 2582581298 2585223862 126
3 iso_pu_bacteria 2585427529 2585549085 126
4 3300048917 Ga0496114_1009851 Ga0496114_1009851_225_629 127
5 3300041404 Ga0439436_0220862 Ga0439436_0220862_94_492 128
6 3300050510 nmdc:mga06r32_906483_c1 nmdc:mga06r32_906483_c1_83_487 128
7 3300006038 Ga0075365_10336995 Ga0075365_103369952 129
8 3300006042 Ga0075368_10045362 Ga0075368_100453623 129
9 3300006048 Ga0075363_100097577 Ga0075363_1000975773 129
10 3300006051 Ga0075364_10180403 Ga0075364_101804033 129
11 3300006178 Ga0075367_10020031 Ga0075367_100200313 129
12 3300006178 Ga0075367_10074474 Ga0075367_100744743 129
13 3300006186 Ga0075369_10109392 Ga0075369_101093922 129
14 3300006195 Ga0075366_10019025 Ga0075366_100190254 129
15 3300014326 Ga0157380_10101899 Ga0157380_101018993 129
16 3300025906 Ga0207699_10576060 Ga0207699_105760601 129
17 3300025915 Ga0207693_10055090 Ga0207693_100550901 129
18 3300025916 Ga0207663_10184124 Ga0207663_101841242 129
19 3300027866 Ga0209813_10060814 Ga0209813_100608142 129
20 3300039447 Ga0436361_0074042 Ga0436361_0074042_3187_3597 129
21 3300041501 Ga0451845_0940612 Ga0451845_0940612_155_571 129
22 3300046491 Ga0495584_0150149 Ga0495584_0150149_315_722 129
23 3300046664 Ga0495659_0133795 Ga0495659_0133795_387_794 129
24 3300048904 Ga0496101_0061585 Ga0496101_0061585_947_1363 129
25 3300048907 Ga0496104_0035286 Ga0496104_0035286_2271_2687 129
26 3300048908 Ga0496105_0388388 Ga0496105_0388388_423_839 129
27 3300048909 Ga0496106_0741126 Ga0496106_0741126_231_647 129
28 3300048911 Ga0496108_0478376 Ga0496108_0478376_64_480 129
29 3300048912 Ga0496109_0051984 Ga0496109_0051984_2108_2524 129
30 3300048915 Ga0496112_0132345 Ga0496112_0132345_1243_1659 129
31 3300048917 Ga0496114_0737440 Ga0496114_0737440_236_652 129
32 3300048918 Ga0496115_0523947 Ga0496115_0523947_149_565 129
33 3300049571 Ga0501034_0132612 Ga0501034_0132612_125_535 129
34 3300049577 Ga0501041_0248110 Ga0501041_0248110_17_418 129
35 3300050490 nmdc:mga03n38_130743_c1 nmdc:mga03n38_130743_c1_711_1118 129
36 3300050492 nmdc:mga0yw44_285429_c1 nmdc:mga0yw44_285429_c1_375_782 129
37 3300050493 nmdc:mga0k408_135325_c1 nmdc:mga0k408_135325_c1_645_1052 129
38 3300050494 nmdc:mga06z11_298204_c1 nmdc:mga06z11_298204_c1_427_834 129
39 3300050495 nmdc:mga04h51_50484_c1 nmdc:mga04h51_50484_c1_384_791 129
40 3300050496 nmdc:mga07m45_14866_c1 nmdc:mga07m45_14866_c1_3474_3881 129
41 3300050509 nmdc:mga0qj67_234958_c1 nmdc:mga0qj67_234958_c1_576_980 129
42 3300002739 JGI25158J39367_1000074 JGI25158J39367_10000749 130
43 3300002773 JGI25152J39213_1008129 JGI25152J39213_10081295 130
44 3300002773 JGI25152J39213_1047966 JGI25152J39213_10479661 130
45 3300002773 JGI25152J39213_1048043 JGI25152J39213_10480431 130
46 3300002774 JGI25150J39212_1008276 JGI25150J39212_10082762 130
47 3300002987 JGI25159J45721_1000262 JGI25159J45721_100026220 130
48 3300003187 JGI25151J46595_10005265 JGI25151J46595_100052654 130
49 3300003215 JGI25153J46596_10019108 JGI25153J46596_100191085 130
50 3300003215 JGI25153J46596_10127183 JGI25153J46596_101271831 130
51 3300003215 JGI25153J46596_10127263 JGI25153J46596_101272631 130
52 3300003354 JGI25160J50197_1023007 JGI25160J50197_10230073 130
53 3300003374 JGI25161J50226_1000137 JGI25161J50226_100013744 130
54 3300003771 Ga0055526_1002794 Ga0055526_100279410 130
55 3300003775 Ga0055524_1005991 Ga0055524_10059912 130
56 3300003781 Ga0055536_1008778 Ga0055536_10087784 130
57 3300003790 Ga0055528_1027613 Ga0055528_10276133 130
58 3300003790 Ga0055528_1036012 Ga0055528_10360121 130
59 3300003792 Ga0055540_1015240 Ga0055540_10152403 130
60 3300003792 Ga0055540_1018131 Ga0055540_10181312 130
61 3300003794 Ga0055531_10014492 Ga0055531_100144923 130
62 3300004625 Ga0055543_1000321 Ga0055543_10003217 130
63 3300005262 Ga0065165_1028090 Ga0065165_10280901 130
64 3300005262 Ga0065165_1141942 Ga0065165_11419421 130
65 3300005331 Ga0070670_100486886 Ga0070670_1004868861 130
66 3300005337 Ga0070682_100211738 Ga0070682_1002117383 130
67 3300005347 Ga0070668_100624455 Ga0070668_1006244551 130
68 3300005548 Ga0070665_100013723 Ga0070665_1000137235 130
69 3300005548 Ga0070665_100118172 Ga0070665_1001181722 130
70 3300006042 Ga0075368_10213366 Ga0075368_102133661 130
71 3300006048 Ga0075363_100458228 Ga0075363_1004582282 130
72 3300006178 Ga0075367_10021315 Ga0075367_100213153 130
73 3300006186 Ga0075369_10027517 Ga0075369_100275173 130
74 3300006195 Ga0075366_10072620 Ga0075366_100726204 130
75 3300006353 Ga0075370_10092194 Ga0075370_100921944 130
76 3300006946 Ga0079104_1008512 Ga0079104_10085122 130
77 3300006948 Ga0099826_10030104 Ga0099826_100301045 130
78 3300009036 Ga0105244_10164819 Ga0105244_101648193 130
79 3300009098 Ga0105245_11663788 Ga0105245_116637882 130
80 3300009148 Ga0105243_10018422 Ga0105243_100184223 130
81 3300012497 Ga0157319_1003163 Ga0157319_10031631 130
82 3300012513 Ga0157326_1022789 Ga0157326_10227891 130
83 3300013100 Ga0157373_10007612 Ga0157373_100076123 130
84 3300013104 Ga0157370_10302579 Ga0157370_103025793 130
85 3300013105 Ga0157369_12672092 Ga0157369_126720922 130
86 3300013308 Ga0157375_11096275 Ga0157375_110962752 130
87 3300014968 Ga0157379_11810046 Ga0157379_118100461 130
88 3300025208 Ga0209436_100299 Ga0209436_10029919 130
89 3300025245 Ga0207425_1001864 Ga0207425_10018647 130
90 3300025245 Ga0207425_1013468 Ga0207425_10134683 130
91 3300025258 Ga0209129_1002128 Ga0209129_10021287 130
92 3300025258 Ga0209129_1007959 Ga0209129_10079591 130
93 3300025273 Ga0209673_1016194 Ga0209673_10161943 130
94 3300025284 Ga0209130_1000009 Ga0209130_1000009327 130
95 3300025294 Ga0209025_1017322 Ga0209025_10173223 130
96 3300025294 Ga0209025_1083880 Ga0209025_10838802 130
97 3300025295 Ga0209564_1006046 Ga0209564_10060465 130
98 3300025297 Ga0209758_1005244 Ga0209758_10052447 130
99 3300025297 Ga0209758_1012770 Ga0209758_10127701 130
100 3300025299 Ga0209256_1002153 Ga0209256_100215312 130
101 3300025302 Ga0207426_1000041 Ga0207426_1000041265 130
102 3300025303 Ga0209051_1013102 Ga0209051_10131025 130
103 3300025972 Ga0207668_10569945 Ga0207668_105699452 130
104 3300028379 Ga0268266_10148689 Ga0268266_101486893 130
105 3300028563 Ga0265319_1270635 Ga0265319_12706351 130
106 3300031247 Ga0265340_10467940 Ga0265340_104679401 130
107 3300041413 Ga0439465_0253293 Ga0439465_0253293_186_578 130
108 3300042125 Ga0450923_012073 Ga0450923_012073_49_462 130
109 3300046506 Ga0495583_0054461 Ga0495583_0054461_508_900 130
110 3300046507 Ga0495606_0337178 Ga0495606_0337178_263_655 130
111 3300046512 Ga0495610_0038438 Ga0495610_0038438_1241_1633 130
112 3300046522 Ga0495643_0083782 Ga0495643_0083782_507_899 130
113 3300046692 Ga0495671_0233430 Ga0495671_0233430_61_453 130
114 3300048905 Ga0496102_0161327 Ga0496102_0161327_484_876 130
115 3300048909 Ga0496106_0236866 Ga0496106_0236866_88_525 130
116 3300048919 Ga0496116_0046812 Ga0496116_0046812_853_1245 130
117 3300048921 Ga0496118_0074368 Ga0496118_0074368_1474_1923 130
118 3300048921 Ga0496118_0234925 Ga0496118_0234925_314_706 130
119 3300048922 Ga0496119_0152870 Ga0496119_0152870_677_1114 130
120 3300048924 Ga0496121_0020154 Ga0496121_0020154_4199_4636 130
121 3300048925 Ga0496122_0096365 Ga0496122_0096365_684_1121 130
122 3300048926 Ga0496123_0053721 Ga0496123_0053721_1984_2376 130
123 3300048927 Ga0496124_0059610 Ga0496124_0059610_1246_1638 130
124 3300048927 Ga0496124_0852308 Ga0496124_0852308_115_507 130
125 3300048928 Ga0496125_0108719 Ga0496125_0108719_1160_1552 130
126 3300048929 Ga0496126_0009461 Ga0496126_0009461_8319_8711 130
127 3300048929 Ga0496126_0632440 Ga0496126_0632440_264_701 130
128 3300049568 Ga0501031_0113989 Ga0501031_0113989_1318_1728 130
129 3300049569 Ga0501032_0000001 Ga0501032_0000001_26514_26924 130
130 3300049569 Ga0501032_0111392 Ga0501032_0111392_1337_1729 130
131 3300049569 Ga0501032_0595506 Ga0501032_0595506_152_550 130
132 3300049570 Ga0501033_0000077 Ga0501033_0000077_53090_53500 130
133 3300049570 Ga0501033_0000518 Ga0501033_0000518_7771_8232 130
134 3300049571 Ga0501034_0000023 Ga0501034_0000023_120166_120576 130
135 3300049571 Ga0501034_0093609 Ga0501034_0093609_202_600 130
136 3300049571 Ga0501034_0632150 Ga0501034_0632150_377_775 130
137 3300049571 Ga0501034_1012336 Ga0501034_1012336_92_490 130
138 3300049572 Ga0501036_0002867 Ga0501036_0002867_3755_4165 130
139 3300049572 Ga0501036_0131873 Ga0501036_0131873_1496_1894 130
140 3300049573 Ga0501037_0002051 Ga0501037_0002051_10929_11339 130
141 3300049573 Ga0501037_0097077 Ga0501037_0097077_1334_1732 130
142 3300049573 Ga0501037_0373107 Ga0501037_0373107_503_901 130
143 3300049574 Ga0501038_0000043 Ga0501038_0000043_22267_22677 130
144 3300049574 Ga0501038_0018994 Ga0501038_0018994_5637_6035 130
145 3300049575 Ga0501039_0000022 Ga0501039_0000022_151637_152047 130
146 3300049575 Ga0501039_0144559 Ga0501039_0144559_73_471 130
147 3300049575 Ga0501039_0454066 Ga0501039_0454066_191_589 130
148 3300049578 Ga0501042_0311365 Ga0501042_0311365_682_1092 130
149 3300049579 Ga0501043_0000019 Ga0501043_0000019_21794_22204 130
150 3300049579 Ga0501043_0209713 Ga0501043_0209713_404_802 130
151 3300049580 Ga0501046_0040118 Ga0501046_0040118_2758_3168 130
152 3300049580 Ga0501046_0238214 Ga0501046_0238214_421_813 130
153 3300049581 Ga0501047_0147286 Ga0501047_0147286_1248_1646 130
154 3300049581 Ga0501047_0180021 Ga0501047_0180021_1421_1819 130
155 3300049581 Ga0501047_0433300 Ga0501047_0433300_496_906 130
156 3300049583 Ga0501067_0188315 Ga0501067_0188315_170_568 130
157 3300049584 Ga0501068_0136506 Ga0501068_0136506_1025_1423 130
158 3300049584 Ga0501068_0219532 Ga0501068_0219532_790_1182 130
159 3300049585 Ga0501069_0185149 Ga0501069_0185149_161_559 130
160 3300049586 Ga0501070_0009601 Ga0501070_0009601_7630_8028 130
161 3300049586 Ga0501070_0626926 Ga0501070_0626926_300_698 130
162 3300049588 Ga0501072_0202567 Ga0501072_0202567_183_581 130
163 3300049589 Ga0501073_0107021 Ga0501073_0107021_1379_1777 130
164 3300049590 Ga0501074_0087925 Ga0501074_0087925_1250_1648 130
165 3300049742 Ga0501080_0015238 Ga0501080_0015238_6246_6644 130
166 3300049744 Ga0501083_0040593 Ga0501083_0040593_1526_1918 130
167 3300049744 Ga0501083_0058721 Ga0501083_0058721_698_1093 130
168 3300049744 Ga0501083_0134395 Ga0501083_0134395_798_1193 130
169 3300049822 Ga0501035_0000316 Ga0501035_0000316_26740_27201 130
170 3300049822 Ga0501035_0000997 Ga0501035_0000997_28051_28461 130
171 3300049822 Ga0501035_0313930 Ga0501035_0313930_828_1226 130
172 3300049822 Ga0501035_1264024 Ga0501035_1264024_27_425 130
173 3300049823 Ga0501044_0044139 Ga0501044_0044139_3196_3606 130
174 3300049823 Ga0501044_0051525 Ga0501044_0051525_133_531 130
175 3300049823 Ga0501044_0851816 Ga0501044_0851816_254_652 130
176 3300049823 Ga0501044_0954393 Ga0501044_0954393_26_424 130
177 3300050491 nmdc:mga00v17_147288_c1 nmdc:mga00v17_147288_c1_786_1235 130
178 3300050516 nmdc:mga0sz30_32740_c1 nmdc:mga0sz30_32740_c1_697_1089 130
179 3300053139 Ga0500568_0190088 Ga0500568_0190088_332_724 130
180 3300053156 Ga0500622_0001966 Ga0500622_0001966_1249_1641 130
181 3300053727 Ga0500611_043715 Ga0500611_043715_568_963 130
182 3300054114 Ga0501084_1039140 Ga0501084_1039140_225_620 130
183 3300059508 Ga0587088_051021 Ga0587088_051021_63_455 130
184 3300059605 Ga0587106_165529 Ga0587106_165529_32_424 130
185 3300060353 Ga0501082_0055900 Ga0501082_0055900_2754_3146 130
186 3300060353 Ga0501082_0884503 Ga0501082_0884503_127_525 130
187 3300001989 JGI24739J22299_10108679 JGI24739J22299_101086791 131
188 3300002239 JGI24034J26672_10036575 JGI24034J26672_100365752 131
189 3300002773 JGI25152J39213_1000936 JGI25152J39213_10009363 131
190 3300002773 JGI25152J39213_1003827 JGI25152J39213_10038276 131
191 3300002773 JGI25152J39213_1006916 JGI25152J39213_10069163 131
192 3300002773 JGI25152J39213_1009567 JGI25152J39213_10095673 131
193 3300002774 JGI25150J39212_1000037 JGI25150J39212_100003772 131
194 3300002774 JGI25150J39212_1014880 JGI25150J39212_10148803 131
195 3300003187 JGI25151J46595_10000220 JGI25151J46595_100002203 131
196 3300003187 JGI25151J46595_10001921 JGI25151J46595_1000192113 131
197 3300003215 JGI25153J46596_10020222 JGI25153J46596_100202223 131
198 3300003374 JGI25161J50226_1006204 JGI25161J50226_10062043 131
199 3300003578 Ga0006562J51391_1020867 Ga0006562J51391_10208671 131
200 3300003775 Ga0055524_1003375 Ga0055524_10033755 131
201 3300003775 Ga0055524_1058744 Ga0055524_10587441 131
202 3300003790 Ga0055528_1008866 Ga0055528_10088661 131
203 3300003790 Ga0055528_1084660 Ga0055528_10846601 131
204 3300003790 Ga0055528_1086390 Ga0055528_10863901 131
205 3300003792 Ga0055540_1002204 Ga0055540_10022049 131
206 3300003792 Ga0055540_1104853 Ga0055540_11048531 131
207 3300004625 Ga0055543_1000609 Ga0055543_10006099 131
208 3300005262 Ga0065165_1004116 Ga0065165_10041164 131
209 3300005293 Ga0065715_11157466 Ga0065715_111574661 131
210 3300005328 Ga0070676_10308788 Ga0070676_103087881 131
211 3300005330 Ga0070690_100399077 Ga0070690_1003990772 131
212 3300005333 Ga0070677_10270542 Ga0070677_102705421 131
213 3300005335 Ga0070666_10236991 Ga0070666_102369913 131
214 3300005338 Ga0068868_100169772 Ga0068868_1001697723 131
215 3300005340 Ga0070689_100104713 Ga0070689_1001047133 131
216 3300005347 Ga0070668_100949319 Ga0070668_1009493191 131
217 3300005347 Ga0070668_101108500 Ga0070668_1011085002 131
218 3300005355 Ga0070671_100022749 Ga0070671_1000227497 131
219 3300005355 Ga0070671_100199081 Ga0070671_1001990813 131
220 3300005364 Ga0070673_100150029 Ga0070673_1001500293 131
221 3300005365 Ga0070688_100093224 Ga0070688_1000932243 131
222 3300005367 Ga0070667_100335334 Ga0070667_1003353343 131
223 3300005441 Ga0070700_100569676 Ga0070700_1005696762 131
224 3300005455 Ga0070663_100124679 Ga0070663_1001246793 131
225 3300005459 Ga0068867_100083766 Ga0068867_1000837663 131
226 3300005466 Ga0070685_10401961 Ga0070685_104019611 131
227 3300005543 Ga0070672_100642674 Ga0070672_1006426742 131
228 3300005618 Ga0068864_101358555 Ga0068864_1013585551 131
229 3300005840 Ga0068870_10523834 Ga0068870_105238341 131
230 3300005841 Ga0068863_100450318 Ga0068863_1004503182 131
231 3300005842 Ga0068858_100320791 Ga0068858_1003207912 131
232 3300006038 Ga0075365_10036684 Ga0075365_100366843 131
233 3300006038 Ga0075365_10108551 Ga0075365_101085513 131
234 3300006038 Ga0075365_10580465 Ga0075365_105804652 131
235 3300006042 Ga0075368_10051726 Ga0075368_100517263 131
236 3300006048 Ga0075363_100192490 Ga0075363_1001924903 131
237 3300006048 Ga0075363_100224401 Ga0075363_1002244013 131
238 3300006048 Ga0075363_100309083 Ga0075363_1003090831 131
239 3300006051 Ga0075364_10148567 Ga0075364_101485671 131
240 3300006051 Ga0075364_10205256 Ga0075364_102052562 131
241 3300006051 Ga0075364_10206689 Ga0075364_102066893 131
242 3300006177 Ga0075362_10191263 Ga0075362_101912631 131
243 3300006178 Ga0075367_10010829 Ga0075367_100108293 131
244 3300006178 Ga0075367_10084840 Ga0075367_100848402 131
245 3300006178 Ga0075367_10310886 Ga0075367_103108862 131
246 3300006178 Ga0075367_11124187 Ga0075367_111241871 131
247 3300006178 Ga0075367_11124189 Ga0075367_111241891 131
248 3300006186 Ga0075369_10009506 Ga0075369_100095067 131
249 3300006186 Ga0075369_10144981 Ga0075369_101449813 131
250 3300006186 Ga0075369_10206460 Ga0075369_102064602 131
251 3300006195 Ga0075366_10132505 Ga0075366_101325051 131
252 3300006353 Ga0075370_10079998 Ga0075370_100799982 131
253 3300006353 Ga0075370_10123019 Ga0075370_101230193 131
254 3300006353 Ga0075370_10240308 Ga0075370_102403082 131
255 3300006353 Ga0075370_10268065 Ga0075370_102680653 131
256 3300006844 Ga0075428_100574323 Ga0075428_1005743232 131
257 3300006846 Ga0075430_100564270 Ga0075430_1005642701 131
258 3300006847 Ga0075431_100004192 Ga0075431_1000041927 131
259 3300006880 Ga0075429_100383221 Ga0075429_1003832212 131
260 3300006881 Ga0068865_100013256 Ga0068865_1000132563 131
261 3300006881 Ga0068865_100445476 Ga0068865_1004454762 131
262 3300009094 Ga0111539_11129439 Ga0111539_111294392 131
263 3300009147 Ga0114129_11013046 Ga0114129_110130462 131
264 3300009148 Ga0105243_10289378 Ga0105243_102893783 131
265 3300009176 Ga0105242_10425634 Ga0105242_104256342 131
266 3300009177 Ga0105248_10019080 Ga0105248_100190803 131
267 3300009177 Ga0105248_10051665 Ga0105248_100516656 131
268 3300009177 Ga0105248_10097131 Ga0105248_100971314 131
269 3300009553 Ga0105249_10188760 Ga0105249_101887603 131
270 3300009553 Ga0105249_10906165 Ga0105249_109061652 131
271 3300009765 Ga0123341_1000009 Ga0123341_100000920 131
272 3300009765 Ga0123341_1073508 Ga0123341_10735083 131
273 3300009766 Ga0123342_1015560 Ga0123342_10155608 131
274 3300009766 Ga0123342_1037816 Ga0123342_10378161 131
275 3300010375 Ga0105239_10281926 Ga0105239_102819262 131
276 3300011119 Ga0105246_10145766 Ga0105246_101457663 131
277 3300012490 Ga0157322_1010465 Ga0157322_10104652 131
278 3300013100 Ga0157373_10395052 Ga0157373_103950521 131
279 3300013308 Ga0157375_10133840 Ga0157375_101338404 131
280 3300014325 Ga0163163_10126457 Ga0163163_101264573 131
281 3300014325 Ga0163163_10941558 Ga0163163_109415581 131
282 3300014968 Ga0157379_10629323 Ga0157379_106293232 131
283 3300017792 Ga0163161_10098119 Ga0163161_100981192 131
284 3300025245 Ga0207425_1000034 Ga0207425_100003471 131
285 3300025245 Ga0207425_1005340 Ga0207425_10053404 131
286 3300025258 Ga0209129_1000094 Ga0209129_100009416 131
287 3300025258 Ga0209129_1002500 Ga0209129_10025009 131
288 3300025258 Ga0209129_1020837 Ga0209129_10208372 131
289 3300025263 Ga0209565_1042042 Ga0209565_10420422 131
290 3300025273 Ga0209673_1000052 Ga0209673_100005268 131
291 3300025273 Ga0209673_1000459 Ga0209673_10004599 131
292 3300025273 Ga0209673_1002893 Ga0209673_10028936 131
293 3300025273 Ga0209673_1010831 Ga0209673_10108314 131
294 3300025291 Ga0209675_1035903 Ga0209675_10359032 131
295 3300025292 Ga0209676_1024551 Ga0209676_10245512 131
296 3300025294 Ga0209025_1000533 Ga0209025_10005336 131
297 3300025294 Ga0209025_1001035 Ga0209025_100103541 131
298 3300025294 Ga0209025_1004694 Ga0209025_10046948 131
299 3300025294 Ga0209025_1032055 Ga0209025_10320553 131
300 3300025295 Ga0209564_1000569 Ga0209564_100056951 131
301 3300025295 Ga0209564_1005379 Ga0209564_10053792 131
302 3300025295 Ga0209564_1011522 Ga0209564_10115224 131
303 3300025297 Ga0209758_1000415 Ga0209758_10004156 131
304 3300025297 Ga0209758_1002002 Ga0209758_100200220 131
305 3300025297 Ga0209758_1006541 Ga0209758_100654110 131
306 3300025297 Ga0209758_1056284 Ga0209758_10562843 131
307 3300025299 Ga0209256_1003192 Ga0209256_100319211 131
308 3300025299 Ga0209256_1010657 Ga0209256_10106574 131
309 3300025299 Ga0209256_1035927 Ga0209256_10359271 131
310 3300025302 Ga0207426_1000595 Ga0207426_100059519 131
311 3300025302 Ga0207426_1000723 Ga0207426_100072319 131
312 3300025303 Ga0209051_1000561 Ga0209051_100056114 131
313 3300025303 Ga0209051_1013239 Ga0209051_10132394 131
314 3300025303 Ga0209051_1014030 Ga0209051_10140305 131
315 3300025304 Ga0209257_1003339 Ga0209257_100333911 131
316 3300025304 Ga0209257_1113897 Ga0209257_11138971 131
317 3300025735 Ga0207713_1143688 Ga0207713_11436882 131
318 3300025901 Ga0207688_10074121 Ga0207688_100741212 131
319 3300025904 Ga0207647_10380707 Ga0207647_103807072 131
320 3300025907 Ga0207645_10173479 Ga0207645_101734791 131
321 3300025908 Ga0207643_10176338 Ga0207643_101763383 131
322 3300025914 Ga0207671_10144770 Ga0207671_101447703 131
323 3300025931 Ga0207644_10126493 Ga0207644_101264933 131
324 3300025931 Ga0207644_10268503 Ga0207644_102685032 131
325 3300025934 Ga0207686_10242058 Ga0207686_102420582 131
326 3300025935 Ga0207709_10052906 Ga0207709_100529063 131
327 3300025936 Ga0207670_10080457 Ga0207670_100804573 131
328 3300025937 Ga0207669_10015374 Ga0207669_100153743 131
329 3300025940 Ga0207691_10565622 Ga0207691_105656222 131
330 3300025941 Ga0207711_10086222 Ga0207711_100862223 131
331 3300025941 Ga0207711_10544747 Ga0207711_105447472 131
332 3300025960 Ga0207651_10221568 Ga0207651_102215681 131
333 3300025972 Ga0207668_10031492 Ga0207668_100314921 131
334 3300025972 Ga0207668_10318406 Ga0207668_103184062 131
335 3300025986 Ga0207658_10845857 Ga0207658_108458572 131
336 3300026067 Ga0207678_10099898 Ga0207678_100998983 131
337 3300026067 Ga0207678_10227704 Ga0207678_102277043 131
338 3300026067 Ga0207678_11582696 Ga0207678_115826961 131
339 3300026089 Ga0207648_10071399 Ga0207648_100713993 131
340 3300026118 Ga0207675_100446088 Ga0207675_1004460882 131
341 3300026121 Ga0207683_10261257 Ga0207683_102612572 131
342 3300027312 Ga0209371_1077771 Ga0209371_10777711 131
343 3300027866 Ga0209813_10147959 Ga0209813_101479592 131
344 3300028379 Ga0268266_11138166 Ga0268266_111381662 131
345 3300028379 Ga0268266_11376941 Ga0268266_113769412 131
346 3300028380 Ga0268265_10104189 Ga0268265_101041892 131
347 3300028794 Ga0307515_10000377 Ga0307515_1000037729 131
348 3300031456 Ga0307513_10001888 Ga0307513_1000188823 131
349 3300031712 Ga0265342_10323547 Ga0265342_103235471 131
350 3300031731 Ga0307405_10011182 Ga0307405_100111821 131
351 3300031911 Ga0307412_10077356 Ga0307412_100773563 131
352 3300034816 Ga0373930_0009261 Ga0373930_0009261_951_1370 131
353 3300034820 Ga0373959_0011942 Ga0373959_0011942_580_999 131
354 3300035085 Ga0373929_0009398 Ga0373929_0009398_495_914 131
355 3300035091 Ga0373951_0006615 Ga0373951_0006615_57_473 131
356 3300035112 Ga0373932_0017412 Ga0373932_0017412_845_1264 131
357 3300035114 Ga0373939_0202558 Ga0373939_0202558_130_549 131
358 3300035121 Ga0373960_0055492 Ga0373960_0055492_553_972 131
359 3300035170 Ga0373943_0634149 Ga0373943_0634149_12_431 131
360 3300035241 Ga0373961_0224373 Ga0373961_0224373_226_642 131
361 3300035242 Ga0373962_0026300 Ga0373962_0026300_1075_1494 131
362 3300035691 Ga0373931_0094116 Ga0373931_0094116_910_1326 131
363 3300035691 Ga0373931_0185170 Ga0373931_0185170_33_452 131
364 3300035692 Ga0373935_0031290 Ga0373935_0031290_660_1079 131
365 3300035724 Ga0373933_0521303 Ga0373933_0521303_130_549 131
366 3300035725 Ga0373947_0146575 Ga0373947_0146575_897_1316 131
367 3300036401 Ga0373937_0876017 Ga0373937_0876017_12_431 131
368 3300037068 Ga0373925_0786609 Ga0373925_0786609_73_492 131
369 3300037418 Ga0395900_0000086 Ga0395900_0000086_59679_60101 131
370 3300037466 Ga0395898_0000285 Ga0395898_0000285_111649_112071 131
371 3300037471 Ga0395905_0000133 Ga0395905_0000133_11430_11852 131
372 3300038443 Ga0395901_0000092 Ga0395901_0000092_9906_10328 131
373 3300039438 Ga0436360_0686328 Ga0436360_0686328_62_478 131
374 3300041413 Ga0439465_0088966 Ga0439465_0088966_24_419 131
375 3300041441 Ga0451787_378896 Ga0451787_378896_140_535 131
376 3300041446 Ga0451794_55478 Ga0451794_55478_81_476 131
377 3300041458 Ga0451798_0974414 Ga0451798_0974414_1239_1634 131
378 3300041459 Ga0451800_1470819 Ga0451800_1470819_75_515 131
379 3300041491 Ga0451833_0329526 Ga0451833_0329526_328_768 131
380 3300041492 Ga0451835_0314534 Ga0451835_0314534_1541_1936 131
381 3300041492 Ga0451835_0469899 Ga0451835_0469899_85_480 131
382 3300041494 Ga0451837_0376117 Ga0451837_0376117_306_701 131
383 3300041495 Ga0451838_05673 Ga0451838_05673_77_472 131
384 3300041496 Ga0451839_0967922 Ga0451839_0967922_1553_1948 131
385 3300041496 Ga0451839_0969815 Ga0451839_0969815_328_723 131
386 3300041497 Ga0451840_04176 Ga0451840_04176_1555_1950 131
387 3300041498 Ga0451841_1441855 Ga0451841_1441855_338_778 131
388 3300041499 Ga0451842_0538 Ga0451842_0538_45_485 131
389 3300041501 Ga0451845_0289069 Ga0451845_0289069_595_990 131
390 3300041501 Ga0451845_0293700 Ga0451845_0293700_1809_2204 131
391 3300041502 Ga0451846_27217 Ga0451846_27217_1264_1659 131
392 3300041503 Ga0451847_0429826 Ga0451847_0429826_130_525 131
393 3300041503 Ga0451847_0470876 Ga0451847_0470876_49_489 131
394 3300041505 Ga0451849_0832956 Ga0451849_0832956_96_491 131
395 3300041506 Ga0451850_30014 Ga0451850_30014_32_472 131
396 3300041507 Ga0451851_0866658 Ga0451851_0866658_514_909 131
397 3300041509 Ga0451843_0940602 Ga0451843_0940602_318_713 131
398 3300041510 Ga0451854_30958 Ga0451854_30958_134_529 131
399 3300041511 Ga0451855_1135233 Ga0451855_1135233_49_444 131
400 3300041512 Ga0451853_1760736 Ga0451853_1760736_284_679 131
401 3300041512 Ga0451853_2301802 Ga0451853_2301802_77_472 131
402 3300041907 Ga0452268_50754 Ga0452268_50754_76_471 131
403 3300041916 Ga0452271_63270 Ga0452271_63270_146_541 131
404 3300041997 Ga0439431_0085186 Ga0439431_0085186_225_620 131
405 3300042006 Ga0439432_023866 Ga0439432_023866_43_438 131
406 3300042122 Ga0450920_029847 Ga0450920_029847_472_912 131
407 3300046452 Ga0495617_057102 Ga0495617_057102_687_1142 131
408 3300046453 Ga0495627_070163 Ga0495627_070163_503_991 131
409 3300046460 Ga0495638_0051177 Ga0495638_0051177_1733_2173 131
410 3300046471 Ga0495650_0041533 Ga0495650_0041533_953_1393 131
411 3300046474 Ga0495605_0037125 Ga0495605_0037125_1037_1432 131
412 3300046477 Ga0495664_0521232 Ga0495664_0521232_82_501 131
413 3300046492 Ga0495585_0210906 Ga0495585_0210906_487_882 131
414 3300046500 Ga0495596_0168171 Ga0495596_0168171_162_557 131
415 3300046501 Ga0495607_0131841 Ga0495607_0131841_874_1269 131
416 3300046506 Ga0495583_0050550 Ga0495583_0050550_450_845 131
417 3300046506 Ga0495583_0052252 Ga0495583_0052252_415_870 131
418 3300046507 Ga0495606_0062227 Ga0495606_0062227_1029_1424 131
419 3300046507 Ga0495606_0092616 Ga0495606_0092616_726_1148 131
420 3300046512 Ga0495610_0002597 Ga0495610_0002597_1202_1624 131
421 3300046515 Ga0495620_0016883 Ga0495620_0016883_34_522 131
422 3300046515 Ga0495620_0019875 Ga0495620_0019875_588_983 131
423 3300046515 Ga0495620_0049658 Ga0495620_0049658_562_984 131
424 3300046518 Ga0495631_0001859 Ga0495631_0001859_529_984 131
425 3300046518 Ga0495631_0237934 Ga0495631_0237934_152_547 131
426 3300046519 Ga0495632_0051998 Ga0495632_0051998_1370_1765 131
427 3300046519 Ga0495632_0205869 Ga0495632_0205869_266_688 131
428 3300046522 Ga0495643_0063995 Ga0495643_0063995_1232_1654 131
429 3300046522 Ga0495643_0069570 Ga0495643_0069570_385_780 131
430 3300046524 Ga0495648_0078976 Ga0495648_0078976_1349_1744 131
431 3300046524 Ga0495648_0237044 Ga0495648_0237044_172_567 131
432 3300046529 Ga0495652_0429806 Ga0495652_0429806_179_598 131
433 3300046530 Ga0495654_0114381 Ga0495654_0114381_757_1152 131
434 3300046538 Ga0495609_0012502 Ga0495609_0012502_3260_3715 131
435 3300046542 Ga0495597_0062015 Ga0495597_0062015_381_776 131
436 3300046543 Ga0495645_0221100 Ga0495645_0221100_825_1244 131
437 3300046558 Ga0495633_0037169 Ga0495633_0037169_474_869 131
438 3300046648 Ga0495611_0022113 Ga0495611_0022113_523_978 131
439 3300046660 Ga0495625_0029614 Ga0495625_0029614_439_894 131
440 3300046660 Ga0495625_0453772 Ga0495625_0453772_234_674 131
441 3300046660 Ga0495625_0528743 Ga0495625_0528743_38_460 131
442 3300046660 Ga0495625_0751316 Ga0495625_0751316_162_557 131
443 3300046663 Ga0495635_0163203 Ga0495635_0163203_950_1366 131
444 3300046691 Ga0495670_0013208 Ga0495670_0013208_201_656 131
445 3300046691 Ga0495670_0028226 Ga0495670_0028226_922_1317 131
446 3300046692 Ga0495671_0411444 Ga0495671_0411444_95_517 131
447 3300046810 Ga0495660_0100952 Ga0495660_0100952_134_529 131
448 3300047317 Ga0495604_0520353 Ga0495604_0520353_193_612 131
449 3300047318 Ga0495636_0083962 Ga0495636_0083962_135_530 131
450 3300047319 Ga0495674_0207536 Ga0495674_0207536_530_949 131
451 3300047320 Ga0495672_0063095 Ga0495672_0063095_609_1016 131
452 3300047323 Ga0495683_0120848 Ga0495683_0120848_644_1084 131
453 3300047443 Ga0495687_102180 Ga0495687_102180_311_751 131
454 3300047444 Ga0495675_0470589 Ga0495675_0470589_163_582 131
455 3300047469 Ga0495673_0104998 Ga0495673_0104998_617_1105 131
456 3300047469 Ga0495673_0225322 Ga0495673_0225322_114_536 131
457 3300047470 Ga0495681_0088867 Ga0495681_0088867_781_1176 131
458 3300047472 Ga0495686_0035155 Ga0495686_0035155_1136_1558 131
459 3300047472 Ga0495686_0039215 Ga0495686_0039215_1222_1617 131
460 3300048090 Ga0495615_0032759 Ga0495615_0032759_689_1084 131
461 3300048091 Ga0495626_0144810 Ga0495626_0144810_288_683 131
462 3300048904 Ga0496101_0040152 Ga0496101_0040152_770_1189 131
463 3300048904 Ga0496101_0657113 Ga0496101_0657113_377_772 131
464 3300048906 Ga0496103_0146964 Ga0496103_0146964_345_764 131
465 3300048907 Ga0496104_0017656 Ga0496104_0017656_5418_5837 131
466 3300048908 Ga0496105_0002552 Ga0496105_0002552_12486_12905 131
467 3300048909 Ga0496106_0059539 Ga0496106_0059539_1045_1464 131
468 3300048910 Ga0496107_0099059 Ga0496107_0099059_534_950 131
469 3300048911 Ga0496108_0154143 Ga0496108_0154143_506_925 131
470 3300048911 Ga0496108_1403551 Ga0496108_1403551_148_555 131
471 3300048912 Ga0496109_0020836 Ga0496109_0020836_4751_5170 131
472 3300048912 Ga0496109_0046632 Ga0496109_0046632_1843_2262 131
473 3300048913 Ga0496110_0082721 Ga0496110_0082721_2220_2639 131
474 3300048914 Ga0496111_0213519 Ga0496111_0213519_938_1357 131
475 3300048915 Ga0496112_0068188 Ga0496112_0068188_1353_1772 131
476 3300048916 Ga0496113_1207262 Ga0496113_1207262_80_499 131
477 3300048918 Ga0496115_0339802 Ga0496115_0339802_178_597 131
478 3300048919 Ga0496116_0004280 Ga0496116_0004280_71_514 131
479 3300048919 Ga0496116_0249122 Ga0496116_0249122_91_579 131
480 3300048920 Ga0496117_0236272 Ga0496117_0236272_184_627 131
481 3300048921 Ga0496118_0004259 Ga0496118_0004259_15933_16328 131
482 3300048921 Ga0496118_0030757 Ga0496118_0030757_23_466 131
483 3300048922 Ga0496119_0085907 Ga0496119_0085907_514_957 131
484 3300048922 Ga0496119_0133296 Ga0496119_0133296_259_681 131
485 3300048923 Ga0496120_0164987 Ga0496120_0164987_451_939 131
486 3300048924 Ga0496121_0150988 Ga0496121_0150988_931_1374 131
487 3300048925 Ga0496122_0054408 Ga0496122_0054408_1578_2069 131
488 3300048927 Ga0496124_0432963 Ga0496124_0432963_65_487 131
489 3300048928 Ga0496125_0005653 Ga0496125_0005653_938_1381 131
490 3300048929 Ga0496126_0302079 Ga0496126_0302079_857_1300 131
491 3300049459 Ga0495678_018645 Ga0495678_018645_11_466 131
492 3300049459 Ga0495678_105214 Ga0495678_105214_420_815 131
493 3300049459 Ga0495678_110088 Ga0495678_110088_434_856 131
494 3300049569 Ga0501032_0025474 Ga0501032_0025474_1355_1786 131
495 3300049569 Ga0501032_0100662 Ga0501032_0100662_418_825 131
496 3300049570 Ga0501033_0024123 Ga0501033_0024123_2824_3231 131
497 3300049571 Ga0501034_0952595 Ga0501034_0952595_99_506 131
498 3300049572 Ga0501036_0029398 Ga0501036_0029398_2850_3281 131
499 3300049572 Ga0501036_0183137 Ga0501036_0183137_748_1233 131
500 3300049572 Ga0501036_0630825 Ga0501036_0630825_265_672 131
501 3300049573 Ga0501037_0014865 Ga0501037_0014865_2090_2521 131
502 3300049574 Ga0501038_0020653 Ga0501038_0020653_729_1160 131
503 3300049575 Ga0501039_0020733 Ga0501039_0020733_2854_3285 131
504 3300049578 Ga0501042_0021056 Ga0501042_0021056_2418_2849 131
505 3300049579 Ga0501043_0037611 Ga0501043_0037611_2615_3022 131
506 3300049579 Ga0501043_0194651 Ga0501043_0194651_451_882 131
507 3300049579 Ga0501043_0684467 Ga0501043_0684467_274_714 131
508 3300049580 Ga0501046_0376233 Ga0501046_0376233_545_976 131
509 3300049581 Ga0501047_0019478 Ga0501047_0019478_3709_4140 131
510 3300049581 Ga0501047_0078900 Ga0501047_0078900_1017_1502 131
511 3300049581 Ga0501047_0216666 Ga0501047_0216666_324_731 131
512 3300049581 Ga0501047_0894714 Ga0501047_0894714_65_472 131
513 3300049582 Ga0501048_0716458 Ga0501048_0716458_52_483 131
514 3300049583 Ga0501067_0012240 Ga0501067_0012240_1813_2244 131
515 3300049584 Ga0501068_0130403 Ga0501068_0130403_664_1149 131
516 3300049585 Ga0501069_0004912 Ga0501069_0004912_2136_2567 131
517 3300049586 Ga0501070_0026104 Ga0501070_0026104_545_976 131
518 3300049586 Ga0501070_0975296 Ga0501070_0975296_164_571 131
519 3300049587 Ga0501071_0032969 Ga0501071_0032969_2467_2898 131
520 3300049588 Ga0501072_0184710 Ga0501072_0184710_561_992 131
521 3300049589 Ga0501073_0033221 Ga0501073_0033221_2515_2946 131
522 3300049590 Ga0501074_0015342 Ga0501074_0015342_2491_2922 131
523 3300049592 Ga0501076_1463652 Ga0501076_1463652_47_469 131
524 3300049665 Ga0501227_140501 Ga0501227_140501_168_563 131
525 3300049742 Ga0501080_0034931 Ga0501080_0034931_2216_2647 131
526 3300049742 Ga0501080_0176011 Ga0501080_0176011_1378_1785 131
527 3300049744 Ga0501083_0011274 Ga0501083_0011274_4693_5094 131
528 3300049744 Ga0501083_0016060 Ga0501083_0016060_2658_3089 131
529 3300049822 Ga0501035_0060569 Ga0501035_0060569_2594_3025 131
530 3300049822 Ga0501035_0201336 Ga0501035_0201336_674_1081 131
531 3300049822 Ga0501035_0252485 Ga0501035_0252485_41_436 131
532 3300049823 Ga0501044_0041587 Ga0501044_0041587_1248_1733 131
533 3300049823 Ga0501044_0066428 Ga0501044_0066428_2377_2784 131
534 3300049823 Ga0501044_0096226 Ga0501044_0096226_451_882 131
535 3300049824 Ga0501045_0013385 Ga0501045_0013385_2680_3111 131
536 3300049824 Ga0501045_0386405 Ga0501045_0386405_562_984 131
537 3300050489 nmdc:mga03683_49273_c1 nmdc:mga03683_49273_c1_812_1207 131
538 3300050489 nmdc:mga03683_80981_c1 nmdc:mga03683_80981_c1_477_893 131
539 3300050490 nmdc:mga03n38_131231_c1 nmdc:mga03n38_131231_c1_446_841 131
540 3300050491 nmdc:mga00v17_302357_c1 nmdc:mga00v17_302357_c1_461_856 131
541 3300050492 nmdc:mga0yw44_105992_c1 nmdc:mga0yw44_105992_c1_410_850 131
542 3300050492 nmdc:mga0yw44_445410_c1 nmdc:mga0yw44_445410_c1_190_609 131
543 3300050492 nmdc:mga0yw44_91916_c1 nmdc:mga0yw44_91916_c1_744_1160 131
544 3300050494 nmdc:mga06z11_293298_c1 nmdc:mga06z11_293298_c1_106_522 131
545 3300050494 nmdc:mga06z11_471459_c1 nmdc:mga06z11_471459_c1_328_723 131
546 3300050494 nmdc:mga06z11_529759_c1 nmdc:mga06z11_529759_c1_137_553 131
547 3300050495 nmdc:mga04h51_171203_c1 nmdc:mga04h51_171203_c1_173_589 131
548 3300050495 nmdc:mga04h51_516155_c1 nmdc:mga04h51_516155_c1_38_478 131
549 3300050495 nmdc:mga04h51_56565_c1 nmdc:mga04h51_56565_c1_195_611 131
550 3300050496 nmdc:mga07m45_101697_c1 nmdc:mga07m45_101697_c1_322_738 131
551 3300050496 nmdc:mga07m45_102547_c1 nmdc:mga07m45_102547_c1_150_566 131
552 3300050496 nmdc:mga07m45_95795_c1 nmdc:mga07m45_95795_c1_1218_1613 131
553 3300050508 nmdc:mga09592_51612_c1 nmdc:mga09592_51612_c1_2727_3134 131
554 3300050509 nmdc:mga0qj67_610590_c1 nmdc:mga0qj67_610590_c1_287_694 131
555 3300050510 nmdc:mga06r32_18149_c1 nmdc:mga06r32_18149_c1_5110_5517 131
556 3300050516 nmdc:mga0sz30_124127_c1 nmdc:mga0sz30_124127_c1_362_769 131
557 3300050516 nmdc:mga0sz30_28305_c1 nmdc:mga0sz30_28305_c1_1033_1449 131
558 3300050516 nmdc:mga0sz30_63064_c1 nmdc:mga0sz30_63064_c1_928_1368 131
559 3300053077 Ga0495601_0088815 Ga0495601_0088815_649_1068 131
560 3300053084 Ga0495595_0059070 Ga0495595_0059070_267_686 131
561 3300053085 Ga0495619_0056591 Ga0495619_0056591_253_672 131
562 3300053086 Ga0500578_0143727 Ga0500578_0143727_229_624 131
563 3300053098 Ga0500650_0158611 Ga0500650_0158611_558_974 131
564 3300053108 Ga0500562_023027 Ga0500562_023027_1181_1597 131
565 3300053109 Ga0500569_007712 Ga0500569_007712_1168_1563 131
566 3300053118 Ga0500594_0009824 Ga0500594_0009824_495_890 131
567 3300053122 Ga0500608_101911 Ga0500608_101911_421_816 131
568 3300053130 Ga0500642_0423300 Ga0500642_0423300_68_484 131
569 3300053134 Ga0500658_0008278 Ga0500658_0008278_2117_2512 131
570 3300053139 Ga0500568_0001609 Ga0500568_0001609_12421_12879 131
571 3300053142 Ga0500577_0236841 Ga0500577_0236841_191_586 131
572 3300053146 Ga0500588_0143308 Ga0500588_0143308_375_791 131
573 3300053153 Ga0500616_0047391 Ga0500616_0047391_649_1071 131
574 3300053153 Ga0500616_0051370 Ga0500616_0051370_1594_1989 131
575 3300053153 Ga0500616_0082737 Ga0500616_0082737_872_1330 131
576 3300054114 Ga0501084_0540501 Ga0501084_0540501_482_889 131
577 3300059491 Ga0587070_135389 Ga0587070_135389_102_497 131
578 3300059492 Ga0587073_0088647 Ga0587073_0088647_320_760 131
579 3300059503 Ga0587080_019117 Ga0587080_019117_21_461 131
580 3300059505 Ga0587083_0018824 Ga0587083_0018824_785_1180 131
581 3300059510 Ga0587090_041206 Ga0587090_041206_62_457 131
582 3300059512 Ga0587092_104135 Ga0587092_104135_72_467 131
583 3300059641 Ga0587068_022656 Ga0587068_022656_70_465 131
584 3300060344 Ga0587071_022486 Ga0587071_022486_24_464 131
585 3300060346 Ga0587111_0119265 Ga0587111_0119265_127_522 131
586 3300060346 Ga0587111_0146678 Ga0587111_0146678_77_472 131
587 3300060353 Ga0501082_0025124 Ga0501082_0025124_2180_2611 131
588 3300060353 Ga0501082_0037839 Ga0501082_0037839_442_843 131
589 3300060353 Ga0501082_0315421 Ga0501082_0315421_323_808 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

3

121

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8688 8 125
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8631 8 125
7jz2-assembly1.cif.gz_C succinate: quinone oxidoreductase sqr from e.coli k12 0.8484 4 125
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8373 8 125
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8364 8 125
ID Description Score Start End Superfamily
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.863 8 125 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.862 8 125 1.20.1300.10
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8611 8 125 1.20.1300.10
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8373 8 125 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8368 8 125 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A7V8QNA5-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.976 26 126 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-V4NFK4-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9756 23 130 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A2H0EV89-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9745 23 125 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A382QPX9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9731 53 129 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A357CJD6-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9719 35 130 GO:0006099
GO:0009055
GO:0016020
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.56 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map