F466818

General Info

Members Datasets Scaffolds Average Seq Length
588 243 588 77

Family's Representative Sequence

Representative Sequence 3300053739|Ga0500587_016627|Ga0500587_016627_529_819
Length 96
Sequence LKKATLQELSNFVELKNHFMAVQVIVFGQLTDILGNSPVNVEGVADTSELVAQLNQRYPALTNAPYIIAVDKQIVNGNTALAGNNTVALLPPFAGG

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
167 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
168 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
171 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
179 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
214 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
228 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
229 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
236 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
237 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
243 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 1.19
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c019560 3300000041 Bacteria 602
2 ARcpr5yngRDRAFT_c013356 3300000043 Bacteria 691
3 ARSoilOldRDRAFT_c023452 3300000044 Bacteria 553
4 JGI24743J22301_10083694 3300001991 Unclassified 675
5 JGI24744J21845_10058120 3300002077 Unclassified 709
6 JGI25154J39366_1016321 3300002738 Bacteria 753
7 rootH2_10190875 3300003320 Bacteria 1321
8 rootL2_10171171 3300003322 Bacteria 1679
9 rootH1_10054153 3300003323 Bacteria 2722
10 Ga0065714_10198895 3300005288 Unclassified 893
11 Ga0065704_10091501 3300005289 Unclassified 2713
12 Ga0065704_10602527 3300005289 Bacteria 606
13 Ga0065712_10077592 3300005290 Bacteria 3465
14 Ga0065712_10134098 3300005290 Unclassified 1471
15 Ga0065712_10287453 3300005290 Unclassified 879
16 Ga0065712_10293476 3300005290 Bacteria 873
17 Ga0065715_10019353 3300005293 Unclassified 1754
18 Ga0065715_10273100 3300005293 Unclassified 1106
19 Ga0065715_10451627 3300005293 Unclassified 741
20 Ga0065715_11170100 3300005293 Unclassified 504
21 Ga0065707_10022333 3300005295 Unclassified 1813
22 Ga0065707_10165567 3300005295 Bacteria 1525
23 Ga0065707_10448943 3300005295 Unclassified 802
24 Ga0070676_10014248 3300005328 Unclassified 4369
25 Ga0070683_100204187 3300005329 Unclassified 1877
26 Ga0070690_100270516 3300005330 Bacteria 1208
27 Ga0070670_100038715 3300005331 Bacteria 4100
28 Ga0070670_100300457 3300005331 Bacteria 1404
29 Ga0070670_100707651 3300005331 Bacteria 906
30 Ga0070670_101197380 3300005331 Bacteria 694
31 Ga0070677_10263826 3300005333 Bacteria 861
32 Ga0070677_10313675 3300005333 Unclassified 801
33 Ga0068869_100032681 3300005334 Unclassified 3668
34 Ga0068869_100079604 3300005334 Unclassified 2442
35 Ga0068869_101217139 3300005334 Unclassified 662
36 Ga0068869_101408855 3300005334 Bacteria 617
37 Ga0070666_10741832 3300005335 Bacteria 721
38 Ga0070666_10826864 3300005335 Unclassified 683
39 Ga0070682_101446636 3300005337 Bacteria 589
40 Ga0068868_100024597 3300005338 Bacteria 4572
41 Ga0068868_100210932 3300005338 Bacteria 1623
42 Ga0068868_100606692 3300005338 Unclassified 970
43 Ga0068868_101663998 3300005338 Unclassified 601
44 Ga0070689_100019130 3300005340 Bacteria 5059
45 Ga0070689_100040492 3300005340 Bacteria 3573
46 Ga0070689_100068440 3300005340 Bacteria 2769
47 Ga0070687_100156614 3300005343 Bacteria 1342
48 Ga0070687_100601345 3300005343 Bacteria 755
49 Ga0070661_101899658 3300005344 Bacteria 506
50 Ga0070668_100005828 3300005347 Bacteria 9138
51 Ga0070668_100125658 3300005347 Bacteria 2054
52 Ga0070669_100038346 3300005353 Unclassified 3478
53 Ga0070669_100072872 3300005353 Bacteria 2544
54 Ga0070669_100137279 3300005353 Bacteria 1882
55 Ga0070669_101592448 3300005353 Bacteria 569
56 Ga0070669_101678048 3300005353 Unclassified 554
57 Ga0070675_100075014 3300005354 Bacteria 2811
58 Ga0070675_100155160 3300005354 Bacteria 1965
59 Ga0070675_100463979 3300005354 Bacteria 1137
60 Ga0070675_100889776 3300005354 Unclassified 816
61 Ga0070675_101004958 3300005354 Bacteria 766
62 Ga0070671_100514063 3300005355 Bacteria 1031
63 Ga0070674_100002262 3300005356 Bacteria 10628
64 Ga0070674_100037295 3300005356 Unclassified 3269
65 Ga0070673_100028166 3300005364 Bacteria 4175
66 Ga0070673_100043512 3300005364 Bacteria 3471
67 Ga0070673_100233601 3300005364 Unclassified 1596
68 Ga0070673_100642412 3300005364 Bacteria 971
69 Ga0070673_101108604 3300005364 Bacteria 739
70 Ga0070673_101539764 3300005364 Bacteria 627
71 Ga0070673_101703307 3300005364 Bacteria 596
72 Ga0070673_102357824 3300005364 Bacteria 506
73 Ga0070688_100051239 3300005365 Unclassified 2575
74 Ga0070688_100089746 3300005365 Bacteria 2006
75 Ga0070688_100363963 3300005365 Bacteria 1062
76 Ga0070688_100384287 3300005365 Unclassified 1035
77 Ga0070688_100919032 3300005365 Unclassified 691
78 Ga0070688_101285714 3300005365 Bacteria 590
79 Ga0070667_100044780 3300005367 Bacteria 3718
80 Ga0070667_100147215 3300005367 Unclassified 2066
81 Ga0070667_100387567 3300005367 Bacteria 1270
82 Ga0070667_101624042 3300005367 Unclassified 608
83 Ga0070667_101877193 3300005367 Bacteria 564
84 Ga0070705_100411366 3300005440 Bacteria 1004
85 Ga0070700_101184056 3300005441 Bacteria 637
86 Ga0070700_101249204 3300005441 Bacteria 622
87 Ga0070700_101366520 3300005441 Bacteria 597
88 Ga0070700_101606815 3300005441 Unclassified 555
89 Ga0070694_101719674 3300005444 Bacteria 534
90 Ga0070663_102016675 3300005455 Unclassified 519
91 Ga0070678_100280384 3300005456 Bacteria 1409
92 Ga0070662_100051494 3300005457 Unclassified 2974
93 Ga0068867_100003798 3300005459 Bacteria 10626
94 Ga0068867_100215252 3300005459 Unclassified 1545
95 Ga0068867_100819270 3300005459 Bacteria 832
96 Ga0068867_101536767 3300005459 Unclassified 621
97 Ga0068867_101671655 3300005459 Bacteria 596
98 Ga0068867_102336363 3300005459 Bacteria 508
99 Ga0070685_10011303 3300005466 Bacteria 4674
100 Ga0070685_10168903 3300005466 Unclassified 1400
101 Ga0070685_10576485 3300005466 Bacteria 806
102 Ga0070707_101170133 3300005468 Bacteria 735
103 Ga0070698_100068393 3300005471 Bacteria 3569
104 Ga0070684_100044635 3300005535 Unclassified 3835
105 Ga0068853_100052550 3300005539 Unclassified 3509
106 Ga0068853_100079979 3300005539 Bacteria 2859
107 Ga0068853_100618419 3300005539 Unclassified 1029
108 Ga0068853_100914221 3300005539 Bacteria 843
109 Ga0068853_101250569 3300005539 Unclassified 717
110 Ga0070672_100041352 3300005543 Unclassified 3543
111 Ga0070672_100597881 3300005543 Unclassified 961
112 Ga0070672_100776585 3300005543 Bacteria 842
113 Ga0070686_100794124 3300005544 Unclassified 762
114 Ga0070686_101469819 3300005544 Bacteria 573
115 Ga0070696_101286485 3300005546 Bacteria 620
116 Ga0070693_100152854 3300005547 Bacteria 1463
117 Ga0070665_100016621 3300005548 Bacteria 7373
118 Ga0070665_100057795 3300005548 Unclassified 3889
119 Ga0070704_100188326 3300005549 Unclassified 1657
120 Ga0070704_100276848 3300005549 Bacteria 1388
121 Ga0068855_100306408 3300005563 Bacteria 1758
122 Ga0070664_100073067 3300005564 Unclassified 2942
123 Ga0070664_100723512 3300005564 Bacteria 928
124 Ga0070664_100823153 3300005564 Bacteria 869
125 Ga0070664_101356789 3300005564 Bacteria 672
126 Ga0068857_100509685 3300005577 Bacteria 1130
127 Ga0068857_100577614 3300005577 Bacteria 1061
128 Ga0068854_101027636 3300005578 Bacteria 731
129 Ga0068854_101029637 3300005578 Bacteria 730
130 Ga0068854_101404307 3300005578 Bacteria 631
131 Ga0070702_100677848 3300005615 Bacteria 783
132 Ga0068852_100282762 3300005616 Unclassified 1600
133 Ga0068852_101755126 3300005616 Unclassified 643
134 Ga0068859_100004404 3300005617 Bacteria 14371
135 Ga0068859_100038311 3300005617 Unclassified 4810
136 Ga0068859_100114512 3300005617 Bacteria 2761
137 Ga0068859_100214701 3300005617 Bacteria 2011
138 Ga0068859_100218717 3300005617 Bacteria 1992
139 Ga0068859_100239690 3300005617 Bacteria 1902
140 Ga0068859_100304908 3300005617 Bacteria 1686
141 Ga0068859_101294357 3300005617 Unclassified 803
142 Ga0068859_101415404 3300005617 Bacteria 767
143 Ga0068859_102101044 3300005617 Bacteria 623
144 Ga0068864_100023053 3300005618 Bacteria 5226
145 Ga0068864_100524555 3300005618 Bacteria 1142
146 Ga0068864_100525501 3300005618 Bacteria 1141
147 Ga0068864_101201957 3300005618 Unclassified 757
148 Ga0068864_101353101 3300005618 Bacteria 713
149 Ga0068864_101711874 3300005618 Bacteria 633
150 Ga0068864_102330539 3300005618 Bacteria 542
151 Ga0068866_10053790 3300005718 Bacteria 2060
152 Ga0068866_11089471 3300005718 Bacteria 572
153 Ga0068861_100191358 3300005719 Bacteria 1710
154 Ga0068861_100330256 3300005719 Bacteria 1331
155 Ga0068861_100487175 3300005719 Unclassified 1112
156 Ga0068861_101143043 3300005719 Unclassified 750
157 Ga0068861_101373559 3300005719 Bacteria 689
158 Ga0068861_102421600 3300005719 Bacteria 528
159 Ga0068870_10039824 3300005840 Bacteria 2433
160 Ga0068870_10246999 3300005840 Bacteria 1104
161 Ga0068863_100395807 3300005841 Unclassified 1350
162 Ga0068863_100597451 3300005841 Bacteria 1092
163 Ga0068863_100747867 3300005841 Bacteria 973
164 Ga0068863_100766508 3300005841 Bacteria 961
165 Ga0068863_100815032 3300005841 Unclassified 931
166 Ga0068863_101031498 3300005841 Bacteria 826
167 Ga0068858_100127805 3300005842 Unclassified 2381
168 Ga0068858_100129440 3300005842 Unclassified 2366
169 Ga0068858_101660440 3300005842 Bacteria 631
170 Ga0068858_101986715 3300005842 Bacteria 575
171 Ga0068860_100066104 3300005843 Bacteria 3434
172 Ga0068860_100092893 3300005843 Bacteria 2875
173 Ga0068860_100144518 3300005843 Unclassified 2288
174 Ga0068860_100289886 3300005843 Bacteria 1601
175 Ga0068860_100348859 3300005843 Bacteria 1456
176 Ga0068860_102161698 3300005843 Unclassified 578
177 Ga0068862_100050350 3300005844 Unclassified 3560
178 Ga0068862_100739135 3300005844 Bacteria 956
179 Ga0068862_100939108 3300005844 Bacteria 852
180 Ga0068862_101031949 3300005844 Bacteria 815
181 Ga0068862_101912446 3300005844 Bacteria 603
182 Ga0075366_10013347 3300006195 Bacteria 4675
183 Ga0075366_10079110 3300006195 Bacteria 1962
184 Ga0075366_10090286 3300006195 Bacteria 1835
185 Ga0075366_10190269 3300006195 Bacteria 1247
186 Ga0075366_10234308 3300006195 Unclassified 1119
187 Ga0097621_100006252 3300006237 Bacteria 8451
188 Ga0097621_100036651 3300006237 Unclassified 3924
189 Ga0097621_100572893 3300006237 Unclassified 1029
190 Ga0097621_100735477 3300006237 Bacteria 910
191 Ga0097621_102144460 3300006237 Bacteria 534
192 Ga0097621_102183760 3300006237 Bacteria 529
193 Ga0068871_100028294 3300006358 Bacteria 4393
194 Ga0068871_100359833 3300006358 Bacteria 1289
195 Ga0068871_100473591 3300006358 Unclassified 1125
196 Ga0068871_101239007 3300006358 Unclassified 700
197 Ga0068871_101541575 3300006358 Bacteria 628
198 Ga0075428_100006620 3300006844 Bacteria 12891
199 Ga0075428_100120899 3300006844 Bacteria 2852
200 Ga0075428_102758584 3300006844 Bacteria 500
201 Ga0075430_100188341 3300006846 Bacteria 1715
202 Ga0075430_100569402 3300006846 Bacteria 934
203 Ga0075431_100000866 3300006847 Bacteria 26579
204 Ga0075431_100775352 3300006847 Bacteria 933
205 Ga0075431_101158091 3300006847 Bacteria 737
206 Ga0075434_102313250 3300006871 Bacteria 540
207 Ga0075429_100006687 3300006880 Bacteria 9994
208 Ga0075429_100009709 3300006880 Bacteria 8341
209 Ga0075429_100165515 3300006880 Bacteria 1937
210 Ga0068865_100004271 3300006881 Bacteria 8620
211 Ga0068865_100141827 3300006881 Unclassified 1813
212 Ga0068865_101135540 3300006881 Bacteria 689
213 Ga0068865_101339377 3300006881 Bacteria 637
214 Ga0097620_100004404 3300006931 Bacteria 14371
215 Ga0097620_100038312 3300006931 Unclassified 4810
216 Ga0097620_100114503 3300006931 Bacteria 2761
217 Ga0097620_100214718 3300006931 Bacteria 2011
218 Ga0097620_100218737 3300006931 Bacteria 1992
219 Ga0097620_100239699 3300006931 Bacteria 1902
220 Ga0097620_100304931 3300006931 Bacteria 1686
221 Ga0097620_101294580 3300006931 Unclassified 803
222 Ga0097620_101415290 3300006931 Bacteria 767
223 Ga0097620_102101023 3300006931 Bacteria 623
224 Ga0105240_10781773 3300009093 Bacteria 1035
225 Ga0111539_10095344 3300009094 Bacteria 3495
226 Ga0111539_10124969 3300009094 Bacteria 3015
227 Ga0111539_10246021 3300009094 Bacteria 2082
228 Ga0111539_10531161 3300009094 Bacteria 1371
229 Ga0111539_10742612 3300009094 Bacteria 1142
230 Ga0111539_13162744 3300009094 Bacteria 531
231 Ga0105245_10567915 3300009098 Bacteria 1158
232 Ga0105245_13133618 3300009098 Bacteria 512
233 Ga0105247_10007209 3300009101 Bacteria 6826
234 Ga0105247_10350512 3300009101 Bacteria 1038
235 Ga0114129_10001572 3300009147 Bacteria 31003
236 Ga0114129_10003569 3300009147 Bacteria 21902
237 Ga0114129_10114463 3300009147 Bacteria 3719
238 Ga0114129_10259114 3300009147 Bacteria 2332
239 Ga0114129_10535051 3300009147 Bacteria 1526
240 Ga0105241_10070874 3300009174 Bacteria 2705
241 Ga0105241_10210813 3300009174 Bacteria 1628
242 Ga0105241_11227681 3300009174 Bacteria 711
243 Ga0105241_11645805 3300009174 Bacteria 622
244 Ga0105242_10025664 3300009176 Unclassified 4665
245 Ga0105242_10177261 3300009176 Unclassified 1878
246 Ga0105242_10250957 3300009176 Bacteria 1594
247 Ga0105242_10269261 3300009176 Unclassified 1542
248 Ga0105242_11648972 3300009176 Bacteria 676
249 Ga0105242_12121081 3300009176 Bacteria 606
250 Ga0105242_13037424 3300009176 Bacteria 520
251 Ga0105248_10225161 3300009177 Unclassified 2111
252 Ga0105248_10834133 3300009177 Bacteria 1040
253 Ga0105248_11523997 3300009177 Bacteria 757
254 Ga0105248_11999878 3300009177 Unclassified 658
255 Ga0105237_10012365 3300009545 Bacteria 8995
256 Ga0105249_10015498 3300009553 Bacteria 6747
257 Ga0105249_10020990 3300009553 Bacteria 5844
258 Ga0105249_10055960 3300009553 Bacteria 3611
259 Ga0105249_10146222 3300009553 Unclassified 2271
260 Ga0105249_10154060 3300009553 Bacteria 2215
261 Ga0105249_11099725 3300009553 Unclassified 865
262 Ga0105249_11331084 3300009553 Unclassified 790
263 Ga0105249_11984712 3300009553 Unclassified 655
264 Ga0105239_10006184 3300010375 Bacteria 13934
265 Ga0105239_11150146 3300010375 Unclassified 894
266 Ga0105239_11543578 3300010375 Bacteria 768
267 Ga0105246_10087749 3300011119 Bacteria 2233
268 Ga0105246_10118181 3300011119 Unclassified 1960
269 Ga0157373_11550886 3300013100 Unclassified 506
270 Ga0157370_10270778 3300013104 Unclassified 1569
271 Ga0157370_10391965 3300013104 Bacteria 1279
272 Ga0157370_10795013 3300013104 Bacteria 861
273 Ga0157374_10055794 3300013296 Bacteria 3688
274 Ga0157374_10117992 3300013296 Bacteria 2558
275 Ga0157374_11397124 3300013296 Bacteria 723
276 Ga0157378_10661608 3300013297 Bacteria 1061
277 Ga0157378_10731467 3300013297 Bacteria 1011
278 Ga0157378_11525129 3300013297 Bacteria 713
279 Ga0163162_10029655 3300013306 Bacteria 5416
280 Ga0163162_10088421 3300013306 Unclassified 3177
281 Ga0163162_10803864 3300013306 Bacteria 1058
282 Ga0157372_10991725 3300013307 Unclassified 973
283 Ga0157372_11169548 3300013307 Unclassified 889
284 Ga0157372_12595780 3300013307 Unclassified 581
285 Ga0157372_12658660 3300013307 Bacteria 574
286 Ga0157375_10072939 3300013308 Bacteria 3451
287 Ga0157375_10743772 3300013308 Bacteria 1132
288 Ga0157375_12604388 3300013308 Bacteria 604
289 Ga0157375_12631231 3300013308 Bacteria 601
290 Ga0163163_10057069 3300014325 Unclassified 3860
291 Ga0163163_10112665 3300014325 Bacteria 2750
292 Ga0163163_10549203 3300014325 Bacteria 1218
293 Ga0163163_10564483 3300014325 Unclassified 1201
294 Ga0157380_10024955 3300014326 Bacteria 4529
295 Ga0157380_10029842 3300014326 Bacteria 4170
296 Ga0157380_10215075 3300014326 Bacteria 1716
297 Ga0157380_10356885 3300014326 Bacteria 1370
298 Ga0157380_10390375 3300014326 Bacteria 1317
299 Ga0157380_10458256 3300014326 Bacteria 1227
300 Ga0157380_10730576 3300014326 Bacteria 999
301 Ga0157380_10812123 3300014326 Bacteria 953
302 Ga0157380_11568759 3300014326 Bacteria 713
303 Ga0157380_13203270 3300014326 Bacteria 523
304 Ga0157377_10089403 3300014745 Unclassified 1816
305 Ga0157377_10230051 3300014745 Bacteria 1191
306 Ga0157377_10342956 3300014745 Unclassified 1000
307 Ga0157379_10155294 3300014968 Unclassified 2064
308 Ga0157379_10228373 3300014968 Unclassified 1687
309 Ga0157379_11601596 3300014968 Bacteria 636
310 Ga0157379_12042297 3300014968 Unclassified 567
311 Ga0157376_10263681 3300014969 Unclassified 1615
312 Ga0157376_10266247 3300014969 Unclassified 1608
313 Ga0157376_10546771 3300014969 Bacteria 1145
314 Ga0157376_10601837 3300014969 Bacteria 1094
315 Ga0157376_12519585 3300014969 Bacteria 554
316 Ga0163161_10000890 3300017792 Bacteria 23195
317 Ga0163161_10273208 3300017792 Bacteria 1323
318 Ga0163161_10431474 3300017792 Unclassified 1062
319 Ga0163161_10652137 3300017792 Bacteria 872
320 Ga0163161_10750855 3300017792 Bacteria 816
321 Ga0163161_11355543 3300017792 Bacteria 620
322 Ga0163161_11389554 3300017792 Unclassified 613
323 Ga0209646_1005623 3300025246 Bacteria 2166
324 Ga0207697_10162640 3300025315 Bacteria 974
325 Ga0207697_10190333 3300025315 Bacteria 901
326 Ga0207656_10026103 3300025321 Unclassified 2378
327 Ga0207642_10027412 3300025899 Unclassified 2331
328 Ga0207710_10000852 3300025900 Bacteria 16442
329 Ga0207688_10013484 3300025901 Unclassified 4442
330 Ga0207680_10029382 3300025903 Unclassified 3087
331 Ga0207645_10001934 3300025907 Bacteria 16720
332 Ga0207645_10096614 3300025907 Unclassified 1903
333 Ga0207643_10005138 3300025908 Bacteria 7002
334 Ga0207643_10030001 3300025908 Bacteria 3025
335 Ga0207654_11030141 3300025911 Unclassified 599
336 Ga0207654_11149054 3300025911 Unclassified 566
337 Ga0207695_10634553 3300025913 Bacteria 949
338 Ga0207662_10021709 3300025918 Unclassified 3673
339 Ga0207646_10204874 3300025922 Bacteria 1782
340 Ga0207646_11410182 3300025922 Bacteria 606
341 Ga0207681_10020255 3300025923 Unclassified 4212
342 Ga0207681_10138611 3300025923 Unclassified 1809
343 Ga0207681_11622583 3300025923 Bacteria 541
344 Ga0207681_11800925 3300025923 Bacteria 511
345 Ga0207650_10057288 3300025925 Unclassified 2898
346 Ga0207650_10911328 3300025925 Bacteria 746
347 Ga0207659_10028420 3300025926 Bacteria 3801
348 Ga0207659_10050201 3300025926 Bacteria 2963
349 Ga0207659_10136972 3300025926 Unclassified 1896
350 Ga0207659_10730629 3300025926 Unclassified 849
351 Ga0207659_11408963 3300025926 Bacteria 597
352 Ga0207644_10427397 3300025931 Unclassified 1086
353 Ga0207644_10690339 3300025931 Unclassified 851
354 Ga0207644_11707347 3300025931 Bacteria 527
355 Ga0207706_10027723 3300025933 Bacteria 5064
356 Ga0207706_11411285 3300025933 Bacteria 571
357 Ga0207686_10138188 3300025934 Unclassified 1680
358 Ga0207686_10170855 3300025934 Unclassified 1533
359 Ga0207686_10262791 3300025934 Unclassified 1266
360 Ga0207686_10600542 3300025934 Bacteria 866
361 Ga0207686_10816629 3300025934 Bacteria 748
362 Ga0207670_10062831 3300025936 Bacteria 2539
363 Ga0207670_10110623 3300025936 Unclassified 1979
364 Ga0207670_10233537 3300025936 Unclassified 1413
365 Ga0207669_10684285 3300025937 Unclassified 842
366 Ga0207669_10755534 3300025937 Bacteria 803
367 Ga0207704_10020737 3300025938 Unclassified 3484
368 Ga0207704_10238726 3300025938 Unclassified 1356
369 Ga0207704_10489295 3300025938 Bacteria 989
370 Ga0207704_11190977 3300025938 Bacteria 649
371 Ga0207691_10201402 3300025940 Unclassified 1732
372 Ga0207691_10595724 3300025940 Unclassified 936
373 Ga0207691_10903708 3300025940 Unclassified 739
374 Ga0207691_11139245 3300025940 Bacteria 648
375 Ga0207711_10515604 3300025941 Bacteria 1115
376 Ga0207689_10015791 3300025942 Bacteria 6393
377 Ga0207689_10067860 3300025942 Unclassified 2930
378 Ga0207689_10104803 3300025942 Unclassified 2324
379 Ga0207689_10215348 3300025942 Unclassified 1587
380 Ga0207661_10988072 3300025944 Unclassified 775
381 Ga0207679_10257658 3300025945 Unclassified 1486
382 Ga0207679_11399723 3300025945 Bacteria 642
383 Ga0207667_10183389 3300025949 Bacteria 2149
384 Ga0207651_10031755 3300025960 Bacteria 3381
385 Ga0207651_10044105 3300025960 Bacteria 2982
386 Ga0207651_12036760 3300025960 Bacteria 516
387 Ga0207712_10026024 3300025961 Bacteria 3894
388 Ga0207712_10042119 3300025961 Unclassified 3143
389 Ga0207712_10144811 3300025961 Bacteria 1828
390 Ga0207712_10171962 3300025961 Unclassified 1694
391 Ga0207712_10551407 3300025961 Unclassified 991
392 Ga0207712_10713789 3300025961 Bacteria 876
393 Ga0207712_11461293 3300025961 Bacteria 612
394 Ga0207668_10098877 3300025972 Bacteria 2163
395 Ga0207668_10265856 3300025972 Bacteria 1400
396 Ga0207668_10276264 3300025972 Bacteria 1375
397 Ga0207668_10952283 3300025972 Bacteria 766
398 Ga0207640_10153003 3300025981 Bacteria 1697
399 Ga0207640_10591306 3300025981 Bacteria 938
400 Ga0207640_11644422 3300025981 Bacteria 579
401 Ga0207658_10046164 3300025986 Unclassified 3180
402 Ga0207658_10109364 3300025986 Unclassified 2182
403 Ga0207658_10158804 3300025986 Unclassified 1851
404 Ga0207658_10509640 3300025986 Unclassified 1073
405 Ga0207677_10355045 3300026023 Bacteria 1230
406 Ga0207677_10460297 3300026023 Bacteria 1092
407 Ga0207677_10505142 3300026023 Bacteria 1046
408 Ga0207703_10938205 3300026035 Unclassified 829
409 Ga0207639_10201451 3300026041 Unclassified 1707
410 Ga0207639_10213057 3300026041 Unclassified 1664
411 Ga0207639_11851134 3300026041 Unclassified 564
412 Ga0207678_10696207 3300026067 Bacteria 894
413 Ga0207708_10345876 3300026075 Unclassified 1219
414 Ga0207702_10196986 3300026078 Unclassified 1865
415 Ga0207641_10000380 3300026088 Bacteria 52801
416 Ga0207641_10210850 3300026088 Unclassified 1796
417 Ga0207641_10507230 3300026088 Bacteria 1172
418 Ga0207641_10509003 3300026088 Bacteria 1170
419 Ga0207641_11047549 3300026088 Bacteria 813
420 Ga0207641_11852119 3300026088 Unclassified 605
421 Ga0207648_10003538 3300026089 Bacteria 16338
422 Ga0207648_10110130 3300026089 Unclassified 2418
423 Ga0207648_10361881 3300026089 Bacteria 1309
424 Ga0207648_11648571 3300026089 Bacteria 602
425 Ga0207676_10018751 3300026095 Bacteria 5037
426 Ga0207676_10068244 3300026095 Bacteria 2843
427 Ga0207676_10133718 3300026095 Unclassified 2113
428 Ga0207676_10421707 3300026095 Bacteria 1252
429 Ga0207676_10774923 3300026095 Unclassified 934
430 Ga0207676_12445771 3300026095 Bacteria 519
431 Ga0207674_10233105 3300026116 Bacteria 1789
432 Ga0207675_100184283 3300026118 Unclassified 2000
433 Ga0207675_100748762 3300026118 Unclassified 988
434 Ga0207675_101063907 3300026118 Unclassified 828
435 Ga0207675_101354720 3300026118 Bacteria 732
436 Ga0207675_101615391 3300026118 Bacteria 669
437 Ga0207675_101817623 3300026118 Bacteria 628
438 Ga0207683_10000691 3300026121 Bacteria 30953
439 Ga0207683_10049417 3300026121 Bacteria 3682
440 Ga0207698_10375963 3300026142 Unclassified 1350
441 Ga0207698_10477512 3300026142 Unclassified 1209
442 Ga0207698_10977676 3300026142 Bacteria 856
443 Ga0207698_11181630 3300026142 Bacteria 779
444 Ga0207698_11367266 3300026142 Bacteria 723
445 Ga0209996_1037412 3300027395 Bacteria 717
446 Ga0207428_10575838 3300027907 Bacteria 813
447 Ga0207428_10900508 3300027907 Unclassified 625
448 Ga0268266_10011708 3300028379 Bacteria 7610
449 Ga0268266_10064584 3300028379 Unclassified 3163
450 Ga0268265_10301992 3300028380 Unclassified 1442
451 Ga0268265_11554151 3300028380 Bacteria 666
452 Ga0268265_12177172 3300028380 Unclassified 561
453 Ga0268265_12364993 3300028380 Bacteria 538
454 Ga0268264_10044674 3300028381 Bacteria 3675
455 Ga0268264_10122469 3300028381 Unclassified 2294
456 Ga0268264_10171452 3300028381 Unclassified 1963
457 Ga0268264_11981028 3300028381 Bacteria 592
458 Ga0307512_10340977 3300030522 Bacteria 667
459 Ga0307512_10427024 3300030522 Bacteria 545
460 Ga0265327_10007307 3300031251 Bacteria 8564
461 Ga0265327_10173025 3300031251 Bacteria 991
462 Ga0307513_10210849 3300031456 Bacteria 1774
463 Ga0307513_10859008 3300031456 Unclassified 614
464 Ga0307513_10918808 3300031456 Bacteria 583
465 Ga0307509_10107276 3300031507 Bacteria 2809
466 Ga0307516_10501757 3300031730 Bacteria 868
467 Ga0307416_103479472 3300032002 Unclassified 527
468 Ga0307414_10034778 3300032004 Bacteria 3346
469 Ga0373943_0726622 3300035170 Bacteria 589
470 Ga0373946_0372405 3300035171 Bacteria 717
471 Ga0373931_1280048 3300035691 Bacteria 504
472 Ga0373927_0721733 3300035695 Bacteria 658
473 Ga0373937_0585538 3300036401 Bacteria 1059
474 Ga0439436_0012382 3300041404 Bacteria 2590
475 Ga0439453_0046763 3300041408 Bacteria 864
476 Ga0451795_0056838 3300041456 Bacteria 698
477 Ga0451800_0429729 3300041459 Bacteria 703
478 Ga0451802_0622033 3300041460 Bacteria 734
479 Ga0451802_1058775 3300041460 Bacteria 502
480 Ga0451804_0981626 3300041463 Bacteria 617
481 Ga0451807_2307153 3300041486 Unclassified 620
482 Ga0451841_0886561 3300041498 Bacteria 1103
483 Ga0451853_0925210 3300041512 Bacteria 635
484 Ga0451853_1010871 3300041512 Bacteria 506
485 Ga0451853_3208196 3300041512 Bacteria 1012
486 Ga0451853_3668395 3300041512 Bacteria 1447
487 Ga0451853_4052459 3300041512 Bacteria 523
488 Ga0439449_0014815 3300042007 Bacteria 2930
489 Ga0439457_000827 3300042014 Bacteria 9289
490 Ga0439462_0052773 3300042015 Bacteria 1094
491 Ga0450922_038939 3300042124 Bacteria 534
492 Ga0450898_052481 3300042134 Bacteria 790
493 Ga0439434_0318531 3300042435 Bacteria 540
494 Ga0439435_0174463 3300042436 Bacteria 700
495 Ga0451577_0605583 3300042876 Unclassified 994
496 Ga0466969_0000103 3300044656 Bacteria 44804
497 Ga0466972_0000012 3300044658 Bacteria 246338
498 Ga0466972_0110891 3300044658 Bacteria 1296
499 Ga0466965_0272273 3300044683 Bacteria 913
500 Ga0466965_0695624 3300044683 Unclassified 583
501 Ga0466966_0000097 3300044684 Bacteria 53836
502 Ga0453684_0183994 3300044712 Unclassified 2450
503 Ga0466968_0230113 3300044735 Bacteria 875
504 Ga0466970_0740258 3300044765 Bacteria 574
505 Ga0466957_0009079 3300044842 Bacteria 5667
506 Ga0466957_0014317 3300044842 Bacteria 4618
507 Ga0466959_0000049 3300045049 Bacteria 83496
508 Ga0495638_0069041 3300046460 Unclassified 2166
509 Ga0495607_0101333 3300046501 Unclassified 1542
510 Ga0495607_0115363 3300046501 Unclassified 1418
511 Ga0495632_0122710 3300046519 Bacteria 1213
512 Ga0495632_0489216 3300046519 Bacteria 531
513 Ga0495643_0063325 3300046522 Bacteria 1956
514 Ga0495654_0239044 3300046530 Unclassified 761
515 Ga0495598_0189939 3300046537 Bacteria 737
516 Ga0495621_0028583 3300046539 Unclassified 1896
517 Ga0495621_0116299 3300046539 Bacteria 1030
518 Ga0495668_0000489 3300046616 Bacteria 49613
519 Ga0495670_0053912 3300046691 Bacteria 2014
520 Ga0495686_0061584 3300047472 Unclassified 2330
521 Ga0495686_0188332 3300047472 Bacteria 1191
522 Ga0496111_0931224 3300048914 Bacteria 625
523 Ga0496126_0795040 3300048929 Bacteria 726
524 Ga0501031_0400454 3300049568 Bacteria 888
525 Ga0501033_0175488 3300049570 Unclassified 1538
526 Ga0501034_0637895 3300049571 Unclassified 968
527 Ga0501034_1273796 3300049571 Unclassified 612
528 Ga0501034_1363491 3300049571 Bacteria 585
529 Ga0501036_1634316 3300049572 Unclassified 520
530 Ga0501043_0344141 3300049579 Bacteria 1134
531 Ga0501047_0004068 3300049581 Bacteria 13756
532 Ga0501047_0121669 3300049581 Bacteria 2491
533 Ga0501047_0484911 3300049581 Unclassified 1064
534 Ga0501233_054208 3300049668 Unclassified 979
535 Ga0501257_018663 3300049686 Bacteria 1619
536 Ga0501257_180274 3300049686 Unclassified 597
537 Ga0501225_0002922 3300049705 Bacteria 5247
538 Ga0501245_146200 3300049708 Bacteria 519
539 Ga0501241_126903 3300049758 Unclassified 571
540 Ga0501035_0239732 3300049822 Bacteria 1543
541 Ga0501044_0033123 3300049823 Bacteria 5430
542 Ga0501044_0963495 3300049823 Bacteria 726
543 nmdc:mga0k408_206436_c1 3300050493 Bacteria 1173
544 nmdc:mga0k408_265875_c1 3300050493 Bacteria 1024
545 nmdc:mga0k408_32475_c1 3300050493 Bacteria 2982
546 nmdc:mga0k408_34935_c1 3300050493 Bacteria 2880
547 nmdc:mga0k408_4631_c1 3300050493 Bacteria 7285
548 nmdc:mga0k408_480179_c1 3300050493 Bacteria 737
549 nmdc:mga05p37_1276461_c1 3300050507 Unclassified 751
550 nmdc:mga05p37_20024_c2 3300050507 Bacteria 7172
551 nmdc:mga05p37_905856_c1 3300050507 Bacteria 950
552 nmdc:mga09592_1122906_c1 3300050508 Bacteria 653
553 nmdc:mga09592_153430_c1 3300050508 Bacteria 1988
554 nmdc:mga09592_38049_c1 3300050508 Unclassified 4037
555 nmdc:mga0qj67_143585_c1 3300050509 Bacteria 1935
556 nmdc:mga0qj67_512782_c1 3300050509 Bacteria 963
557 nmdc:mga06r32_758920_c1 3300050510 Bacteria 933
558 nmdc:mga06r32_9671_c1 3300050510 Bacteria 8709
559 nmdc:mga08y16_1061793_c1 3300050511 Bacteria 787
560 nmdc:mga08y16_123242_c1 3300050511 Bacteria 2697
561 nmdc:mga08y16_1466422_c1 3300050511 Bacteria 644
562 nmdc:mga08y16_55351_c1 3300050511 Bacteria 4145
563 Ga0500578_0000934 3300053086 Bacteria 32814
564 Ga0500578_0047248 3300053086 Bacteria 2762
565 Ga0500644_0146434 3300053088 Unclassified 943
566 Ga0500644_0402556 3300053088 Unclassified 597
567 Ga0500646_0007450 3300053090 Bacteria 2798
568 Ga0500583_0000012 3300053092 Bacteria 154426
569 Ga0500583_0002721 3300053092 Bacteria 5393
570 Ga0500555_060840 3300053103 Unclassified 1016
571 Ga0500556_0032665 3300053104 Unclassified 1780
572 Ga0500569_289456 3300053109 Bacteria 552
573 Ga0500594_0087378 3300053118 Bacteria 942
574 Ga0500618_163139 3300053125 Bacteria 510
575 Ga0500652_084026 3300053131 Bacteria 1327
576 Ga0500658_0341292 3300053134 Bacteria 688
577 Ga0500559_0239727 3300053136 Bacteria 855
578 Ga0500561_0262185 3300053137 Bacteria 550
579 Ga0500589_031996 3300053147 Bacteria 2452
580 Ga0500603_084783 3300053150 Bacteria 923
581 Ga0500616_0015278 3300053153 Bacteria 4394
582 Ga0500616_0161055 3300053153 Bacteria 1029
583 Ga0500616_0275983 3300053153 Unclassified 707
584 Ga0500622_0026523 3300053156 Bacteria 3057
585 Ga0500639_027948 3300053163 Bacteria 2981
586 Ga0500637_0599881 3300053178 Bacteria 522
587 Ga0500611_000002 3300053727 Bacteria 345991
588 Ga0500587_016627 3300053739 Bacteria 941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041408 Ga0439453_0046763 Ga0439453_0046763_289_537 65
2 3300026095 Ga0207676_10421707 Ga0207676_104217073 70
3 3300005331 Ga0070670_101197380 Ga0070670_1011973802 71
4 3300017792 Ga0163161_10652137 Ga0163161_106521372 71
5 3300042435 Ga0439434_0318531 Ga0439434_0318531_283_510 75
6 3300046501 Ga0495607_0101333 Ga0495607_0101333_606_839 75
7 3300000041 ARcpr5oldR_c019560 ARcpr5oldR_0195602 76
8 3300000043 ARcpr5yngRDRAFT_c013356 ARcpr5yngRDRAFT_0133562 76
9 3300000044 ARSoilOldRDRAFT_c023452 ARSoilOldRDRAFT_0234522 76
10 3300001991 JGI24743J22301_10083694 JGI24743J22301_100836942 76
11 3300002077 JGI24744J21845_10058120 JGI24744J21845_100581202 76
12 3300002738 JGI25154J39366_1016321 JGI25154J39366_10163212 76
13 3300003320 rootH2_10190875 rootH2_101908752 76
14 3300003322 rootL2_10171171 rootL2_101711711 76
15 3300003323 rootH1_10054153 rootH1_100541535 76
16 3300005288 Ga0065714_10198895 Ga0065714_101988952 76
17 3300005289 Ga0065704_10091501 Ga0065704_100915013 76
18 3300005289 Ga0065704_10602527 Ga0065704_106025272 76
19 3300005290 Ga0065712_10077592 Ga0065712_100775925 76
20 3300005290 Ga0065712_10134098 Ga0065712_101340982 76
21 3300005290 Ga0065712_10287453 Ga0065712_102874531 76
22 3300005290 Ga0065712_10293476 Ga0065712_102934762 76
23 3300005293 Ga0065715_10019353 Ga0065715_100193533 76
24 3300005293 Ga0065715_10273100 Ga0065715_102731002 76
25 3300005293 Ga0065715_10451627 Ga0065715_104516272 76
26 3300005293 Ga0065715_11170100 Ga0065715_111701001 76
27 3300005295 Ga0065707_10022333 Ga0065707_100223332 76
28 3300005295 Ga0065707_10165567 Ga0065707_101655672 76
29 3300005295 Ga0065707_10448943 Ga0065707_104489432 76
30 3300005328 Ga0070676_10014248 Ga0070676_100142482 76
31 3300005329 Ga0070683_100204187 Ga0070683_1002041872 76
32 3300005330 Ga0070690_100270516 Ga0070690_1002705162 76
33 3300005331 Ga0070670_100038715 Ga0070670_1000387155 76
34 3300005331 Ga0070670_100300457 Ga0070670_1003004573 76
35 3300005331 Ga0070670_100707651 Ga0070670_1007076512 76
36 3300005333 Ga0070677_10263826 Ga0070677_102638261 76
37 3300005333 Ga0070677_10313675 Ga0070677_103136752 76
38 3300005334 Ga0068869_100032681 Ga0068869_1000326814 76
39 3300005334 Ga0068869_100079604 Ga0068869_1000796044 76
40 3300005334 Ga0068869_101217139 Ga0068869_1012171392 76
41 3300005334 Ga0068869_101408855 Ga0068869_1014088552 76
42 3300005335 Ga0070666_10741832 Ga0070666_107418322 76
43 3300005335 Ga0070666_10826864 Ga0070666_108268642 76
44 3300005337 Ga0070682_101446636 Ga0070682_1014466362 76
45 3300005338 Ga0068868_100024597 Ga0068868_1000245971 76
46 3300005338 Ga0068868_100210932 Ga0068868_1002109322 76
47 3300005338 Ga0068868_100606692 Ga0068868_1006066922 76
48 3300005338 Ga0068868_101663998 Ga0068868_1016639982 76
49 3300005340 Ga0070689_100019130 Ga0070689_1000191304 76
50 3300005340 Ga0070689_100040492 Ga0070689_1000404925 76
51 3300005340 Ga0070689_100068440 Ga0070689_1000684402 76
52 3300005343 Ga0070687_100156614 Ga0070687_1001566141 76
53 3300005343 Ga0070687_100601345 Ga0070687_1006013452 76
54 3300005344 Ga0070661_101899658 Ga0070661_1018996582 76
55 3300005347 Ga0070668_100005828 Ga0070668_1000058282 76
56 3300005347 Ga0070668_100125658 Ga0070668_1001256582 76
57 3300005353 Ga0070669_100038346 Ga0070669_1000383464 76
58 3300005353 Ga0070669_100072872 Ga0070669_1000728722 76
59 3300005353 Ga0070669_100137279 Ga0070669_1001372793 76
60 3300005353 Ga0070669_101592448 Ga0070669_1015924481 76
61 3300005353 Ga0070669_101678048 Ga0070669_1016780482 76
62 3300005354 Ga0070675_100075014 Ga0070675_1000750142 76
63 3300005354 Ga0070675_100155160 Ga0070675_1001551601 76
64 3300005354 Ga0070675_100463979 Ga0070675_1004639792 76
65 3300005354 Ga0070675_100889776 Ga0070675_1008897762 76
66 3300005354 Ga0070675_101004958 Ga0070675_1010049581 76
67 3300005355 Ga0070671_100514063 Ga0070671_1005140632 76
68 3300005356 Ga0070674_100002262 Ga0070674_1000022627 76
69 3300005356 Ga0070674_100037295 Ga0070674_1000372954 76
70 3300005364 Ga0070673_100028166 Ga0070673_1000281665 76
71 3300005364 Ga0070673_100043512 Ga0070673_1000435125 76
72 3300005364 Ga0070673_100233601 Ga0070673_1002336012 76
73 3300005364 Ga0070673_100642412 Ga0070673_1006424122 76
74 3300005364 Ga0070673_101108604 Ga0070673_1011086042 76
75 3300005364 Ga0070673_101539764 Ga0070673_1015397641 76
76 3300005364 Ga0070673_101703307 Ga0070673_1017033072 76
77 3300005364 Ga0070673_102357824 Ga0070673_1023578241 76
78 3300005365 Ga0070688_100051239 Ga0070688_1000512392 76
79 3300005365 Ga0070688_100089746 Ga0070688_1000897462 76
80 3300005365 Ga0070688_100363963 Ga0070688_1003639631 76
81 3300005365 Ga0070688_100384287 Ga0070688_1003842873 76
82 3300005365 Ga0070688_100919032 Ga0070688_1009190321 76
83 3300005365 Ga0070688_101285714 Ga0070688_1012857141 76
84 3300005367 Ga0070667_100044780 Ga0070667_1000447802 76
85 3300005367 Ga0070667_100147215 Ga0070667_1001472153 76
86 3300005367 Ga0070667_100387567 Ga0070667_1003875671 76
87 3300005367 Ga0070667_101624042 Ga0070667_1016240421 76
88 3300005367 Ga0070667_101877193 Ga0070667_1018771931 76
89 3300005440 Ga0070705_100411366 Ga0070705_1004113662 76
90 3300005441 Ga0070700_101184056 Ga0070700_1011840561 76
91 3300005441 Ga0070700_101249204 Ga0070700_1012492041 76
92 3300005441 Ga0070700_101366520 Ga0070700_1013665201 76
93 3300005441 Ga0070700_101606815 Ga0070700_1016068151 76
94 3300005444 Ga0070694_101719674 Ga0070694_1017196741 76
95 3300005455 Ga0070663_102016675 Ga0070663_1020166751 76
96 3300005456 Ga0070678_100280384 Ga0070678_1002803842 76
97 3300005457 Ga0070662_100051494 Ga0070662_1000514943 76
98 3300005459 Ga0068867_100003798 Ga0068867_1000037986 76
99 3300005459 Ga0068867_100215252 Ga0068867_1002152522 76
100 3300005459 Ga0068867_100819270 Ga0068867_1008192701 76
101 3300005459 Ga0068867_101536767 Ga0068867_1015367671 76
102 3300005459 Ga0068867_101671655 Ga0068867_1016716552 76
103 3300005459 Ga0068867_102336363 Ga0068867_1023363632 76
104 3300005466 Ga0070685_10011303 Ga0070685_100113036 76
105 3300005466 Ga0070685_10168903 Ga0070685_101689032 76
106 3300005466 Ga0070685_10576485 Ga0070685_105764852 76
107 3300005468 Ga0070707_101170133 Ga0070707_1011701332 76
108 3300005471 Ga0070698_100068393 Ga0070698_1000683935 76
109 3300005535 Ga0070684_100044635 Ga0070684_1000446354 76
110 3300005539 Ga0068853_100052550 Ga0068853_1000525502 76
111 3300005539 Ga0068853_100079979 Ga0068853_1000799792 76
112 3300005539 Ga0068853_100618419 Ga0068853_1006184192 76
113 3300005539 Ga0068853_100914221 Ga0068853_1009142211 76
114 3300005539 Ga0068853_101250569 Ga0068853_1012505692 76
115 3300005543 Ga0070672_100041352 Ga0070672_1000413524 76
116 3300005543 Ga0070672_100597881 Ga0070672_1005978812 76
117 3300005543 Ga0070672_100776585 Ga0070672_1007765852 76
118 3300005544 Ga0070686_100794124 Ga0070686_1007941241 76
119 3300005544 Ga0070686_101469819 Ga0070686_1014698192 76
120 3300005546 Ga0070696_101286485 Ga0070696_1012864852 76
121 3300005547 Ga0070693_100152854 Ga0070693_1001528542 76
122 3300005548 Ga0070665_100016621 Ga0070665_1000166212 76
123 3300005548 Ga0070665_100057795 Ga0070665_1000577955 76
124 3300005549 Ga0070704_100188326 Ga0070704_1001883263 76
125 3300005549 Ga0070704_100276848 Ga0070704_1002768481 76
126 3300005563 Ga0068855_100306408 Ga0068855_1003064082 76
127 3300005564 Ga0070664_100073067 Ga0070664_1000730673 76
128 3300005564 Ga0070664_100723512 Ga0070664_1007235122 76
129 3300005564 Ga0070664_100823153 Ga0070664_1008231531 76
130 3300005564 Ga0070664_101356789 Ga0070664_1013567892 76
131 3300005577 Ga0068857_100509685 Ga0068857_1005096852 76
132 3300005577 Ga0068857_100577614 Ga0068857_1005776142 76
133 3300005578 Ga0068854_101027636 Ga0068854_1010276361 76
134 3300005578 Ga0068854_101029637 Ga0068854_1010296372 76
135 3300005578 Ga0068854_101404307 Ga0068854_1014043072 76
136 3300005615 Ga0070702_100677848 Ga0070702_1006778482 76
137 3300005616 Ga0068852_100282762 Ga0068852_1002827622 76
138 3300005616 Ga0068852_101755126 Ga0068852_1017551262 76
139 3300005617 Ga0068859_100004404 Ga0068859_10000440410 76
140 3300005617 Ga0068859_100038311 Ga0068859_1000383112 76
141 3300005617 Ga0068859_100114512 Ga0068859_1001145123 76
142 3300005617 Ga0068859_100214701 Ga0068859_1002147014 76
143 3300005617 Ga0068859_100218717 Ga0068859_1002187171 76
144 3300005617 Ga0068859_100239690 Ga0068859_1002396903 76
145 3300005617 Ga0068859_100304908 Ga0068859_1003049082 76
146 3300005617 Ga0068859_101294357 Ga0068859_1012943572 76
147 3300005617 Ga0068859_101415404 Ga0068859_1014154042 76
148 3300005617 Ga0068859_102101044 Ga0068859_1021010442 76
149 3300005618 Ga0068864_100023053 Ga0068864_1000230538 76
150 3300005618 Ga0068864_100524555 Ga0068864_1005245553 76
151 3300005618 Ga0068864_100525501 Ga0068864_1005255012 76
152 3300005618 Ga0068864_101201957 Ga0068864_1012019572 76
153 3300005618 Ga0068864_101353101 Ga0068864_1013531012 76
154 3300005618 Ga0068864_101711874 Ga0068864_1017118741 76
155 3300005618 Ga0068864_102330539 Ga0068864_1023305392 76
156 3300005718 Ga0068866_10053790 Ga0068866_100537902 76
157 3300005718 Ga0068866_11089471 Ga0068866_110894711 76
158 3300005719 Ga0068861_100191358 Ga0068861_1001913581 76
159 3300005719 Ga0068861_100330256 Ga0068861_1003302562 76
160 3300005719 Ga0068861_100487175 Ga0068861_1004871752 76
161 3300005719 Ga0068861_101143043 Ga0068861_1011430432 76
162 3300005719 Ga0068861_101373559 Ga0068861_1013735592 76
163 3300005719 Ga0068861_102421600 Ga0068861_1024216002 76
164 3300005840 Ga0068870_10039824 Ga0068870_100398243 76
165 3300005840 Ga0068870_10246999 Ga0068870_102469993 76
166 3300005841 Ga0068863_100395807 Ga0068863_1003958072 76
167 3300005841 Ga0068863_100597451 Ga0068863_1005974512 76
168 3300005841 Ga0068863_100747867 Ga0068863_1007478672 76
169 3300005841 Ga0068863_100766508 Ga0068863_1007665082 76
170 3300005841 Ga0068863_100815032 Ga0068863_1008150322 76
171 3300005841 Ga0068863_101031498 Ga0068863_1010314982 76
172 3300005842 Ga0068858_100127805 Ga0068858_1001278053 76
173 3300005842 Ga0068858_100129440 Ga0068858_1001294402 76
174 3300005842 Ga0068858_101660440 Ga0068858_1016604402 76
175 3300005842 Ga0068858_101986715 Ga0068858_1019867151 76
176 3300005843 Ga0068860_100066104 Ga0068860_1000661042 76
177 3300005843 Ga0068860_100092893 Ga0068860_1000928933 76
178 3300005843 Ga0068860_100144518 Ga0068860_1001445183 76
179 3300005843 Ga0068860_100289886 Ga0068860_1002898861 76
180 3300005843 Ga0068860_100348859 Ga0068860_1003488592 76
181 3300005843 Ga0068860_102161698 Ga0068860_1021616982 76
182 3300005844 Ga0068862_100050350 Ga0068862_1000503505 76
183 3300005844 Ga0068862_100739135 Ga0068862_1007391352 76
184 3300005844 Ga0068862_100939108 Ga0068862_1009391082 76
185 3300005844 Ga0068862_101031949 Ga0068862_1010319492 76
186 3300005844 Ga0068862_101912446 Ga0068862_1019124462 76
187 3300006195 Ga0075366_10013347 Ga0075366_100133472 76
188 3300006195 Ga0075366_10079110 Ga0075366_100791103 76
189 3300006195 Ga0075366_10090286 Ga0075366_100902863 76
190 3300006195 Ga0075366_10190269 Ga0075366_101902693 76
191 3300006195 Ga0075366_10234308 Ga0075366_102343082 76
192 3300006237 Ga0097621_100006252 Ga0097621_1000062522 76
193 3300006237 Ga0097621_100036651 Ga0097621_1000366514 76
194 3300006237 Ga0097621_100572893 Ga0097621_1005728932 76
195 3300006237 Ga0097621_100735477 Ga0097621_1007354772 76
196 3300006237 Ga0097621_102144460 Ga0097621_1021444602 76
197 3300006237 Ga0097621_102183760 Ga0097621_1021837602 76
198 3300006358 Ga0068871_100028294 Ga0068871_1000282946 76
199 3300006358 Ga0068871_100359833 Ga0068871_1003598333 76
200 3300006358 Ga0068871_100473591 Ga0068871_1004735912 76
201 3300006358 Ga0068871_101239007 Ga0068871_1012390072 76
202 3300006358 Ga0068871_101541575 Ga0068871_1015415751 76
203 3300006844 Ga0075428_100006620 Ga0075428_1000066206 76
204 3300006844 Ga0075428_100120899 Ga0075428_1001208994 76
205 3300006844 Ga0075428_102758584 Ga0075428_1027585841 76
206 3300006846 Ga0075430_100188341 Ga0075430_1001883413 76
207 3300006846 Ga0075430_100569402 Ga0075430_1005694022 76
208 3300006847 Ga0075431_100000866 Ga0075431_1000008663 76
209 3300006847 Ga0075431_100775352 Ga0075431_1007753522 76
210 3300006847 Ga0075431_101158091 Ga0075431_1011580912 76
211 3300006871 Ga0075434_102313250 Ga0075434_1023132501 76
212 3300006880 Ga0075429_100006687 Ga0075429_1000066875 76
213 3300006880 Ga0075429_100009709 Ga0075429_1000097093 76
214 3300006880 Ga0075429_100165515 Ga0075429_1001655153 76
215 3300006881 Ga0068865_100004271 Ga0068865_1000042712 76
216 3300006881 Ga0068865_100141827 Ga0068865_1001418272 76
217 3300006881 Ga0068865_101135540 Ga0068865_1011355402 76
218 3300006881 Ga0068865_101339377 Ga0068865_1013393772 76
219 3300006931 Ga0097620_100004404 Ga0097620_10000440410 76
220 3300006931 Ga0097620_100038312 Ga0097620_1000383122 76
221 3300006931 Ga0097620_100114503 Ga0097620_1001145033 76
222 3300006931 Ga0097620_100214718 Ga0097620_1002147181 76
223 3300006931 Ga0097620_100218737 Ga0097620_1002187374 76
224 3300006931 Ga0097620_100239699 Ga0097620_1002396992 76
225 3300006931 Ga0097620_100304931 Ga0097620_1003049312 76
226 3300006931 Ga0097620_101294580 Ga0097620_1012945802 76
227 3300006931 Ga0097620_101415290 Ga0097620_1014152902 76
228 3300006931 Ga0097620_102101023 Ga0097620_1021010232 76
229 3300009093 Ga0105240_10781773 Ga0105240_107817733 76
230 3300009094 Ga0111539_10095344 Ga0111539_100953444 76
231 3300009094 Ga0111539_10124969 Ga0111539_101249695 76
232 3300009094 Ga0111539_10246021 Ga0111539_102460212 76
233 3300009094 Ga0111539_10531161 Ga0111539_105311612 76
234 3300009094 Ga0111539_10742612 Ga0111539_107426122 76
235 3300009094 Ga0111539_13162744 Ga0111539_131627442 76
236 3300009098 Ga0105245_10567915 Ga0105245_105679151 76
237 3300009098 Ga0105245_13133618 Ga0105245_131336182 76
238 3300009101 Ga0105247_10007209 Ga0105247_100072096 76
239 3300009101 Ga0105247_10350512 Ga0105247_103505122 76
240 3300009147 Ga0114129_10001572 Ga0114129_1000157211 76
241 3300009147 Ga0114129_10003569 Ga0114129_100035698 76
242 3300009147 Ga0114129_10114463 Ga0114129_101144631 76
243 3300009147 Ga0114129_10259114 Ga0114129_102591143 76
244 3300009147 Ga0114129_10535051 Ga0114129_105350513 76
245 3300009174 Ga0105241_10070874 Ga0105241_100708742 76
246 3300009174 Ga0105241_10210813 Ga0105241_102108133 76
247 3300009174 Ga0105241_11227681 Ga0105241_112276812 76
248 3300009174 Ga0105241_11645805 Ga0105241_116458052 76
249 3300009176 Ga0105242_10025664 Ga0105242_100256644 76
250 3300009176 Ga0105242_10177261 Ga0105242_101772612 76
251 3300009176 Ga0105242_10250957 Ga0105242_102509573 76
252 3300009176 Ga0105242_10269261 Ga0105242_102692612 76
253 3300009176 Ga0105242_11648972 Ga0105242_116489722 76
254 3300009176 Ga0105242_12121081 Ga0105242_121210812 76
255 3300009176 Ga0105242_13037424 Ga0105242_130374242 76
256 3300009177 Ga0105248_10225161 Ga0105248_102251613 76
257 3300009177 Ga0105248_10834133 Ga0105248_108341332 76
258 3300009177 Ga0105248_11523997 Ga0105248_115239972 76
259 3300009177 Ga0105248_11999878 Ga0105248_119998781 76
260 3300009545 Ga0105237_10012365 Ga0105237_100123654 76
261 3300009553 Ga0105249_10015498 Ga0105249_100154988 76
262 3300009553 Ga0105249_10020990 Ga0105249_100209904 76
263 3300009553 Ga0105249_10055960 Ga0105249_100559605 76
264 3300009553 Ga0105249_10146222 Ga0105249_101462222 76
265 3300009553 Ga0105249_10154060 Ga0105249_101540603 76
266 3300009553 Ga0105249_11099725 Ga0105249_110997252 76
267 3300009553 Ga0105249_11331084 Ga0105249_113310842 76
268 3300009553 Ga0105249_11984712 Ga0105249_119847122 76
269 3300010375 Ga0105239_10006184 Ga0105239_100061847 76
270 3300010375 Ga0105239_11150146 Ga0105239_111501461 76
271 3300010375 Ga0105239_11543578 Ga0105239_115435781 76
272 3300011119 Ga0105246_10087749 Ga0105246_100877492 76
273 3300011119 Ga0105246_10118181 Ga0105246_101181812 76
274 3300013100 Ga0157373_11550886 Ga0157373_115508862 76
275 3300013104 Ga0157370_10270778 Ga0157370_102707782 76
276 3300013104 Ga0157370_10391965 Ga0157370_103919652 76
277 3300013104 Ga0157370_10795013 Ga0157370_107950132 76
278 3300013296 Ga0157374_10055794 Ga0157374_100557943 76
279 3300013296 Ga0157374_10117992 Ga0157374_101179923 76
280 3300013296 Ga0157374_11397124 Ga0157374_113971242 76
281 3300013297 Ga0157378_10661608 Ga0157378_106616082 76
282 3300013297 Ga0157378_10731467 Ga0157378_107314672 76
283 3300013297 Ga0157378_11525129 Ga0157378_115251291 76
284 3300013306 Ga0163162_10029655 Ga0163162_100296552 76
285 3300013306 Ga0163162_10088421 Ga0163162_100884212 76
286 3300013306 Ga0163162_10803864 Ga0163162_108038643 76
287 3300013307 Ga0157372_10991725 Ga0157372_109917252 76
288 3300013307 Ga0157372_11169548 Ga0157372_111695482 76
289 3300013307 Ga0157372_12595780 Ga0157372_125957802 76
290 3300013307 Ga0157372_12658660 Ga0157372_126586601 76
291 3300013308 Ga0157375_10072939 Ga0157375_100729395 76
292 3300013308 Ga0157375_10743772 Ga0157375_107437722 76
293 3300013308 Ga0157375_12604388 Ga0157375_126043881 76
294 3300013308 Ga0157375_12631231 Ga0157375_126312312 76
295 3300014325 Ga0163163_10057069 Ga0163163_100570692 76
296 3300014325 Ga0163163_10112665 Ga0163163_101126653 76
297 3300014325 Ga0163163_10549203 Ga0163163_105492032 76
298 3300014325 Ga0163163_10564483 Ga0163163_105644831 76
299 3300014326 Ga0157380_10024955 Ga0157380_100249553 76
300 3300014326 Ga0157380_10029842 Ga0157380_100298423 76
301 3300014326 Ga0157380_10215075 Ga0157380_102150752 76
302 3300014326 Ga0157380_10356885 Ga0157380_103568852 76
303 3300014326 Ga0157380_10390375 Ga0157380_103903752 76
304 3300014326 Ga0157380_10458256 Ga0157380_104582562 76
305 3300014326 Ga0157380_10730576 Ga0157380_107305762 76
306 3300014326 Ga0157380_10812123 Ga0157380_108121232 76
307 3300014326 Ga0157380_11568759 Ga0157380_115687592 76
308 3300014326 Ga0157380_13203270 Ga0157380_132032701 76
309 3300014745 Ga0157377_10089403 Ga0157377_100894032 76
310 3300014745 Ga0157377_10230051 Ga0157377_102300513 76
311 3300014745 Ga0157377_10342956 Ga0157377_103429562 76
312 3300014968 Ga0157379_10155294 Ga0157379_101552943 76
313 3300014968 Ga0157379_10228373 Ga0157379_102283732 76
314 3300014968 Ga0157379_11601596 Ga0157379_116015962 76
315 3300014968 Ga0157379_12042297 Ga0157379_120422972 76
316 3300014969 Ga0157376_10263681 Ga0157376_102636812 76
317 3300014969 Ga0157376_10266247 Ga0157376_102662472 76
318 3300014969 Ga0157376_10546771 Ga0157376_105467713 76
319 3300014969 Ga0157376_10601837 Ga0157376_106018371 76
320 3300014969 Ga0157376_12519585 Ga0157376_125195851 76
321 3300017792 Ga0163161_10000890 Ga0163161_1000089016 76
322 3300017792 Ga0163161_10273208 Ga0163161_102732083 76
323 3300017792 Ga0163161_10431474 Ga0163161_104314742 76
324 3300017792 Ga0163161_10750855 Ga0163161_107508551 76
325 3300017792 Ga0163161_11355543 Ga0163161_113555432 76
326 3300017792 Ga0163161_11389554 Ga0163161_113895542 76
327 3300025246 Ga0209646_1005623 Ga0209646_10056233 76
328 3300025315 Ga0207697_10162640 Ga0207697_101626401 76
329 3300025315 Ga0207697_10190333 Ga0207697_101903332 76
330 3300025321 Ga0207656_10026103 Ga0207656_100261033 76
331 3300025899 Ga0207642_10027412 Ga0207642_100274124 76
332 3300025900 Ga0207710_10000852 Ga0207710_1000085212 76
333 3300025901 Ga0207688_10013484 Ga0207688_100134843 76
334 3300025903 Ga0207680_10029382 Ga0207680_100293822 76
335 3300025907 Ga0207645_10001934 Ga0207645_1000193414 76
336 3300025907 Ga0207645_10096614 Ga0207645_100966142 76
337 3300025908 Ga0207643_10005138 Ga0207643_100051386 76
338 3300025908 Ga0207643_10030001 Ga0207643_100300013 76
339 3300025911 Ga0207654_11030141 Ga0207654_110301411 76
340 3300025911 Ga0207654_11149054 Ga0207654_111490542 76
341 3300025913 Ga0207695_10634553 Ga0207695_106345531 76
342 3300025918 Ga0207662_10021709 Ga0207662_100217093 76
343 3300025922 Ga0207646_10204874 Ga0207646_102048745 76
344 3300025922 Ga0207646_11410182 Ga0207646_114101821 76
345 3300025923 Ga0207681_10020255 Ga0207681_100202552 76
346 3300025923 Ga0207681_10138611 Ga0207681_101386113 76
347 3300025923 Ga0207681_11622583 Ga0207681_116225832 76
348 3300025923 Ga0207681_11800925 Ga0207681_118009252 76
349 3300025925 Ga0207650_10057288 Ga0207650_100572884 76
350 3300025925 Ga0207650_10911328 Ga0207650_109113282 76
351 3300025926 Ga0207659_10028420 Ga0207659_100284202 76
352 3300025926 Ga0207659_10050201 Ga0207659_100502012 76
353 3300025926 Ga0207659_10136972 Ga0207659_101369723 76
354 3300025926 Ga0207659_10730629 Ga0207659_107306292 76
355 3300025926 Ga0207659_11408963 Ga0207659_114089631 76
356 3300025931 Ga0207644_10427397 Ga0207644_104273972 76
357 3300025931 Ga0207644_10690339 Ga0207644_106903392 76
358 3300025931 Ga0207644_11707347 Ga0207644_117073471 76
359 3300025933 Ga0207706_10027723 Ga0207706_100277234 76
360 3300025933 Ga0207706_11411285 Ga0207706_114112852 76
361 3300025934 Ga0207686_10138188 Ga0207686_101381882 76
362 3300025934 Ga0207686_10170855 Ga0207686_101708552 76
363 3300025934 Ga0207686_10262791 Ga0207686_102627912 76
364 3300025934 Ga0207686_10600542 Ga0207686_106005422 76
365 3300025934 Ga0207686_10816629 Ga0207686_108166292 76
366 3300025936 Ga0207670_10062831 Ga0207670_100628315 76
367 3300025936 Ga0207670_10110623 Ga0207670_101106232 76
368 3300025936 Ga0207670_10233537 Ga0207670_102335372 76
369 3300025937 Ga0207669_10684285 Ga0207669_106842852 76
370 3300025937 Ga0207669_10755534 Ga0207669_107555342 76
371 3300025938 Ga0207704_10020737 Ga0207704_100207374 76
372 3300025938 Ga0207704_10238726 Ga0207704_102387262 76
373 3300025938 Ga0207704_10489295 Ga0207704_104892952 76
374 3300025938 Ga0207704_11190977 Ga0207704_111909772 76
375 3300025940 Ga0207691_10201402 Ga0207691_102014023 76
376 3300025940 Ga0207691_10595724 Ga0207691_105957242 76
377 3300025940 Ga0207691_10903708 Ga0207691_109037081 76
378 3300025940 Ga0207691_11139245 Ga0207691_111392452 76
379 3300025941 Ga0207711_10515604 Ga0207711_105156042 76
380 3300025942 Ga0207689_10015791 Ga0207689_100157914 76
381 3300025942 Ga0207689_10067860 Ga0207689_100678603 76
382 3300025942 Ga0207689_10104803 Ga0207689_101048034 76
383 3300025942 Ga0207689_10215348 Ga0207689_102153483 76
384 3300025944 Ga0207661_10988072 Ga0207661_109880722 76
385 3300025945 Ga0207679_10257658 Ga0207679_102576582 76
386 3300025945 Ga0207679_11399723 Ga0207679_113997232 76
387 3300025949 Ga0207667_10183389 Ga0207667_101833893 76
388 3300025960 Ga0207651_10031755 Ga0207651_100317554 76
389 3300025960 Ga0207651_10044105 Ga0207651_100441052 76
390 3300025960 Ga0207651_12036760 Ga0207651_120367602 76
391 3300025961 Ga0207712_10026024 Ga0207712_100260244 76
392 3300025961 Ga0207712_10042119 Ga0207712_100421192 76
393 3300025961 Ga0207712_10144811 Ga0207712_101448112 76
394 3300025961 Ga0207712_10171962 Ga0207712_101719622 76
395 3300025961 Ga0207712_10551407 Ga0207712_105514072 76
396 3300025961 Ga0207712_10713789 Ga0207712_107137891 76
397 3300025961 Ga0207712_11461293 Ga0207712_114612932 76
398 3300025972 Ga0207668_10098877 Ga0207668_100988772 76
399 3300025972 Ga0207668_10265856 Ga0207668_102658561 76
400 3300025972 Ga0207668_10276264 Ga0207668_102762641 76
401 3300025972 Ga0207668_10952283 Ga0207668_109522832 76
402 3300025981 Ga0207640_10153003 Ga0207640_101530032 76
403 3300025981 Ga0207640_10591306 Ga0207640_105913061 76
404 3300025981 Ga0207640_11644422 Ga0207640_116444222 76
405 3300025986 Ga0207658_10046164 Ga0207658_100461644 76
406 3300025986 Ga0207658_10109364 Ga0207658_101093642 76
407 3300025986 Ga0207658_10158804 Ga0207658_101588041 76
408 3300025986 Ga0207658_10509640 Ga0207658_105096402 76
409 3300026023 Ga0207677_10355045 Ga0207677_103550452 76
410 3300026023 Ga0207677_10460297 Ga0207677_104602972 76
411 3300026023 Ga0207677_10505142 Ga0207677_105051422 76
412 3300026035 Ga0207703_10938205 Ga0207703_109382051 76
413 3300026041 Ga0207639_10201451 Ga0207639_102014512 76
414 3300026041 Ga0207639_10213057 Ga0207639_102130572 76
415 3300026041 Ga0207639_11851134 Ga0207639_118511341 76
416 3300026067 Ga0207678_10696207 Ga0207678_106962071 76
417 3300026075 Ga0207708_10345876 Ga0207708_103458761 76
418 3300026078 Ga0207702_10196986 Ga0207702_101969862 76
419 3300026088 Ga0207641_10000380 Ga0207641_100003809 76
420 3300026088 Ga0207641_10210850 Ga0207641_102108502 76
421 3300026088 Ga0207641_10507230 Ga0207641_105072302 76
422 3300026088 Ga0207641_10509003 Ga0207641_105090032 76
423 3300026088 Ga0207641_11047549 Ga0207641_110475492 76
424 3300026088 Ga0207641_11852119 Ga0207641_118521191 76
425 3300026089 Ga0207648_10003538 Ga0207648_100035389 76
426 3300026089 Ga0207648_10110130 Ga0207648_101101302 76
427 3300026089 Ga0207648_10361881 Ga0207648_103618812 76
428 3300026089 Ga0207648_11648571 Ga0207648_116485711 76
429 3300026095 Ga0207676_10018751 Ga0207676_100187511 76
430 3300026095 Ga0207676_10068244 Ga0207676_100682443 76
431 3300026095 Ga0207676_10133718 Ga0207676_101337183 76
432 3300026095 Ga0207676_10774923 Ga0207676_107749231 76
433 3300026095 Ga0207676_12445771 Ga0207676_124457711 76
434 3300026116 Ga0207674_10233105 Ga0207674_102331052 76
435 3300026118 Ga0207675_100184283 Ga0207675_1001842832 76
436 3300026118 Ga0207675_100748762 Ga0207675_1007487622 76
437 3300026118 Ga0207675_101063907 Ga0207675_1010639072 76
438 3300026118 Ga0207675_101354720 Ga0207675_1013547202 76
439 3300026118 Ga0207675_101615391 Ga0207675_1016153912 76
440 3300026118 Ga0207675_101817623 Ga0207675_1018176231 76
441 3300026121 Ga0207683_10000691 Ga0207683_1000069124 76
442 3300026121 Ga0207683_10049417 Ga0207683_100494175 76
443 3300026142 Ga0207698_10375963 Ga0207698_103759632 76
444 3300026142 Ga0207698_10477512 Ga0207698_104775122 76
445 3300026142 Ga0207698_10977676 Ga0207698_109776762 76
446 3300026142 Ga0207698_11181630 Ga0207698_111816302 76
447 3300026142 Ga0207698_11367266 Ga0207698_113672662 76
448 3300027395 Ga0209996_1037412 Ga0209996_10374122 76
449 3300027907 Ga0207428_10575838 Ga0207428_105758382 76
450 3300027907 Ga0207428_10900508 Ga0207428_109005082 76
451 3300028379 Ga0268266_10011708 Ga0268266_100117083 76
452 3300028379 Ga0268266_10064584 Ga0268266_100645843 76
453 3300028380 Ga0268265_10301992 Ga0268265_103019922 76
454 3300028380 Ga0268265_11554151 Ga0268265_115541512 76
455 3300028380 Ga0268265_12177172 Ga0268265_121771721 76
456 3300028380 Ga0268265_12364993 Ga0268265_123649932 76
457 3300028381 Ga0268264_10044674 Ga0268264_100446742 76
458 3300028381 Ga0268264_10122469 Ga0268264_101224692 76
459 3300028381 Ga0268264_10171452 Ga0268264_101714523 76
460 3300028381 Ga0268264_11981028 Ga0268264_119810282 76
461 3300030522 Ga0307512_10340977 Ga0307512_103409771 76
462 3300030522 Ga0307512_10427024 Ga0307512_104270242 76
463 3300031251 Ga0265327_10007307 Ga0265327_100073078 76
464 3300031251 Ga0265327_10173025 Ga0265327_101730252 76
465 3300031456 Ga0307513_10210849 Ga0307513_102108492 76
466 3300031456 Ga0307513_10859008 Ga0307513_108590081 76
467 3300031456 Ga0307513_10918808 Ga0307513_109188081 76
468 3300031507 Ga0307509_10107276 Ga0307509_101072764 76
469 3300031730 Ga0307516_10501757 Ga0307516_105017571 76
470 3300032002 Ga0307416_103479472 Ga0307416_1034794722 76
471 3300032004 Ga0307414_10034778 Ga0307414_100347784 76
472 3300035170 Ga0373943_0726622 Ga0373943_0726622_68_298 76
473 3300035171 Ga0373946_0372405 Ga0373946_0372405_418_648 76
474 3300035691 Ga0373931_1280048 Ga0373931_1280048_34_267 76
475 3300035695 Ga0373927_0721733 Ga0373927_0721733_357_590 76
476 3300036401 Ga0373937_0585538 Ga0373937_0585538_779_1009 76
477 3300041404 Ga0439436_0012382 Ga0439436_0012382_2243_2476 76
478 3300041456 Ga0451795_0056838 Ga0451795_0056838_205_438 76
479 3300041459 Ga0451800_0429729 Ga0451800_0429729_76_309 76
480 3300041460 Ga0451802_0622033 Ga0451802_0622033_167_400 76
481 3300041460 Ga0451802_1058775 Ga0451802_1058775_245_478 76
482 3300041463 Ga0451804_0981626 Ga0451804_0981626_210_443 76
483 3300041486 Ga0451807_2307153 Ga0451807_2307153_272_505 76
484 3300041498 Ga0451841_0886561 Ga0451841_0886561_750_983 76
485 3300041512 Ga0451853_0925210 Ga0451853_0925210_180_413 76
486 3300041512 Ga0451853_1010871 Ga0451853_1010871_104_337 76
487 3300041512 Ga0451853_3208196 Ga0451853_3208196_207_440 76
488 3300041512 Ga0451853_3668395 Ga0451853_3668395_894_1127 76
489 3300041512 Ga0451853_4052459 Ga0451853_4052459_67_300 76
490 3300042007 Ga0439449_0014815 Ga0439449_0014815_1639_1872 76
491 3300042014 Ga0439457_000827 Ga0439457_000827_8152_8385 76
492 3300042015 Ga0439462_0052773 Ga0439462_0052773_226_459 76
493 3300042124 Ga0450922_038939 Ga0450922_038939_234_467 76
494 3300042134 Ga0450898_052481 Ga0450898_052481_222_455 76
495 3300042436 Ga0439435_0174463 Ga0439435_0174463_42_272 76
496 3300042876 Ga0451577_0605583 Ga0451577_0605583_163_396 76
497 3300044656 Ga0466969_0000103 Ga0466969_0000103_32512_32745 76
498 3300044658 Ga0466972_0000012 Ga0466972_0000012_183116_183349 76
499 3300044658 Ga0466972_0110891 Ga0466972_0110891_671_904 76
500 3300044683 Ga0466965_0272273 Ga0466965_0272273_224_457 76
501 3300044683 Ga0466965_0695624 Ga0466965_0695624_118_351 76
502 3300044684 Ga0466966_0000097 Ga0466966_0000097_29648_29881 76
503 3300044712 Ga0453684_0183994 Ga0453684_0183994_1559_1792 76
504 3300044735 Ga0466968_0230113 Ga0466968_0230113_622_855 76
505 3300044765 Ga0466970_0740258 Ga0466970_0740258_76_309 76
506 3300044842 Ga0466957_0009079 Ga0466957_0009079_897_1130 76
507 3300044842 Ga0466957_0014317 Ga0466957_0014317_3340_3573 76
508 3300045049 Ga0466959_0000049 Ga0466959_0000049_2408_2641 76
509 3300046460 Ga0495638_0069041 Ga0495638_0069041_1489_1722 76
510 3300046501 Ga0495607_0115363 Ga0495607_0115363_267_500 76
511 3300046519 Ga0495632_0122710 Ga0495632_0122710_438_671 76
512 3300046519 Ga0495632_0489216 Ga0495632_0489216_30_263 76
513 3300046522 Ga0495643_0063325 Ga0495643_0063325_621_854 76
514 3300046530 Ga0495654_0239044 Ga0495654_0239044_227_457 76
515 3300046537 Ga0495598_0189939 Ga0495598_0189939_362_592 76
516 3300046539 Ga0495621_0028583 Ga0495621_0028583_484_714 76
517 3300046539 Ga0495621_0116299 Ga0495621_0116299_289_519 76
518 3300046616 Ga0495668_0000489 Ga0495668_0000489_15498_15731 76
519 3300046691 Ga0495670_0053912 Ga0495670_0053912_755_985 76
520 3300047472 Ga0495686_0061584 Ga0495686_0061584_2041_2271 76
521 3300047472 Ga0495686_0188332 Ga0495686_0188332_298_531 76
522 3300048914 Ga0496111_0931224 Ga0496111_0931224_295_525 76
523 3300048929 Ga0496126_0795040 Ga0496126_0795040_158_391 76
524 3300049568 Ga0501031_0400454 Ga0501031_0400454_463_696 76
525 3300049570 Ga0501033_0175488 Ga0501033_0175488_1253_1486 76
526 3300049571 Ga0501034_0637895 Ga0501034_0637895_155_385 76
527 3300049571 Ga0501034_1273796 Ga0501034_1273796_331_564 76
528 3300049571 Ga0501034_1363491 Ga0501034_1363491_329_562 76
529 3300049572 Ga0501036_1634316 Ga0501036_1634316_95_328 76
530 3300049579 Ga0501043_0344141 Ga0501043_0344141_576_809 76
531 3300049581 Ga0501047_0004068 Ga0501047_0004068_6235_6468 76
532 3300049581 Ga0501047_0121669 Ga0501047_0121669_1165_1398 76
533 3300049581 Ga0501047_0484911 Ga0501047_0484911_701_934 76
534 3300049668 Ga0501233_054208 Ga0501233_054208_558_797 76
535 3300049686 Ga0501257_018663 Ga0501257_018663_67_300 76
536 3300049686 Ga0501257_180274 Ga0501257_180274_14_247 76
537 3300049705 Ga0501225_0002922 Ga0501225_0002922_2244_2477 76
538 3300049708 Ga0501245_146200 Ga0501245_146200_11_250 76
539 3300049758 Ga0501241_126903 Ga0501241_126903_244_477 76
540 3300049822 Ga0501035_0239732 Ga0501035_0239732_550_783 76
541 3300049823 Ga0501044_0033123 Ga0501044_0033123_4290_4523 76
542 3300049823 Ga0501044_0963495 Ga0501044_0963495_402_635 76
543 3300050493 nmdc:mga0k408_206436_c1 nmdc:mga0k408_206436_c1_25_258 76
544 3300050493 nmdc:mga0k408_265875_c1 nmdc:mga0k408_265875_c1_135_365 76
545 3300050493 nmdc:mga0k408_32475_c1 nmdc:mga0k408_32475_c1_855_1088 76
546 3300050493 nmdc:mga0k408_34935_c1 nmdc:mga0k408_34935_c1_421_654 76
547 3300050493 nmdc:mga0k408_4631_c1 nmdc:mga0k408_4631_c1_1176_1406 76
548 3300050493 nmdc:mga0k408_480179_c1 nmdc:mga0k408_480179_c1_59_292 76
549 3300050507 nmdc:mga05p37_1276461_c1 nmdc:mga05p37_1276461_c1_350_583 76
550 3300050507 nmdc:mga05p37_20024_c2 nmdc:mga05p37_20024_c2_4856_5089 76
551 3300050507 nmdc:mga05p37_905856_c1 nmdc:mga05p37_905856_c1_348_578 76
552 3300050508 nmdc:mga09592_1122906_c1 nmdc:mga09592_1122906_c1_304_534 76
553 3300050508 nmdc:mga09592_153430_c1 nmdc:mga09592_153430_c1_1688_1918 76
554 3300050508 nmdc:mga09592_38049_c1 nmdc:mga09592_38049_c1_3579_3812 76
555 3300050509 nmdc:mga0qj67_143585_c1 nmdc:mga0qj67_143585_c1_1309_1590 76
556 3300050509 nmdc:mga0qj67_512782_c1 nmdc:mga0qj67_512782_c1_251_484 76
557 3300050510 nmdc:mga06r32_758920_c1 nmdc:mga06r32_758920_c1_324_605 76
558 3300050510 nmdc:mga06r32_9671_c1 nmdc:mga06r32_9671_c1_6028_6261 76
559 3300050511 nmdc:mga08y16_1061793_c1 nmdc:mga08y16_1061793_c1_452_682 76
560 3300050511 nmdc:mga08y16_123242_c1 nmdc:mga08y16_123242_c1_2440_2670 76
561 3300050511 nmdc:mga08y16_1466422_c1 nmdc:mga08y16_1466422_c1_133_369 76
562 3300050511 nmdc:mga08y16_55351_c1 nmdc:mga08y16_55351_c1_298_528 76
563 3300053086 Ga0500578_0000934 Ga0500578_0000934_3940_4173 76
564 3300053086 Ga0500578_0047248 Ga0500578_0047248_324_557 76
565 3300053088 Ga0500644_0146434 Ga0500644_0146434_27_260 76
566 3300053088 Ga0500644_0402556 Ga0500644_0402556_225_458 76
567 3300053090 Ga0500646_0007450 Ga0500646_0007450_2060_2293 76
568 3300053092 Ga0500583_0000012 Ga0500583_0000012_123926_124159 76
569 3300053092 Ga0500583_0002721 Ga0500583_0002721_618_851 76
570 3300053103 Ga0500555_060840 Ga0500555_060840_483_716 76
571 3300053104 Ga0500556_0032665 Ga0500556_0032665_1421_1654 76
572 3300053109 Ga0500569_289456 Ga0500569_289456_144_377 76
573 3300053118 Ga0500594_0087378 Ga0500594_0087378_641_874 76
574 3300053125 Ga0500618_163139 Ga0500618_163139_133_366 76
575 3300053131 Ga0500652_084026 Ga0500652_084026_310_543 76
576 3300053134 Ga0500658_0341292 Ga0500658_0341292_85_318 76
577 3300053136 Ga0500559_0239727 Ga0500559_0239727_234_467 76
578 3300053137 Ga0500561_0262185 Ga0500561_0262185_200_433 76
579 3300053147 Ga0500589_031996 Ga0500589_031996_1368_1601 76
580 3300053150 Ga0500603_084783 Ga0500603_084783_654_887 76
581 3300053153 Ga0500616_0015278 Ga0500616_0015278_3439_3672 76
582 3300053153 Ga0500616_0161055 Ga0500616_0161055_524_757 76
583 3300053153 Ga0500616_0275983 Ga0500616_0275983_232_465 76
584 3300053156 Ga0500622_0026523 Ga0500622_0026523_86_319 76
585 3300053163 Ga0500639_027948 Ga0500639_027948_1383_1616 76
586 3300053178 Ga0500637_0599881 Ga0500637_0599881_182_415 76
587 3300053727 Ga0500611_000002 Ga0500611_000002_49608_49841 76
588 3300053739 Ga0500587_016627 Ga0500587_016627_529_819 76

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

24

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vjk-assembly1.cif.gz_A putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 0.8899 1 72
5djo-assembly1.cif.gz_A crystal structure of the cc1-fha tandem of kinesin-3 kif13a 0.8852 46 70
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8662 1 76
2qie-assembly1.cif.gz_D staphylococcus aureus molybdopterin synthase in complex with precursor z 0.8651 3 76
2g1l-assembly1.cif.gz_A crystal structure of the fha domain of human kinesin family member c 0.8649 46 70
ID Description Score Start End Superfamily
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8948 3 76 3.10.20.30
af_E7F6P4_395_521_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.888 46 69 2.60.200.20
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8869 1 76 3.10.20.30
af_Q9VN82_366_475_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8835 46 70 2.60.200.20
af_A0A0R4IFD5_328_446_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8821 45 70 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7M3MZC0-F1-model_v4 MoaD/ThiS family protein 0.9763 1 76
AF-A0A2U1A499-F1-model_v4 deleted 0.9723 1 76
AF-A0A7G5XL76-F1-model_v4 MoaD/ThiS family protein 0.9666 1 76
AF-A0A4Q3RZK4-F1-model_v4 MoaD/ThiS family protein 0.9643 1 76
AF-A0A4V2A605-F1-model_v4 MoaD/ThiS family protein 0.964 1 76

Feature Viewer

pLDDT pTM Quality
88.85 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map