F466823

General Info

Members Datasets Scaffolds Average Seq Length
588 365 1176 265

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746768|2785369656
Length 304
Sequence WGRRRGCWGRHLTAYPPHTLVGMTSRAASLPHARLRSSGGTPIVGTVTRGTTNPNRLRRMDRWIAATHGAELRRAAEPVAVDLGYGATPWTAVELLARLRAAAPRTRVVGVEIEPARVAAARPYERDGLVFRHGGFEIPVRERPLLIRAANVLRQYDEGEVAAVWERLCARLAPASERSRGGLLVEGTCDEIGRRHVWVALGPEGPRTVTFATRLGSLERPSDLAERLPKALIHRNVPGEPVHAFLHDFDRAWAAAAPYASYGARQRWIRTVRHLATDWPLTDGPSRWRQGEVTVAWGALAPRG

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
124 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
137 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
142 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
143 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
146 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
258 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
265 2501939600 Micromonospora sp. L5 Isolate Unclassified
266 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
267 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
268 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
269 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
270 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
271 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
272 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
273 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
274 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
275 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
276 2643221548 Streptomyces sp. Root55 Isolate Unclassified
277 2643221647 Streptomyces sp. Root369 Isolate Unclassified
278 2643221670 Streptomyces sp. Root431 Isolate Unclassified
279 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
280 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
281 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
282 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
283 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
284 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
285 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
286 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
287 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
288 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
289 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
290 2808606448 Streptomyces sp. 193411 Isolate Unclassified
291 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
292 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
293 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
294 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
295 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
296 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
297 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
298 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
299 2855683550 Micromonospora sp. RP3T Isolate Unclassified
300 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
301 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
302 2858868258 Micromonospora sp. MH33 Isolate Unclassified
303 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
304 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
305 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
306 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
307 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
308 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
309 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
310 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
311 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
312 2867428634 Streptomyces sp. RP5T Isolate Unclassified
313 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
314 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
315 2902582711 Micromonospora sp. AP08 Isolate Unclassified
316 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
317 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
318 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
319 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
320 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
321 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
322 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
323 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
324 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
325 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
326 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
327 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
328 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
329 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
330 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
331 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
332 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
333 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
334 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
335 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
336 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
337 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
338 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
339 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
340 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
341 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
342 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
343 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
344 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
345 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
346 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
347 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
348 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
349 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
350 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
351 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
352 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
353 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
354 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
355 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
356 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
357 649633069 Micromonospora sp. L5 Isolate Unclassified
358 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
359 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
360 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
361 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
362 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
363 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
364 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
365 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.97
Metatranscriptomes 0.68
Isolates 17.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0.34
Rhizoplane 7.48
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000941 3300000549 Bacteria 4501
2 JGI25152J39213_1000335 3300002773 Bacteria 29846
3 rootH1_10037150 3300003316 Bacteria 1712
4 rootL2_10082043 3300003322 Bacteria 10957
5 Ga0006562J51391_1007369 3300003578 Bacteria 890
6 Ga0065714_10014240 3300005288 Bacteria 2023
7 Ga0070658_10103738 3300005327 Bacteria 2352
8 Ga0070683_100109396 3300005329 Bacteria 2607
9 Ga0070683_100192568 3300005329 Bacteria 1936
10 Ga0068869_100205961 3300005334 Bacteria 1553
11 Ga0070680_100058019 3300005336 Bacteria 3165
12 Ga0070682_100322384 3300005337 Bacteria 1142
13 Ga0070661_100019596 3300005344 Bacteria 4821
14 Ga0070675_100006468 3300005354 Bacteria 8996
15 Ga0070675_100286895 3300005354 Bacteria 1448
16 Ga0070671_100227791 3300005355 Bacteria 1581
17 Ga0070674_100038002 3300005356 Bacteria 3241
18 Ga0070713_100118397 3300005436 Bacteria 2319
19 Ga0070700_100000064 3300005441 Bacteria 78318
20 Ga0070700_100261211 3300005441 Bacteria 1247
21 Ga0070681_10199678 3300005458 Bacteria 1918
22 Ga0070684_100154629 3300005535 Bacteria 2079
23 Ga0068855_100237689 3300005563 Bacteria 2037
24 Ga0068855_100270116 3300005563 Bacteria 1891
25 Ga0068857_100075192 3300005577 Bacteria 3011
26 Ga0068856_100263716 3300005614 Bacteria 1738
27 Ga0068859_100158868 3300005617 Bacteria 2339
28 Ga0068862_100156986 3300005844 Bacteria 2029
29 Ga0081540_1018872 3300005983 Bacteria 4213
30 Ga0081540_1034721 3300005983 Bacteria 2714
31 Ga0081539_10000362 3300005985 Bacteria 99991
32 Ga0075432_10002837 3300006058 Bacteria 5821
33 Ga0075428_100017791 3300006844 Bacteria 7854
34 Ga0075431_100320065 3300006847 Bacteria 1564
35 Ga0097620_100008608 3300006931 Bacteria 10313
36 Ga0097620_100158870 3300006931 Bacteria 2339
37 Ga0105251_10007055 3300009011 Bacteria 7006
38 Ga0105240_10464055 3300009093 Bacteria 1414
39 Ga0105245_10113497 3300009098 Bacteria 2523
40 Ga0114129_10005500 3300009147 Bacteria 17909
41 Ga0105243_10060117 3300009148 Bacteria 3035
42 Ga0105243_10098887 3300009148 Bacteria 2418
43 Ga0105243_10243474 3300009148 Bacteria 1602
44 Ga0105243_10254017 3300009148 Bacteria 1571
45 Ga0105248_10023531 3300009177 Bacteria 6843
46 Ga0105238_10123815 3300009551 Bacteria 2565
47 Ga0105246_10002272 3300011119 Bacteria 11598
48 Ga0105246_10002827 3300011119 Bacteria 10519
49 Ga0105246_10005419 3300011119 Bacteria 7769
50 Ga0157371_10017878 3300013102 Bacteria 5256
51 Ga0157369_10007003 3300013105 Bacteria 13010
52 Ga0163162_10157200 3300013306 Bacteria 2394
53 Ga0163162_10499102 3300013306 Bacteria 1347
54 Ga0157375_10096992 3300013308 Bacteria 3022
55 Ga0157375_10497124 3300013308 Bacteria 1384
56 Ga0157375_10602961 3300013308 Bacteria 1257
57 Ga0163163_10353131 3300014325 Bacteria 1526
58 Ga0163163_10581123 3300014325 Bacteria 1183
59 Ga0157380_10002067 3300014326 Bacteria 13444
60 Ga0182008_10016026 3300014497 Bacteria 3901
61 Ga0182006_1141084 3300015261 Bacteria 823
62 Ga0182007_10005637 3300015262 Bacteria 5465
63 Ga0163161_10382992 3300017792 Bacteria 1124
64 Ga0206354_10537467 3300020081 Bacteria 1892
65 Ga0209148_1004296 3300025254 Bacteria 3549
66 Ga0209129_1000112 3300025258 Bacteria 148742
67 Ga0209025_1000250 3300025294 Bacteria 126596
68 Ga0209051_1002132 3300025303 Bacteria 14737
69 Ga0207697_10003410 3300025315 Bacteria 7877
70 Ga0207696_1016427 3300025711 Bacteria 2475
71 Ga0207655_1018438 3300025728 Bacteria 3700
72 Ga0207713_1023870 3300025735 Bacteria 2866
73 Ga0207713_1034295 3300025735 Bacteria 2206
74 Ga0207682_10007075 3300025893 Bacteria 4496
75 Ga0207710_10005796 3300025900 Bacteria 5301
76 Ga0207688_10045276 3300025901 Bacteria 2454
77 Ga0207680_10095129 3300025903 Bacteria 1903
78 Ga0207645_10001283 3300025907 Bacteria 20650
79 Ga0207705_10067696 3300025909 Bacteria 2585
80 Ga0207671_10102293 3300025914 Bacteria 2171
81 Ga0207660_10280449 3300025917 Bacteria 1322
82 Ga0207649_10051133 3300025920 Bacteria 2558
83 Ga0207652_10059783 3300025921 Bacteria 3286
84 Ga0207694_10202250 3300025924 Bacteria 1616
85 Ga0207694_10423322 3300025924 Bacteria 1109
86 Ga0207650_10008172 3300025925 Bacteria 7135
87 Ga0207650_10116175 3300025925 Bacteria 2078
88 Ga0207659_10130899 3300025926 Bacteria 1936
89 Ga0207687_10375461 3300025927 Bacteria 1164
90 Ga0207700_10087538 3300025928 Bacteria 2450
91 Ga0207644_10121709 3300025931 Bacteria 1987
92 Ga0207706_10298884 3300025933 Bacteria 1403
93 Ga0207709_10151169 3300025935 Bacteria 1608
94 Ga0207691_10005671 3300025940 Bacteria 12067
95 Ga0207691_10348168 3300025940 Bacteria 1268
96 Ga0207711_10300436 3300025941 Bacteria 1481
97 Ga0207661_10004969 3300025944 Bacteria 9328
98 Ga0207667_10295732 3300025949 Bacteria 1654
99 Ga0207651_10010662 3300025960 Bacteria 5105
100 Ga0207668_10158443 3300025972 Bacteria 1761
101 Ga0207639_10378003 3300026041 Bacteria 1271
102 Ga0207678_10288152 3300026067 Bacteria 1410
103 Ga0207678_10461531 3300026067 Bacteria 1105
104 Ga0207708_10000076 3300026075 Bacteria 78340
105 Ga0207708_10301812 3300026075 Bacteria 1303
106 Ga0207702_10141681 3300026078 Bacteria 2176
107 Ga0207674_10035629 3300026116 Bacteria 5193
108 Ga0207674_10159084 3300026116 Bacteria 2214
109 Ga0207683_10007071 3300026121 Bacteria 9626
110 Ga0207698_10012901 3300026142 Bacteria 5491
111 Ga0207428_10004666 3300027907 Bacteria 12982
112 Ga0268266_10125931 3300028379 Bacteria 2286
113 Ga0268266_10183671 3300028379 Bacteria 1906
114 Ga0268264_10719271 3300028381 Bacteria 993
115 Ga0307515_10029121 3300028794 Bacteria 9352
116 Ga0307515_10161078 3300028794 Bacteria 2288
117 Ga0268256_1039809 3300030500 Bacteria 1059
118 Ga0307511_10073492 3300030521 Bacteria 2473
119 Ga0307513_10042977 3300031456 Bacteria 4969
120 Ga0307408_100008044 3300031548 Bacteria 6971
121 Ga0307408_100043398 3300031548 Bacteria 3199
122 Ga0307408_100061003 3300031548 Bacteria 2751
123 Ga0307408_100080978 3300031548 Bacteria 2426
124 Ga0307408_100425170 3300031548 Bacteria 1146
125 Ga0307508_10047332 3300031616 Bacteria 3836
126 Ga0307508_10146350 3300031616 Bacteria 1966
127 Ga0307514_10011573 3300031649 Bacteria 7332
128 Ga0307514_10157131 3300031649 Bacteria 1513
129 Ga0307516_10008286 3300031730 Bacteria 11785
130 Ga0307405_10019114 3300031731 Bacteria 3797
131 Ga0307405_10047654 3300031731 Bacteria 2639
132 Ga0307405_10053896 3300031731 Bacteria 2508
133 Ga0307405_10080072 3300031731 Bacteria 2131
134 Ga0307405_10082577 3300031731 Bacteria 2103
135 Ga0307405_10113544 3300031731 Bacteria 1839
136 Ga0307413_10009225 3300031824 Bacteria 4711
137 Ga0307413_10081795 3300031824 Bacteria 2072
138 Ga0307413_10139619 3300031824 Bacteria 1672
139 Ga0307413_10319268 3300031824 Bacteria 1186
140 Ga0307413_10419560 3300031824 Bacteria 1053
141 Ga0307410_10002901 3300031852 Bacteria 8441
142 Ga0307410_10010956 3300031852 Bacteria 5162
143 Ga0307410_10017063 3300031852 Bacteria 4348
144 Ga0307410_10028456 3300031852 Bacteria 3545
145 Ga0307410_10037417 3300031852 Bacteria 3169
146 Ga0307410_10056020 3300031852 Bacteria 2679
147 Ga0307410_10104583 3300031852 Bacteria 2036
148 Ga0307410_10123671 3300031852 Bacteria 1890
149 Ga0307410_10167006 3300031852 Bacteria 1654
150 Ga0326468_10000866 3300031889 Bacteria 2981
151 Ga0307406_10076487 3300031901 Bacteria 2211
152 Ga0307406_10076578 3300031901 Bacteria 2210
153 Ga0307406_10094619 3300031901 Bacteria 2020
154 Ga0307406_10106470 3300031901 Bacteria 1921
155 Ga0307406_10276321 3300031901 Bacteria 1279
156 Ga0307407_10055513 3300031903 Bacteria 2289
157 Ga0307407_10066291 3300031903 Bacteria 2129
158 Ga0307407_10102124 3300031903 Bacteria 1782
159 Ga0307407_10106203 3300031903 Bacteria 1753
160 Ga0307407_10232198 3300031903 Bacteria 1253
161 Ga0307407_10264957 3300031903 Bacteria 1184
162 Ga0307412_10008626 3300031911 Bacteria 5828
163 Ga0307412_10042097 3300031911 Bacteria 2964
164 Ga0307412_10061966 3300031911 Bacteria 2516
165 Ga0307412_10070969 3300031911 Bacteria 2376
166 Ga0307412_10107659 3300031911 Bacteria 1984
167 Ga0307412_10124930 3300031911 Bacteria 1859
168 Ga0307412_10308441 3300031911 Bacteria 1254
169 Ga0307412_10360455 3300031911 Bacteria 1170
170 Ga0307409_100010815 3300031995 Bacteria 5705
171 Ga0307409_100015008 3300031995 Bacteria 5065
172 Ga0307409_100245338 3300031995 Bacteria 1633
173 Ga0307409_100247852 3300031995 Bacteria 1626
174 Ga0307409_100593831 3300031995 Bacteria 1093
175 Ga0307409_100842116 3300031995 Bacteria 927
176 Ga0307416_100000902 3300032002 Bacteria 15696
177 Ga0307416_100022281 3300032002 Bacteria 4569
178 Ga0307416_100024107 3300032002 Bacteria 4432
179 Ga0307416_100062540 3300032002 Bacteria 3044
180 Ga0307416_100101752 3300032002 Bacteria 2503
181 Ga0307416_100121563 3300032002 Bacteria 2328
182 Ga0307416_100230555 3300032002 Bacteria 1785
183 Ga0307416_100339280 3300032002 Bacteria 1514
184 Ga0307416_100680099 3300032002 Bacteria 1116
185 Ga0307416_100708223 3300032002 Bacteria 1096
186 Ga0307414_10072173 3300032004 Bacteria 2493
187 Ga0307414_10087585 3300032004 Bacteria 2302
188 Ga0307414_10093589 3300032004 Bacteria 2241
189 Ga0307411_10007272 3300032005 Bacteria 5619
190 Ga0307415_100046575 3300032126 Bacteria 2914
191 Ga0307415_100092353 3300032126 Bacteria 2195
192 Ga0307415_100315466 3300032126 Bacteria 1301
193 Ga0307415_100802396 3300032126 Bacteria 859
194 Ga0316583_10032454 3300032133 Bacteria 1857
195 Ga0307510_10037893 3300033180 Bacteria 5341
196 Ga0373951_0000148 3300035091 Bacteria 25725
197 Ga0373931_0109744 3300035691 Bacteria 1564
198 Ga0395899_0030316 3300037312 Bacteria 4068
199 Ga0395899_0184334 3300037312 Bacteria 1463
200 Ga0395899_0236159 3300037312 Bacteria 1260
201 Ga0395899_0268254 3300037312 Bacteria 1165
202 Ga0395900_0043733 3300037418 Bacteria 4617
203 Ga0395900_0049217 3300037418 Bacteria 4342
204 Ga0395900_0459442 3300037418 Bacteria 1228
205 Ga0395898_0009353 3300037466 Bacteria 10295
206 Ga0395898_0028220 3300037466 Bacteria 5627
207 Ga0395898_0216868 3300037466 Bacteria 1825
208 Ga0395898_0542879 3300037466 Bacteria 1104
209 Ga0395905_0180311 3300037471 Bacteria 1983
210 Ga0395901_0002968 3300038443 Bacteria 17114
211 Ga0395901_0011481 3300038443 Bacteria 8976
212 Ga0395901_0038453 3300038443 Bacteria 4949
213 Ga0395901_0157229 3300038443 Bacteria 2387
214 Ga0395901_0347271 3300038443 Bacteria 1532
215 Ga0395901_0742613 3300038443 Bacteria 975
216 Ga0439436_0004582 3300041404 Bacteria 4238
217 Ga0439436_0039782 3300041404 Bacteria 1349
218 Ga0439438_007308 3300041405 Bacteria 3787
219 Ga0439439_0049545 3300041406 Bacteria 1099
220 Ga0439461_0005463 3300041410 Bacteria 2167
221 Ga0439466_0001051 3300041411 Bacteria 10668
222 Ga0439466_0006962 3300041411 Bacteria 4286
223 Ga0439466_0058273 3300041411 Bacteria 1250
224 Ga0439465_0100562 3300041413 Bacteria 998
225 Ga0451843_0409629 3300041509 Bacteria 974
226 Ga0451853_1000543 3300041512 Bacteria 3245
227 Ga0451853_3358716 3300041512 Bacteria 826
228 Ga0439433_0005903 3300041999 Bacteria 2629
229 Ga0439433_0033689 3300041999 Bacteria 1177
230 Ga0439442_000041 3300042002 Bacteria 29264
231 Ga0439442_000267 3300042002 Bacteria 12742
232 Ga0439442_000269 3300042002 Bacteria 12687
233 Ga0439442_016832 3300042002 Bacteria 1508
234 Ga0439448_0075309 3300042005 Bacteria 1128
235 Ga0439432_016381 3300042006 Bacteria 2496
236 Ga0439432_016958 3300042006 Bacteria 2447
237 Ga0439449_0001213 3300042007 Bacteria 10126
238 Ga0439449_0006931 3300042007 Bacteria 4320
239 Ga0439449_0011831 3300042007 Bacteria 3280
240 Ga0439449_0036529 3300042007 Bacteria 1827
241 Ga0439449_0042119 3300042007 Bacteria 1697
242 Ga0439452_009635 3300042010 Bacteria 2839
243 Ga0439455_0014358 3300042012 Bacteria 1807
244 Ga0439457_000264 3300042014 Bacteria 14379
245 Ga0439457_000643 3300042014 Bacteria 10318
246 Ga0439457_007639 3300042014 Bacteria 2589
247 Ga0439457_009346 3300042014 Bacteria 2285
248 Ga0439462_0002766 3300042015 Bacteria 4121
249 Ga0439462_0005991 3300042015 Bacteria 3010
250 Ga0439462_0019528 3300042015 Bacteria 1765
251 Ga0439462_0020043 3300042015 Bacteria 1743
252 Ga0439462_0040347 3300042015 Bacteria 1245
253 Ga0439463_047916 3300042016 Bacteria 1089
254 Ga0450919_000499 3300042121 Bacteria 4910
255 Ga0450920_001192 3300042122 Bacteria 4258
256 Ga0450920_016907 3300042122 Bacteria 1392
257 Ga0450897_002915 3300042128 Bacteria 1329
258 Ga0450900_002926 3300042136 Bacteria 1855
259 Ga0450900_012937 3300042136 Bacteria 1098
260 Ga0450907_000254 3300042146 Bacteria 18240
261 Ga0450907_020198 3300042146 Bacteria 1117
262 Ga0439446_0016159 3300042156 Bacteria 2077
263 Ga0450908_000671 3300042184 Bacteria 6596
264 Ga0450909_009900 3300042185 Bacteria 1392
265 Ga0439434_0000387 3300042435 Bacteria 12514
266 Ga0439434_0006225 3300042435 Bacteria 3480
267 Ga0450918_000368 3300042531 Bacteria 9869
268 Ga0466969_0039221 3300044656 Bacteria 2380
269 Ga0466966_0132802 3300044684 Bacteria 1523
270 Ga0466961_0003699 3300044693 Bacteria 9551
271 Ga0466961_0237836 3300044693 Bacteria 1120
272 Ga0466963_0004295 3300044694 Bacteria 8270
273 Ga0466963_0270582 3300044694 Bacteria 1193
274 Ga0466970_0000834 3300044765 Bacteria 14808
275 Ga0466970_0066533 3300044765 Bacteria 1934
276 Ga0466957_0008903 3300044842 Bacteria 5720
277 Ga0466960_0015998 3300044901 Bacteria 3244
278 Ga0466960_0068447 3300044901 Bacteria 1761
279 Ga0466959_0000799 3300045049 Bacteria 18547
280 Ga0466959_0010490 3300045049 Bacteria 6626
281 Ga0466958_0003715 3300045836 Bacteria 7971
282 Ga0466967_0065411 3300045976 Bacteria 3236
283 Ga0495617_005548 3300046452 Bacteria 4465
284 Ga0495627_014869 3300046453 Bacteria 2701
285 Ga0495603_0001171 3300046455 Bacteria 15280
286 Ga0495603_0002660 3300046455 Bacteria 10538
287 Ga0495629_0009008 3300046459 Bacteria 7322
288 Ga0495629_0039391 3300046459 Bacteria 3326
289 Ga0495629_0251015 3300046459 Bacteria 1217
290 Ga0495629_0348343 3300046459 Bacteria 1011
291 Ga0495638_0041226 3300046460 Bacteria 2922
292 Ga0495638_0081623 3300046460 Bacteria 1962
293 Ga0495641_0107930 3300046461 Bacteria 1242
294 Ga0495653_0049941 3300046463 Bacteria 3219
295 Ga0495580_0024638 3300046472 Bacteria 4402
296 Ga0495580_0111335 3300046472 Bacteria 1901
297 Ga0495582_0166744 3300046473 Bacteria 1253
298 Ga0495639_0004336 3300046475 Bacteria 6086
299 Ga0495639_0017136 3300046475 Bacteria 3146
300 Ga0495662_0006386 3300046476 Bacteria 5891
301 Ga0495662_0023658 3300046476 Bacteria 2966
302 Ga0495585_0021060 3300046492 Bacteria 3745
303 Ga0495585_0096343 3300046492 Bacteria 1587
304 Ga0495594_0018195 3300046499 Bacteria 3720
305 Ga0495594_0064694 3300046499 Bacteria 2028
306 Ga0495594_0297848 3300046499 Bacteria 919
307 Ga0495606_0005896 3300046507 Bacteria 11524
308 Ga0495610_0005338 3300046512 Bacteria 9171
309 Ga0495610_0122853 3300046512 Bacteria 1136
310 Ga0495620_0088581 3300046515 Bacteria 1243
311 Ga0495631_0025732 3300046518 Bacteria 2706
312 Ga0495631_0084009 3300046518 Bacteria 1372
313 Ga0495642_0143521 3300046528 Bacteria 1031
314 Ga0495654_0011741 3300046530 Bacteria 4731
315 Ga0495665_0004689 3300046531 Bacteria 7369
316 Ga0495640_0018558 3300046533 Bacteria 5153
317 Ga0495640_0305721 3300046533 Bacteria 987
318 Ga0495586_0056002 3300046535 Bacteria 2138
319 Ga0495586_0166742 3300046535 Bacteria 1244
320 Ga0495609_0048998 3300046538 Bacteria 1886
321 Ga0495645_0176389 3300046543 Bacteria 1467
322 Ga0495633_0088760 3300046558 Bacteria 1437
323 Ga0495633_0129813 3300046558 Bacteria 1166
324 Ga0495656_0001859 3300046615 Bacteria 6959
325 Ga0495656_0175484 3300046615 Bacteria 1050
326 Ga0495668_0095010 3300046616 Bacteria 1632
327 Ga0495668_0112280 3300046616 Bacteria 1490
328 Ga0495634_0311604 3300046642 Bacteria 949
329 Ga0495611_0006633 3300046648 Bacteria 4928
330 Ga0495588_0008313 3300046674 Bacteria 4755
331 Ga0495588_0009277 3300046674 Bacteria 4543
332 Ga0495588_0029330 3300046674 Bacteria 2759
333 Ga0495588_0138631 3300046674 Bacteria 1284
334 Ga0495657_0016204 3300046675 Bacteria 5434
335 Ga0495623_0093891 3300046679 Bacteria 1836
336 Ga0495613_0006347 3300046689 Bacteria 8843
337 Ga0495613_0011715 3300046689 Bacteria 6516
338 Ga0495624_0149326 3300046690 Bacteria 1430
339 Ga0495670_0002428 3300046691 Bacteria 9204
340 Ga0495670_0044312 3300046691 Bacteria 2221
341 Ga0495670_0161844 3300046691 Bacteria 1176
342 Ga0495670_0239392 3300046691 Bacteria 966
343 Ga0495671_0165066 3300046692 Bacteria 1077
344 Ga0495589_0004171 3300046794 Bacteria 7735
345 Ga0495589_0049647 3300046794 Bacteria 2076
346 Ga0495589_0066806 3300046794 Bacteria 1760
347 Ga0495600_0022880 3300046809 Bacteria 4017
348 Ga0495600_0132856 3300046809 Bacteria 1617
349 Ga0495581_0001990 3300047315 Bacteria 11465
350 Ga0495581_0165218 3300047315 Bacteria 1294
351 Ga0495604_0042657 3300047317 Bacteria 3554
352 Ga0495604_0202548 3300047317 Bacteria 1376
353 Ga0495636_0007527 3300047318 Bacteria 4285
354 Ga0495676_0014520 3300047321 Bacteria 7046
355 Ga0495680_0395240 3300047322 Bacteria 955
356 Ga0495687_041695 3300047443 Bacteria 2011
357 Ga0495675_0059666 3300047444 Bacteria 2418
358 Ga0495677_0018583 3300047445 Bacteria 2519
359 Ga0495679_079620 3300047446 Bacteria 932
360 Ga0495685_001500 3300047447 Bacteria 7149
361 Ga0495685_005425 3300047447 Bacteria 4164
362 Ga0495681_0018968 3300047470 Bacteria 3771
363 Ga0495681_0030870 3300047470 Bacteria 2723
364 Ga0495686_0038767 3300047472 Bacteria 3046
365 Ga0495593_0200868 3300047673 Bacteria 1002
366 Ga0495614_0080875 3300048089 Bacteria 1407
367 Ga0495626_0004356 3300048091 Bacteria 8719
368 Ga0496100_0058289 3300048903 Bacteria 2534
369 Ga0496100_0455443 3300048903 Bacteria 981
370 Ga0496101_0599860 3300048904 Bacteria 870
371 Ga0496102_0006769 3300048905 Bacteria 9780
372 Ga0496102_0076699 3300048905 Bacteria 3075
373 Ga0496102_0186804 3300048905 Bacteria 1953
374 Ga0496103_0012978 3300048906 Bacteria 4941
375 Ga0496103_0015531 3300048906 Bacteria 4533
376 Ga0496104_0128169 3300048907 Bacteria 2437
377 Ga0496104_0233412 3300048907 Bacteria 1751
378 Ga0496104_0447445 3300048907 Bacteria 1204
379 Ga0496105_0019239 3300048908 Bacteria 5507
380 Ga0496105_0031264 3300048908 Bacteria 4365
381 Ga0496105_0047263 3300048908 Bacteria 3551
382 Ga0496106_0065433 3300048909 Bacteria 2767
383 Ga0496106_0070624 3300048909 Bacteria 2667
384 Ga0496106_0157006 3300048909 Bacteria 1797
385 Ga0496107_0100495 3300048910 Bacteria 2120
386 Ga0496108_0034559 3300048911 Bacteria 4201
387 Ga0496108_0323777 3300048911 Bacteria 1344
388 Ga0496108_0355358 3300048911 Bacteria 1279
389 Ga0496109_0027664 3300048912 Bacteria 5066
390 Ga0496109_0130759 3300048912 Bacteria 2343
391 Ga0496109_0141698 3300048912 Bacteria 2248
392 Ga0496109_0146253 3300048912 Bacteria 2211
393 Ga0496109_0438112 3300048912 Bacteria 1234
394 Ga0496110_0073590 3300048913 Bacteria 3032
395 Ga0496110_0078705 3300048913 Bacteria 2935
396 Ga0496110_0080953 3300048913 Bacteria 2894
397 Ga0496110_0185017 3300048913 Bacteria 1891
398 Ga0496110_0219095 3300048913 Bacteria 1730
399 Ga0496111_0169668 3300048914 Bacteria 1621
400 Ga0496111_0235301 3300048914 Bacteria 1360
401 Ga0496112_0019113 3300048915 Bacteria 6458
402 Ga0496112_0421611 3300048915 Bacteria 1273
403 Ga0496112_0697116 3300048915 Bacteria 943
404 Ga0496113_0096541 3300048916 Bacteria 2285
405 Ga0496113_0153795 3300048916 Bacteria 1816
406 Ga0496113_0297837 3300048916 Bacteria 1291
407 Ga0496113_0340643 3300048916 Bacteria 1202
408 Ga0496114_0011307 3300048917 Bacteria 7129
409 Ga0496114_0044913 3300048917 Bacteria 3668
410 Ga0496114_0052324 3300048917 Bacteria 3402
411 Ga0496114_0164788 3300048917 Bacteria 1929
412 Ga0495678_031196 3300049459 Bacteria 2224
413 Ga0501318_004994 3300049534 Bacteria 1297
414 Ga0501321_008608 3300049537 Bacteria 1086
415 Ga0501031_0004909 3300049568 Bacteria 8690
416 Ga0501031_0146929 3300049568 Bacteria 1540
417 Ga0501031_0278353 3300049568 Bacteria 1086
418 Ga0501032_0034024 3300049569 Bacteria 3490
419 Ga0501032_0068000 3300049569 Bacteria 2379
420 Ga0501033_0027970 3300049570 Bacteria 4238
421 Ga0501033_0105363 3300049570 Bacteria 2055
422 Ga0501033_0240819 3300049570 Bacteria 1283
423 Ga0501034_0027786 3300049571 Bacteria 5752
424 Ga0501034_0082423 3300049571 Bacteria 3218
425 Ga0501034_0197209 3300049571 Bacteria 1973
426 Ga0501034_0469895 3300049571 Bacteria 1174
427 Ga0501036_0007030 3300049572 Bacteria 9162
428 Ga0501036_0010416 3300049572 Bacteria 7675
429 Ga0501036_0038009 3300049572 Bacteria 4073
430 Ga0501036_0334680 3300049572 Bacteria 1264
431 Ga0501036_0401366 3300049572 Bacteria 1144
432 Ga0501037_0005557 3300049573 Bacteria 9197
433 Ga0501037_0006798 3300049573 Bacteria 8360
434 Ga0501037_0014570 3300049573 Bacteria 5785
435 Ga0501037_0049919 3300049573 Bacteria 3063
436 Ga0501038_0009539 3300049574 Bacteria 8904
437 Ga0501038_0036112 3300049574 Bacteria 4337
438 Ga0501038_0150564 3300049574 Bacteria 1897
439 Ga0501039_0010639 3300049575 Bacteria 7009
440 Ga0501039_0044831 3300049575 Bacteria 3417
441 Ga0501039_0231934 3300049575 Bacteria 1451
442 Ga0501039_0381282 3300049575 Bacteria 1107
443 Ga0501041_0007470 3300049577 Bacteria 6416
444 Ga0501041_0417298 3300049577 Bacteria 851
445 Ga0501042_0002601 3300049578 Bacteria 11094
446 Ga0501043_0003043 3300049579 Bacteria 13927
447 Ga0501043_0006985 3300049579 Bacteria 8991
448 Ga0501046_0003217 3300049580 Bacteria 15010
449 Ga0501046_0042351 3300049580 Bacteria 3631
450 Ga0501046_0042857 3300049580 Bacteria 3606
451 Ga0501047_0106730 3300049581 Bacteria 2681
452 Ga0501047_0209398 3300049581 Bacteria 1808
453 Ga0501047_0325769 3300049581 Bacteria 1375
454 Ga0501047_0575587 3300049581 Bacteria 949
455 Ga0501048_0014629 3300049582 Bacteria 5807
456 Ga0501070_0002065 3300049586 Bacteria 17650
457 Ga0501070_0054855 3300049586 Bacteria 3305
458 Ga0501070_0109357 3300049586 Bacteria 2284
459 Ga0501070_0110602 3300049586 Bacteria 2271
460 Ga0501072_0018130 3300049588 Bacteria 5413
461 Ga0501074_0003057 3300049590 Bacteria 11796
462 Ga0501074_0127269 3300049590 Bacteria 1823
463 Ga0501074_0277167 3300049590 Bacteria 1192
464 Ga0501075_0009998 3300049591 Bacteria 6652
465 Ga0501076_0002267 3300049592 Bacteria 13155
466 Ga0501079_0012248 3300049741 Bacteria 6545
467 Ga0501035_0000268 3300049822 Bacteria 61655
468 Ga0501035_0327714 3300049822 Bacteria 1285
469 Ga0501044_0017111 3300049823 Bacteria 7780
470 Ga0501044_0054682 3300049823 Bacteria 4102
471 Ga0501044_0126399 3300049823 Bacteria 2554
472 Ga0501044_0313436 3300049823 Bacteria 1495
473 Ga0501045_0000424 3300049824 Bacteria 25806
474 Ga0501045_0148732 3300049824 Bacteria 1742
475 Ga0501045_0282455 3300049824 Bacteria 1236
476 nmdc:mga06z11_134882_c1 3300050494 Bacteria 1390
477 nmdc:mga04h51_110335_c1 3300050495 Bacteria 1013
478 nmdc:mga09592_16486_c1 3300050508 Bacteria 6045
479 nmdc:mga0qj67_26_c1 3300050509 Bacteria 103914
480 Ga0500560_000597 3300053107 Bacteria 5243
481 Ga0500652_031344 3300053131 Bacteria 2085
482 Ga0500568_0007195 3300053139 Bacteria 5485
483 Ga0500600_0197201 3300053149 Bacteria 952
484 Ga0501082_0015559 3300060353 Bacteria 6550
485 Ga0466962_0054091 3300061719 Bacteria 1918
486 Ga0530510_0006626 3300061734 Bacteria 8076
487 2785369656 2784746768 Bacteria 10036182
488 2501944961 2501939600 Bacteria 6907073
489 2515495496 2515154088 Bacteria 5526283
490 2515720258 2515154129 Bacteria 5584369
491 2515755999 2515154137 Bacteria 5711575
492 2516084414 2515154202 Bacteria 5471270
493 2516089663 2515154203 Bacteria 5458536
494 2537898225 2537561592 Bacteria 4348607
495 2585310226 2582581313 Bacteria 10042643
496 2585313642 2582581314 Bacteria 11452267
497 2616694918 2616644814 Bacteria 11555299
498 2623585232 2622736626 Bacteria 7181580
499 2643765104 2643221548 Bacteria 8053412
500 2644262481 2643221647 Bacteria 10741251
501 2644390050 2643221670 Bacteria 6497041
502 2644461057 2643221682 Bacteria 6743283
503 2676201195 2675902999 Bacteria 9438463
504 2691512704 2690315906 Bacteria 4517044
505 2723641309 2721755702 Bacteria 4373124
506 2784588742 2784132148 Bacteria 8627943
507 2785343148 2784746763 Bacteria 9783172
508 2786670743 2786546132 Bacteria 10419719
509 2804845946 2802429296 Bacteria 7227771
510 2808871878 2808606365 Bacteria 4301966
511 2808894237 2808606370 Bacteria 4942454
512 2808897861 2808606371 Bacteria 4251511
513 2809232350 2808606448 Bacteria 8656184
514 2810363080 2808606700 Bacteria 3482157
515 2812357942 2811994879 Bacteria 9313447
516 2812480389 2811994917 Bacteria 7761064
517 2819426043 2818991318 Bacteria 5266538
518 2831937100 2831935698 Bacteria 5963223
519 2832010195 2832004796 Bacteria 6538017
520 2844851633 2844849076 Bacteria 4091819
521 2852636514 2852635781 Bacteria 8251373
522 2855687012 2855683550 Bacteria 7134265
523 2856859063 2856858025 Bacteria 7255264
524 2857741631 2857740372 Bacteria 4782044
525 2858874489 2858868258 Bacteria 7683772
526 2858902764 2858902515 Bacteria 7086037
527 2861527168 2861520306 Bacteria 8348283
528 2862179346 2862178590 Bacteria 8583590
529 2862511661 2862507626 Bacteria 9425308
530 2866069743 2866065130 Bacteria 6518152
531 2867306115 2867302475 Bacteria 7087181
532 2867317313 2867312974 Bacteria 7058875
533 2867323130 2867319477 Bacteria 7069771
534 2867348940 2867346516 Bacteria 7608576
535 2867431173 2867428634 Bacteria 9590268
536 2867510728 2867507094 Bacteria 6506033
537 2877680968 2877676314 Bacteria 9512378
538 2902584666 2902582711 Bacteria 6187705
539 2904497907 2904497146 Bacteria 4731781
540 2904778927 2904776348 Bacteria 4658726
541 2905930819 2905926851 Bacteria 4423176
542 2910811582 2910809715 Bacteria 4982797
543 2912719809 2912715099 Bacteria 9460473
544 2919037974 2919034639 Bacteria 4763403
545 2919063140 2919059106 Bacteria 4991624
546 2919391646 2919391150 Bacteria 4884741
547 2919445708 2919443155 Bacteria 4072969
548 2919448252 2919446982 Bacteria 3994487
549 2919539398 2919538618 Bacteria 4677069
550 2933420084 2933418574 Bacteria 4476724
551 2935410722 2935409751 Bacteria 4179611
552 2939600628 2939598168 Bacteria 4687164
553 2939647052 2939647034 Bacteria 4681660
554 2939678731 2939674588 Bacteria 4844420
555 2945923796 2945920336 Bacteria 4501603
556 2945944557 2945941187 Bacteria 4682474
557 2945957255 2945956166 Bacteria 5110334
558 2946006960 2946003308 Bacteria 3857229
559 2946024693 2946024296 Bacteria 3508095
560 2946040463 2946037020 Bacteria 4900426
561 2946059894 2946059875 Bacteria 4386623
562 2946067911 2946064051 Bacteria 8957905
563 2947229050 2947224130 Bacteria 9938529
564 2954001725 2953998280 Bacteria 4812144
565 2954386074 2954380949 Bacteria 10050426
566 2954677067 2954673503 Bacteria 9685905
567 2954687089 2954682443 Bacteria 9862841
568 2954696722 2954691527 Bacteria 10720516
569 2954705439 2954701450 Bacteria 10834262
570 2954716077 2954711539 Bacteria 10867210
571 2954726022 2954721474 Bacteria 10456478
572 2954735780 2954731030 Bacteria 10243860
573 2954744957 2954740390 Bacteria 10229294
574 2954754645 2954749733 Bacteria 10366972
575 2954763944 2954759201 Bacteria 9358192
576 2990063227 2990059506 Bacteria 9321252
577 2996222104 2996221748 Bacteria 6799777
578 3006325176 3006321560 Bacteria 8247479
579 3006428829 3006425503 Bacteria 6491253
580 649812978 649633069 Bacteria 6962533
581 8003858080 8003856774 Bacteria 7675274
582 8003870861 8003870546 Bacteria 7396674
583 8008490291 8008485437 Bacteria 7198341
584 8025414140 8025413630 Bacteria 7014048
585 8025529593 8025524527 Bacteria 7197316
586 8054110156 8054107350 Bacteria 5022511
587 8055416158 8055412473 Bacteria 6257500
588 8056673026 8056667051 Bacteria 6953971
589 LJQas_1000941
590 JGI25152J39213_1000335
591 rootH1_10037150
592 rootL2_10082043
593 Ga0006562J51391_1007369
594 Ga0065714_10014240
595 Ga0070658_10103738
596 Ga0070683_100109396
597 Ga0070683_100192568
598 Ga0068869_100205961
599 Ga0070680_100058019
600 Ga0070682_100322384
601 Ga0070661_100019596
602 Ga0070675_100006468
603 Ga0070675_100286895
604 Ga0070671_100227791
605 Ga0070674_100038002
606 Ga0070713_100118397
607 Ga0070700_100000064
608 Ga0070700_100261211
609 Ga0070681_10199678
610 Ga0070684_100154629
611 Ga0068855_100237689
612 Ga0068855_100270116
613 Ga0068857_100075192
614 Ga0068856_100263716
615 Ga0068859_100158868
616 Ga0068862_100156986
617 Ga0081540_1018872
618 Ga0081540_1034721
619 Ga0081539_10000362
620 Ga0075432_10002837
621 Ga0075428_100017791
622 Ga0075431_100320065
623 Ga0097620_100008608
624 Ga0097620_100158870
625 Ga0105251_10007055
626 Ga0105240_10464055
627 Ga0105245_10113497
628 Ga0114129_10005500
629 Ga0105243_10060117
630 Ga0105243_10098887
631 Ga0105243_10243474
632 Ga0105243_10254017
633 Ga0105248_10023531
634 Ga0105238_10123815
635 Ga0105246_10002272
636 Ga0105246_10002827
637 Ga0105246_10005419
638 Ga0157371_10017878
639 Ga0157369_10007003
640 Ga0163162_10157200
641 Ga0163162_10499102
642 Ga0157375_10096992
643 Ga0157375_10497124
644 Ga0157375_10602961
645 Ga0163163_10353131
646 Ga0163163_10581123
647 Ga0157380_10002067
648 Ga0182008_10016026
649 Ga0182006_1141084
650 Ga0182007_10005637
651 Ga0163161_10382992
652 Ga0206354_10537467
653 Ga0209148_1004296
654 Ga0209129_1000112
655 Ga0209025_1000250
656 Ga0209051_1002132
657 Ga0207697_10003410
658 Ga0207696_1016427
659 Ga0207655_1018438
660 Ga0207713_1023870
661 Ga0207713_1034295
662 Ga0207682_10007075
663 Ga0207710_10005796
664 Ga0207688_10045276
665 Ga0207680_10095129
666 Ga0207645_10001283
667 Ga0207705_10067696
668 Ga0207671_10102293
669 Ga0207660_10280449
670 Ga0207649_10051133
671 Ga0207652_10059783
672 Ga0207694_10202250
673 Ga0207694_10423322
674 Ga0207650_10008172
675 Ga0207650_10116175
676 Ga0207659_10130899
677 Ga0207687_10375461
678 Ga0207700_10087538
679 Ga0207644_10121709
680 Ga0207706_10298884
681 Ga0207709_10151169
682 Ga0207691_10005671
683 Ga0207691_10348168
684 Ga0207711_10300436
685 Ga0207661_10004969
686 Ga0207667_10295732
687 Ga0207651_10010662
688 Ga0207668_10158443
689 Ga0207639_10378003
690 Ga0207678_10288152
691 Ga0207678_10461531
692 Ga0207708_10000076
693 Ga0207708_10301812
694 Ga0207702_10141681
695 Ga0207674_10035629
696 Ga0207674_10159084
697 Ga0207683_10007071
698 Ga0207698_10012901
699 Ga0207428_10004666
700 Ga0268266_10125931
701 Ga0268266_10183671
702 Ga0268264_10719271
703 Ga0307515_10029121
704 Ga0307515_10161078
705 Ga0268256_1039809
706 Ga0307511_10073492
707 Ga0307513_10042977
708 Ga0307408_100008044
709 Ga0307408_100043398
710 Ga0307408_100061003
711 Ga0307408_100080978
712 Ga0307408_100425170
713 Ga0307508_10047332
714 Ga0307508_10146350
715 Ga0307514_10011573
716 Ga0307514_10157131
717 Ga0307516_10008286
718 Ga0307405_10019114
719 Ga0307405_10047654
720 Ga0307405_10053896
721 Ga0307405_10080072
722 Ga0307405_10082577
723 Ga0307405_10113544
724 Ga0307413_10009225
725 Ga0307413_10081795
726 Ga0307413_10139619
727 Ga0307413_10319268
728 Ga0307413_10419560
729 Ga0307410_10002901
730 Ga0307410_10010956
731 Ga0307410_10017063
732 Ga0307410_10028456
733 Ga0307410_10037417
734 Ga0307410_10056020
735 Ga0307410_10104583
736 Ga0307410_10123671
737 Ga0307410_10167006
738 Ga0326468_10000866
739 Ga0307406_10076487
740 Ga0307406_10076578
741 Ga0307406_10094619
742 Ga0307406_10106470
743 Ga0307406_10276321
744 Ga0307407_10055513
745 Ga0307407_10066291
746 Ga0307407_10102124
747 Ga0307407_10106203
748 Ga0307407_10232198
749 Ga0307407_10264957
750 Ga0307412_10008626
751 Ga0307412_10042097
752 Ga0307412_10061966
753 Ga0307412_10070969
754 Ga0307412_10107659
755 Ga0307412_10124930
756 Ga0307412_10308441
757 Ga0307412_10360455
758 Ga0307409_100010815
759 Ga0307409_100015008
760 Ga0307409_100245338
761 Ga0307409_100247852
762 Ga0307409_100593831
763 Ga0307409_100842116
764 Ga0307416_100000902
765 Ga0307416_100022281
766 Ga0307416_100024107
767 Ga0307416_100062540
768 Ga0307416_100101752
769 Ga0307416_100121563
770 Ga0307416_100230555
771 Ga0307416_100339280
772 Ga0307416_100680099
773 Ga0307416_100708223
774 Ga0307414_10072173
775 Ga0307414_10087585
776 Ga0307414_10093589
777 Ga0307411_10007272
778 Ga0307415_100046575
779 Ga0307415_100092353
780 Ga0307415_100315466
781 Ga0307415_100802396
782 Ga0316583_10032454
783 Ga0307510_10037893
784 Ga0373951_0000148
785 Ga0373931_0109744
786 Ga0395899_0030316
787 Ga0395899_0184334
788 Ga0395899_0236159
789 Ga0395899_0268254
790 Ga0395900_0043733
791 Ga0395900_0049217
792 Ga0395900_0459442
793 Ga0395898_0009353
794 Ga0395898_0028220
795 Ga0395898_0216868
796 Ga0395898_0542879
797 Ga0395905_0180311
798 Ga0395901_0002968
799 Ga0395901_0011481
800 Ga0395901_0038453
801 Ga0395901_0157229
802 Ga0395901_0347271
803 Ga0395901_0742613
804 Ga0439436_0004582
805 Ga0439436_0039782
806 Ga0439438_007308
807 Ga0439439_0049545
808 Ga0439461_0005463
809 Ga0439466_0001051
810 Ga0439466_0006962
811 Ga0439466_0058273
812 Ga0439465_0100562
813 Ga0451843_0409629
814 Ga0451853_1000543
815 Ga0451853_3358716
816 Ga0439433_0005903
817 Ga0439433_0033689
818 Ga0439442_000041
819 Ga0439442_000267
820 Ga0439442_000269
821 Ga0439442_016832
822 Ga0439448_0075309
823 Ga0439432_016381
824 Ga0439432_016958
825 Ga0439449_0001213
826 Ga0439449_0006931
827 Ga0439449_0011831
828 Ga0439449_0036529
829 Ga0439449_0042119
830 Ga0439452_009635
831 Ga0439455_0014358
832 Ga0439457_000264
833 Ga0439457_000643
834 Ga0439457_007639
835 Ga0439457_009346
836 Ga0439462_0002766
837 Ga0439462_0005991
838 Ga0439462_0019528
839 Ga0439462_0020043
840 Ga0439462_0040347
841 Ga0439463_047916
842 Ga0450919_000499
843 Ga0450920_001192
844 Ga0450920_016907
845 Ga0450897_002915
846 Ga0450900_002926
847 Ga0450900_012937
848 Ga0450907_000254
849 Ga0450907_020198
850 Ga0439446_0016159
851 Ga0450908_000671
852 Ga0450909_009900
853 Ga0439434_0000387
854 Ga0439434_0006225
855 Ga0450918_000368
856 Ga0466969_0039221
857 Ga0466966_0132802
858 Ga0466961_0003699
859 Ga0466961_0237836
860 Ga0466963_0004295
861 Ga0466963_0270582
862 Ga0466970_0000834
863 Ga0466970_0066533
864 Ga0466957_0008903
865 Ga0466960_0015998
866 Ga0466960_0068447
867 Ga0466959_0000799
868 Ga0466959_0010490
869 Ga0466958_0003715
870 Ga0466967_0065411
871 Ga0495617_005548
872 Ga0495627_014869
873 Ga0495603_0001171
874 Ga0495603_0002660
875 Ga0495629_0009008
876 Ga0495629_0039391
877 Ga0495629_0251015
878 Ga0495629_0348343
879 Ga0495638_0041226
880 Ga0495638_0081623
881 Ga0495641_0107930
882 Ga0495653_0049941
883 Ga0495580_0024638
884 Ga0495580_0111335
885 Ga0495582_0166744
886 Ga0495639_0004336
887 Ga0495639_0017136
888 Ga0495662_0006386
889 Ga0495662_0023658
890 Ga0495585_0021060
891 Ga0495585_0096343
892 Ga0495594_0018195
893 Ga0495594_0064694
894 Ga0495594_0297848
895 Ga0495606_0005896
896 Ga0495610_0005338
897 Ga0495610_0122853
898 Ga0495620_0088581
899 Ga0495631_0025732
900 Ga0495631_0084009
901 Ga0495642_0143521
902 Ga0495654_0011741
903 Ga0495665_0004689
904 Ga0495640_0018558
905 Ga0495640_0305721
906 Ga0495586_0056002
907 Ga0495586_0166742
908 Ga0495609_0048998
909 Ga0495645_0176389
910 Ga0495633_0088760
911 Ga0495633_0129813
912 Ga0495656_0001859
913 Ga0495656_0175484
914 Ga0495668_0095010
915 Ga0495668_0112280
916 Ga0495634_0311604
917 Ga0495611_0006633
918 Ga0495588_0008313
919 Ga0495588_0009277
920 Ga0495588_0029330
921 Ga0495588_0138631
922 Ga0495657_0016204
923 Ga0495623_0093891
924 Ga0495613_0006347
925 Ga0495613_0011715
926 Ga0495624_0149326
927 Ga0495670_0002428
928 Ga0495670_0044312
929 Ga0495670_0161844
930 Ga0495670_0239392
931 Ga0495671_0165066
932 Ga0495589_0004171
933 Ga0495589_0049647
934 Ga0495589_0066806
935 Ga0495600_0022880
936 Ga0495600_0132856
937 Ga0495581_0001990
938 Ga0495581_0165218
939 Ga0495604_0042657
940 Ga0495604_0202548
941 Ga0495636_0007527
942 Ga0495676_0014520
943 Ga0495680_0395240
944 Ga0495687_041695
945 Ga0495675_0059666
946 Ga0495677_0018583
947 Ga0495679_079620
948 Ga0495685_001500
949 Ga0495685_005425
950 Ga0495681_0018968
951 Ga0495681_0030870
952 Ga0495686_0038767
953 Ga0495593_0200868
954 Ga0495614_0080875
955 Ga0495626_0004356
956 Ga0496100_0058289
957 Ga0496100_0455443
958 Ga0496101_0599860
959 Ga0496102_0006769
960 Ga0496102_0076699
961 Ga0496102_0186804
962 Ga0496103_0012978
963 Ga0496103_0015531
964 Ga0496104_0128169
965 Ga0496104_0233412
966 Ga0496104_0447445
967 Ga0496105_0019239
968 Ga0496105_0031264
969 Ga0496105_0047263
970 Ga0496106_0065433
971 Ga0496106_0070624
972 Ga0496106_0157006
973 Ga0496107_0100495
974 Ga0496108_0034559
975 Ga0496108_0323777
976 Ga0496108_0355358
977 Ga0496109_0027664
978 Ga0496109_0130759
979 Ga0496109_0141698
980 Ga0496109_0146253
981 Ga0496109_0438112
982 Ga0496110_0073590
983 Ga0496110_0078705
984 Ga0496110_0080953
985 Ga0496110_0185017
986 Ga0496110_0219095
987 Ga0496111_0169668
988 Ga0496111_0235301
989 Ga0496112_0019113
990 Ga0496112_0421611
991 Ga0496112_0697116
992 Ga0496113_0096541
993 Ga0496113_0153795
994 Ga0496113_0297837
995 Ga0496113_0340643
996 Ga0496114_0011307
997 Ga0496114_0044913
998 Ga0496114_0052324
999 Ga0496114_0164788
1000 Ga0495678_031196
1001 Ga0501318_004994
1002 Ga0501321_008608
1003 Ga0501031_0004909
1004 Ga0501031_0146929
1005 Ga0501031_0278353
1006 Ga0501032_0034024
1007 Ga0501032_0068000
1008 Ga0501033_0027970
1009 Ga0501033_0105363
1010 Ga0501033_0240819
1011 Ga0501034_0027786
1012 Ga0501034_0082423
1013 Ga0501034_0197209
1014 Ga0501034_0469895
1015 Ga0501036_0007030
1016 Ga0501036_0010416
1017 Ga0501036_0038009
1018 Ga0501036_0334680
1019 Ga0501036_0401366
1020 Ga0501037_0005557
1021 Ga0501037_0006798
1022 Ga0501037_0014570
1023 Ga0501037_0049919
1024 Ga0501038_0009539
1025 Ga0501038_0036112
1026 Ga0501038_0150564
1027 Ga0501039_0010639
1028 Ga0501039_0044831
1029 Ga0501039_0231934
1030 Ga0501039_0381282
1031 Ga0501041_0007470
1032 Ga0501041_0417298
1033 Ga0501042_0002601
1034 Ga0501043_0003043
1035 Ga0501043_0006985
1036 Ga0501046_0003217
1037 Ga0501046_0042351
1038 Ga0501046_0042857
1039 Ga0501047_0106730
1040 Ga0501047_0209398
1041 Ga0501047_0325769
1042 Ga0501047_0575587
1043 Ga0501048_0014629
1044 Ga0501070_0002065
1045 Ga0501070_0054855
1046 Ga0501070_0109357
1047 Ga0501070_0110602
1048 Ga0501072_0018130
1049 Ga0501074_0003057
1050 Ga0501074_0127269
1051 Ga0501074_0277167
1052 Ga0501075_0009998
1053 Ga0501076_0002267
1054 Ga0501079_0012248
1055 Ga0501035_0000268
1056 Ga0501035_0327714
1057 Ga0501044_0017111
1058 Ga0501044_0054682
1059 Ga0501044_0126399
1060 Ga0501044_0313436
1061 Ga0501045_0000424
1062 Ga0501045_0148732
1063 Ga0501045_0282455
1064 nmdc:mga06z11_134882_c1
1065 nmdc:mga04h51_110335_c1
1066 nmdc:mga09592_16486_c1
1067 nmdc:mga0qj67_26_c1
1068 Ga0500560_000597
1069 Ga0500652_031344
1070 Ga0500568_0007195
1071 Ga0500600_0197201
1072 Ga0501082_0015559
1073 Ga0466962_0054091
1074 Ga0530510_0006626
1075 2785369656
1076 2501944961
1077 2515495496
1078 2515720258
1079 2515755999
1080 2516084414
1081 2516089663
1082 2537898225
1083 2585310226
1084 2585313642
1085 2616694918
1086 2623585232
1087 2643765104
1088 2644262481
1089 2644390050
1090 2644461057
1091 2676201195
1092 2691512704
1093 2723641309
1094 2784588742
1095 2785343148
1096 2786670743
1097 2804845946
1098 2808871878
1099 2808894237
1100 2808897861
1101 2809232350
1102 2810363080
1103 2812357942
1104 2812480389
1105 2819426043
1106 2831937100
1107 2832010195
1108 2844851633
1109 2852636514
1110 2855687012
1111 2856859063
1112 2857741631
1113 2858874489
1114 2858902764
1115 2861527168
1116 2862179346
1117 2862511661
1118 2866069743
1119 2867306115
1120 2867317313
1121 2867323130
1122 2867348940
1123 2867431173
1124 2867510728
1125 2877680968
1126 2902584666
1127 2904497907
1128 2904778927
1129 2905930819
1130 2910811582
1131 2912719809
1132 2919037974
1133 2919063140
1134 2919391646
1135 2919445708
1136 2919448252
1137 2919539398
1138 2933420084
1139 2935410722
1140 2939600628
1141 2939647052
1142 2939678731
1143 2945923796
1144 2945944557
1145 2945957255
1146 2946006960
1147 2946024693
1148 2946040463
1149 2946059894
1150 2946067911
1151 2947229050
1152 2954001725
1153 2954386074
1154 2954677067
1155 2954687089
1156 2954696722
1157 2954705439
1158 2954716077
1159 2954726022
1160 2954735780
1161 2954744957
1162 2954754645
1163 2954763944
1164 2990063227
1165 2996222104
1166 3006325176
1167 3006428829
1168 649812978
1169 8003858080
1170 8003870861
1171 8008490291
1172 8025414140
1173 8025529593
1174 8054110156
1175 8055416158
1176 8056673026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8076 51 183
5thz-assembly2.cif.gz_A crystal structure of curj carbon methyltransferase 0.7865 76 180
5mpt-assembly1.cif.gz_A structure of the citrinin polyketide synthase cmet domain 0.7777 76 186
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.7721 51 179
3tky-assembly2.cif.gz_D monolignol o-methyltransferase (momt) 0.7719 75 182
ID Description Score Start End Superfamily
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7799 51 179 3.40.50.150
af_Q96IZ6_183_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7587 79 182 3.40.50.150
af_B4FY91_102_330_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7559 80 182 3.40.50.150
af_Q9LPU7_127_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7508 75 180 3.40.50.150
af_Q9MAP0_102_350_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7452 75 182 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4R7LIU7-F1-model_v4 Methyltransferase family protein 1.001 58 298
AF-N1V661-F1-model_v4 Methylase 0.995 60 297
AF-A0A0A1D0A7-F1-model_v4 Methylase 0.9943 60 298
AF-A0A6J7E4L4-F1-model_v4 Unannotated protein 0.9921 213 298
AF-A0A1R4F7J8-F1-model_v4 Uncharacterized protein SCO4203 0.9914 60 298

Map