F466818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 588 | 243 | 588 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300053739|Ga0500587_016627|Ga0500587_016627_529_819 |
| Length | 96 |
| Sequence | LKKATLQELSNFVELKNHFMAVQVIVFGQLTDILGNSPVNVEGVADTSELVAQLNQRYPALTNAPYIIAVDKQIVNGNTALAGNNTVALLPPFAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 167 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 168 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 177 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 178 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 179 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 180 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 181 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 212 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 214 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 224 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 226 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 227 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 230 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 231 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 232 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 233 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 234 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 235 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 236 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 237 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 240 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 241 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 242 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 243 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.29 |
| Nodule | 0 |
| Rhizoplane | 1.19 |
| Rhizosphere | 89.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c019560 | 3300000041 | Bacteria | 602 |
| 2 | ARcpr5yngRDRAFT_c013356 | 3300000043 | Bacteria | 691 |
| 3 | ARSoilOldRDRAFT_c023452 | 3300000044 | Bacteria | 553 |
| 4 | JGI24743J22301_10083694 | 3300001991 | Unclassified | 675 |
| 5 | JGI24744J21845_10058120 | 3300002077 | Unclassified | 709 |
| 6 | JGI25154J39366_1016321 | 3300002738 | Bacteria | 753 |
| 7 | rootH2_10190875 | 3300003320 | Bacteria | 1321 |
| 8 | rootL2_10171171 | 3300003322 | Bacteria | 1679 |
| 9 | rootH1_10054153 | 3300003323 | Bacteria | 2722 |
| 10 | Ga0065714_10198895 | 3300005288 | Unclassified | 893 |
| 11 | Ga0065704_10091501 | 3300005289 | Unclassified | 2713 |
| 12 | Ga0065704_10602527 | 3300005289 | Bacteria | 606 |
| 13 | Ga0065712_10077592 | 3300005290 | Bacteria | 3465 |
| 14 | Ga0065712_10134098 | 3300005290 | Unclassified | 1471 |
| 15 | Ga0065712_10287453 | 3300005290 | Unclassified | 879 |
| 16 | Ga0065712_10293476 | 3300005290 | Bacteria | 873 |
| 17 | Ga0065715_10019353 | 3300005293 | Unclassified | 1754 |
| 18 | Ga0065715_10273100 | 3300005293 | Unclassified | 1106 |
| 19 | Ga0065715_10451627 | 3300005293 | Unclassified | 741 |
| 20 | Ga0065715_11170100 | 3300005293 | Unclassified | 504 |
| 21 | Ga0065707_10022333 | 3300005295 | Unclassified | 1813 |
| 22 | Ga0065707_10165567 | 3300005295 | Bacteria | 1525 |
| 23 | Ga0065707_10448943 | 3300005295 | Unclassified | 802 |
| 24 | Ga0070676_10014248 | 3300005328 | Unclassified | 4369 |
| 25 | Ga0070683_100204187 | 3300005329 | Unclassified | 1877 |
| 26 | Ga0070690_100270516 | 3300005330 | Bacteria | 1208 |
| 27 | Ga0070670_100038715 | 3300005331 | Bacteria | 4100 |
| 28 | Ga0070670_100300457 | 3300005331 | Bacteria | 1404 |
| 29 | Ga0070670_100707651 | 3300005331 | Bacteria | 906 |
| 30 | Ga0070670_101197380 | 3300005331 | Bacteria | 694 |
| 31 | Ga0070677_10263826 | 3300005333 | Bacteria | 861 |
| 32 | Ga0070677_10313675 | 3300005333 | Unclassified | 801 |
| 33 | Ga0068869_100032681 | 3300005334 | Unclassified | 3668 |
| 34 | Ga0068869_100079604 | 3300005334 | Unclassified | 2442 |
| 35 | Ga0068869_101217139 | 3300005334 | Unclassified | 662 |
| 36 | Ga0068869_101408855 | 3300005334 | Bacteria | 617 |
| 37 | Ga0070666_10741832 | 3300005335 | Bacteria | 721 |
| 38 | Ga0070666_10826864 | 3300005335 | Unclassified | 683 |
| 39 | Ga0070682_101446636 | 3300005337 | Bacteria | 589 |
| 40 | Ga0068868_100024597 | 3300005338 | Bacteria | 4572 |
| 41 | Ga0068868_100210932 | 3300005338 | Bacteria | 1623 |
| 42 | Ga0068868_100606692 | 3300005338 | Unclassified | 970 |
| 43 | Ga0068868_101663998 | 3300005338 | Unclassified | 601 |
| 44 | Ga0070689_100019130 | 3300005340 | Bacteria | 5059 |
| 45 | Ga0070689_100040492 | 3300005340 | Bacteria | 3573 |
| 46 | Ga0070689_100068440 | 3300005340 | Bacteria | 2769 |
| 47 | Ga0070687_100156614 | 3300005343 | Bacteria | 1342 |
| 48 | Ga0070687_100601345 | 3300005343 | Bacteria | 755 |
| 49 | Ga0070661_101899658 | 3300005344 | Bacteria | 506 |
| 50 | Ga0070668_100005828 | 3300005347 | Bacteria | 9138 |
| 51 | Ga0070668_100125658 | 3300005347 | Bacteria | 2054 |
| 52 | Ga0070669_100038346 | 3300005353 | Unclassified | 3478 |
| 53 | Ga0070669_100072872 | 3300005353 | Bacteria | 2544 |
| 54 | Ga0070669_100137279 | 3300005353 | Bacteria | 1882 |
| 55 | Ga0070669_101592448 | 3300005353 | Bacteria | 569 |
| 56 | Ga0070669_101678048 | 3300005353 | Unclassified | 554 |
| 57 | Ga0070675_100075014 | 3300005354 | Bacteria | 2811 |
| 58 | Ga0070675_100155160 | 3300005354 | Bacteria | 1965 |
| 59 | Ga0070675_100463979 | 3300005354 | Bacteria | 1137 |
| 60 | Ga0070675_100889776 | 3300005354 | Unclassified | 816 |
| 61 | Ga0070675_101004958 | 3300005354 | Bacteria | 766 |
| 62 | Ga0070671_100514063 | 3300005355 | Bacteria | 1031 |
| 63 | Ga0070674_100002262 | 3300005356 | Bacteria | 10628 |
| 64 | Ga0070674_100037295 | 3300005356 | Unclassified | 3269 |
| 65 | Ga0070673_100028166 | 3300005364 | Bacteria | 4175 |
| 66 | Ga0070673_100043512 | 3300005364 | Bacteria | 3471 |
| 67 | Ga0070673_100233601 | 3300005364 | Unclassified | 1596 |
| 68 | Ga0070673_100642412 | 3300005364 | Bacteria | 971 |
| 69 | Ga0070673_101108604 | 3300005364 | Bacteria | 739 |
| 70 | Ga0070673_101539764 | 3300005364 | Bacteria | 627 |
| 71 | Ga0070673_101703307 | 3300005364 | Bacteria | 596 |
| 72 | Ga0070673_102357824 | 3300005364 | Bacteria | 506 |
| 73 | Ga0070688_100051239 | 3300005365 | Unclassified | 2575 |
| 74 | Ga0070688_100089746 | 3300005365 | Bacteria | 2006 |
| 75 | Ga0070688_100363963 | 3300005365 | Bacteria | 1062 |
| 76 | Ga0070688_100384287 | 3300005365 | Unclassified | 1035 |
| 77 | Ga0070688_100919032 | 3300005365 | Unclassified | 691 |
| 78 | Ga0070688_101285714 | 3300005365 | Bacteria | 590 |
| 79 | Ga0070667_100044780 | 3300005367 | Bacteria | 3718 |
| 80 | Ga0070667_100147215 | 3300005367 | Unclassified | 2066 |
| 81 | Ga0070667_100387567 | 3300005367 | Bacteria | 1270 |
| 82 | Ga0070667_101624042 | 3300005367 | Unclassified | 608 |
| 83 | Ga0070667_101877193 | 3300005367 | Bacteria | 564 |
| 84 | Ga0070705_100411366 | 3300005440 | Bacteria | 1004 |
| 85 | Ga0070700_101184056 | 3300005441 | Bacteria | 637 |
| 86 | Ga0070700_101249204 | 3300005441 | Bacteria | 622 |
| 87 | Ga0070700_101366520 | 3300005441 | Bacteria | 597 |
| 88 | Ga0070700_101606815 | 3300005441 | Unclassified | 555 |
| 89 | Ga0070694_101719674 | 3300005444 | Bacteria | 534 |
| 90 | Ga0070663_102016675 | 3300005455 | Unclassified | 519 |
| 91 | Ga0070678_100280384 | 3300005456 | Bacteria | 1409 |
| 92 | Ga0070662_100051494 | 3300005457 | Unclassified | 2974 |
| 93 | Ga0068867_100003798 | 3300005459 | Bacteria | 10626 |
| 94 | Ga0068867_100215252 | 3300005459 | Unclassified | 1545 |
| 95 | Ga0068867_100819270 | 3300005459 | Bacteria | 832 |
| 96 | Ga0068867_101536767 | 3300005459 | Unclassified | 621 |
| 97 | Ga0068867_101671655 | 3300005459 | Bacteria | 596 |
| 98 | Ga0068867_102336363 | 3300005459 | Bacteria | 508 |
| 99 | Ga0070685_10011303 | 3300005466 | Bacteria | 4674 |
| 100 | Ga0070685_10168903 | 3300005466 | Unclassified | 1400 |
| 101 | Ga0070685_10576485 | 3300005466 | Bacteria | 806 |
| 102 | Ga0070707_101170133 | 3300005468 | Bacteria | 735 |
| 103 | Ga0070698_100068393 | 3300005471 | Bacteria | 3569 |
| 104 | Ga0070684_100044635 | 3300005535 | Unclassified | 3835 |
| 105 | Ga0068853_100052550 | 3300005539 | Unclassified | 3509 |
| 106 | Ga0068853_100079979 | 3300005539 | Bacteria | 2859 |
| 107 | Ga0068853_100618419 | 3300005539 | Unclassified | 1029 |
| 108 | Ga0068853_100914221 | 3300005539 | Bacteria | 843 |
| 109 | Ga0068853_101250569 | 3300005539 | Unclassified | 717 |
| 110 | Ga0070672_100041352 | 3300005543 | Unclassified | 3543 |
| 111 | Ga0070672_100597881 | 3300005543 | Unclassified | 961 |
| 112 | Ga0070672_100776585 | 3300005543 | Bacteria | 842 |
| 113 | Ga0070686_100794124 | 3300005544 | Unclassified | 762 |
| 114 | Ga0070686_101469819 | 3300005544 | Bacteria | 573 |
| 115 | Ga0070696_101286485 | 3300005546 | Bacteria | 620 |
| 116 | Ga0070693_100152854 | 3300005547 | Bacteria | 1463 |
| 117 | Ga0070665_100016621 | 3300005548 | Bacteria | 7373 |
| 118 | Ga0070665_100057795 | 3300005548 | Unclassified | 3889 |
| 119 | Ga0070704_100188326 | 3300005549 | Unclassified | 1657 |
| 120 | Ga0070704_100276848 | 3300005549 | Bacteria | 1388 |
| 121 | Ga0068855_100306408 | 3300005563 | Bacteria | 1758 |
| 122 | Ga0070664_100073067 | 3300005564 | Unclassified | 2942 |
| 123 | Ga0070664_100723512 | 3300005564 | Bacteria | 928 |
| 124 | Ga0070664_100823153 | 3300005564 | Bacteria | 869 |
| 125 | Ga0070664_101356789 | 3300005564 | Bacteria | 672 |
| 126 | Ga0068857_100509685 | 3300005577 | Bacteria | 1130 |
| 127 | Ga0068857_100577614 | 3300005577 | Bacteria | 1061 |
| 128 | Ga0068854_101027636 | 3300005578 | Bacteria | 731 |
| 129 | Ga0068854_101029637 | 3300005578 | Bacteria | 730 |
| 130 | Ga0068854_101404307 | 3300005578 | Bacteria | 631 |
| 131 | Ga0070702_100677848 | 3300005615 | Bacteria | 783 |
| 132 | Ga0068852_100282762 | 3300005616 | Unclassified | 1600 |
| 133 | Ga0068852_101755126 | 3300005616 | Unclassified | 643 |
| 134 | Ga0068859_100004404 | 3300005617 | Bacteria | 14371 |
| 135 | Ga0068859_100038311 | 3300005617 | Unclassified | 4810 |
| 136 | Ga0068859_100114512 | 3300005617 | Bacteria | 2761 |
| 137 | Ga0068859_100214701 | 3300005617 | Bacteria | 2011 |
| 138 | Ga0068859_100218717 | 3300005617 | Bacteria | 1992 |
| 139 | Ga0068859_100239690 | 3300005617 | Bacteria | 1902 |
| 140 | Ga0068859_100304908 | 3300005617 | Bacteria | 1686 |
| 141 | Ga0068859_101294357 | 3300005617 | Unclassified | 803 |
| 142 | Ga0068859_101415404 | 3300005617 | Bacteria | 767 |
| 143 | Ga0068859_102101044 | 3300005617 | Bacteria | 623 |
| 144 | Ga0068864_100023053 | 3300005618 | Bacteria | 5226 |
| 145 | Ga0068864_100524555 | 3300005618 | Bacteria | 1142 |
| 146 | Ga0068864_100525501 | 3300005618 | Bacteria | 1141 |
| 147 | Ga0068864_101201957 | 3300005618 | Unclassified | 757 |
| 148 | Ga0068864_101353101 | 3300005618 | Bacteria | 713 |
| 149 | Ga0068864_101711874 | 3300005618 | Bacteria | 633 |
| 150 | Ga0068864_102330539 | 3300005618 | Bacteria | 542 |
| 151 | Ga0068866_10053790 | 3300005718 | Bacteria | 2060 |
| 152 | Ga0068866_11089471 | 3300005718 | Bacteria | 572 |
| 153 | Ga0068861_100191358 | 3300005719 | Bacteria | 1710 |
| 154 | Ga0068861_100330256 | 3300005719 | Bacteria | 1331 |
| 155 | Ga0068861_100487175 | 3300005719 | Unclassified | 1112 |
| 156 | Ga0068861_101143043 | 3300005719 | Unclassified | 750 |
| 157 | Ga0068861_101373559 | 3300005719 | Bacteria | 689 |
| 158 | Ga0068861_102421600 | 3300005719 | Bacteria | 528 |
| 159 | Ga0068870_10039824 | 3300005840 | Bacteria | 2433 |
| 160 | Ga0068870_10246999 | 3300005840 | Bacteria | 1104 |
| 161 | Ga0068863_100395807 | 3300005841 | Unclassified | 1350 |
| 162 | Ga0068863_100597451 | 3300005841 | Bacteria | 1092 |
| 163 | Ga0068863_100747867 | 3300005841 | Bacteria | 973 |
| 164 | Ga0068863_100766508 | 3300005841 | Bacteria | 961 |
| 165 | Ga0068863_100815032 | 3300005841 | Unclassified | 931 |
| 166 | Ga0068863_101031498 | 3300005841 | Bacteria | 826 |
| 167 | Ga0068858_100127805 | 3300005842 | Unclassified | 2381 |
| 168 | Ga0068858_100129440 | 3300005842 | Unclassified | 2366 |
| 169 | Ga0068858_101660440 | 3300005842 | Bacteria | 631 |
| 170 | Ga0068858_101986715 | 3300005842 | Bacteria | 575 |
| 171 | Ga0068860_100066104 | 3300005843 | Bacteria | 3434 |
| 172 | Ga0068860_100092893 | 3300005843 | Bacteria | 2875 |
| 173 | Ga0068860_100144518 | 3300005843 | Unclassified | 2288 |
| 174 | Ga0068860_100289886 | 3300005843 | Bacteria | 1601 |
| 175 | Ga0068860_100348859 | 3300005843 | Bacteria | 1456 |
| 176 | Ga0068860_102161698 | 3300005843 | Unclassified | 578 |
| 177 | Ga0068862_100050350 | 3300005844 | Unclassified | 3560 |
| 178 | Ga0068862_100739135 | 3300005844 | Bacteria | 956 |
| 179 | Ga0068862_100939108 | 3300005844 | Bacteria | 852 |
| 180 | Ga0068862_101031949 | 3300005844 | Bacteria | 815 |
| 181 | Ga0068862_101912446 | 3300005844 | Bacteria | 603 |
| 182 | Ga0075366_10013347 | 3300006195 | Bacteria | 4675 |
| 183 | Ga0075366_10079110 | 3300006195 | Bacteria | 1962 |
| 184 | Ga0075366_10090286 | 3300006195 | Bacteria | 1835 |
| 185 | Ga0075366_10190269 | 3300006195 | Bacteria | 1247 |
| 186 | Ga0075366_10234308 | 3300006195 | Unclassified | 1119 |
| 187 | Ga0097621_100006252 | 3300006237 | Bacteria | 8451 |
| 188 | Ga0097621_100036651 | 3300006237 | Unclassified | 3924 |
| 189 | Ga0097621_100572893 | 3300006237 | Unclassified | 1029 |
| 190 | Ga0097621_100735477 | 3300006237 | Bacteria | 910 |
| 191 | Ga0097621_102144460 | 3300006237 | Bacteria | 534 |
| 192 | Ga0097621_102183760 | 3300006237 | Bacteria | 529 |
| 193 | Ga0068871_100028294 | 3300006358 | Bacteria | 4393 |
| 194 | Ga0068871_100359833 | 3300006358 | Bacteria | 1289 |
| 195 | Ga0068871_100473591 | 3300006358 | Unclassified | 1125 |
| 196 | Ga0068871_101239007 | 3300006358 | Unclassified | 700 |
| 197 | Ga0068871_101541575 | 3300006358 | Bacteria | 628 |
| 198 | Ga0075428_100006620 | 3300006844 | Bacteria | 12891 |
| 199 | Ga0075428_100120899 | 3300006844 | Bacteria | 2852 |
| 200 | Ga0075428_102758584 | 3300006844 | Bacteria | 500 |
| 201 | Ga0075430_100188341 | 3300006846 | Bacteria | 1715 |
| 202 | Ga0075430_100569402 | 3300006846 | Bacteria | 934 |
| 203 | Ga0075431_100000866 | 3300006847 | Bacteria | 26579 |
| 204 | Ga0075431_100775352 | 3300006847 | Bacteria | 933 |
| 205 | Ga0075431_101158091 | 3300006847 | Bacteria | 737 |
| 206 | Ga0075434_102313250 | 3300006871 | Bacteria | 540 |
| 207 | Ga0075429_100006687 | 3300006880 | Bacteria | 9994 |
| 208 | Ga0075429_100009709 | 3300006880 | Bacteria | 8341 |
| 209 | Ga0075429_100165515 | 3300006880 | Bacteria | 1937 |
| 210 | Ga0068865_100004271 | 3300006881 | Bacteria | 8620 |
| 211 | Ga0068865_100141827 | 3300006881 | Unclassified | 1813 |
| 212 | Ga0068865_101135540 | 3300006881 | Bacteria | 689 |
| 213 | Ga0068865_101339377 | 3300006881 | Bacteria | 637 |
| 214 | Ga0097620_100004404 | 3300006931 | Bacteria | 14371 |
| 215 | Ga0097620_100038312 | 3300006931 | Unclassified | 4810 |
| 216 | Ga0097620_100114503 | 3300006931 | Bacteria | 2761 |
| 217 | Ga0097620_100214718 | 3300006931 | Bacteria | 2011 |
| 218 | Ga0097620_100218737 | 3300006931 | Bacteria | 1992 |
| 219 | Ga0097620_100239699 | 3300006931 | Bacteria | 1902 |
| 220 | Ga0097620_100304931 | 3300006931 | Bacteria | 1686 |
| 221 | Ga0097620_101294580 | 3300006931 | Unclassified | 803 |
| 222 | Ga0097620_101415290 | 3300006931 | Bacteria | 767 |
| 223 | Ga0097620_102101023 | 3300006931 | Bacteria | 623 |
| 224 | Ga0105240_10781773 | 3300009093 | Bacteria | 1035 |
| 225 | Ga0111539_10095344 | 3300009094 | Bacteria | 3495 |
| 226 | Ga0111539_10124969 | 3300009094 | Bacteria | 3015 |
| 227 | Ga0111539_10246021 | 3300009094 | Bacteria | 2082 |
| 228 | Ga0111539_10531161 | 3300009094 | Bacteria | 1371 |
| 229 | Ga0111539_10742612 | 3300009094 | Bacteria | 1142 |
| 230 | Ga0111539_13162744 | 3300009094 | Bacteria | 531 |
| 231 | Ga0105245_10567915 | 3300009098 | Bacteria | 1158 |
| 232 | Ga0105245_13133618 | 3300009098 | Bacteria | 512 |
| 233 | Ga0105247_10007209 | 3300009101 | Bacteria | 6826 |
| 234 | Ga0105247_10350512 | 3300009101 | Bacteria | 1038 |
| 235 | Ga0114129_10001572 | 3300009147 | Bacteria | 31003 |
| 236 | Ga0114129_10003569 | 3300009147 | Bacteria | 21902 |
| 237 | Ga0114129_10114463 | 3300009147 | Bacteria | 3719 |
| 238 | Ga0114129_10259114 | 3300009147 | Bacteria | 2332 |
| 239 | Ga0114129_10535051 | 3300009147 | Bacteria | 1526 |
| 240 | Ga0105241_10070874 | 3300009174 | Bacteria | 2705 |
| 241 | Ga0105241_10210813 | 3300009174 | Bacteria | 1628 |
| 242 | Ga0105241_11227681 | 3300009174 | Bacteria | 711 |
| 243 | Ga0105241_11645805 | 3300009174 | Bacteria | 622 |
| 244 | Ga0105242_10025664 | 3300009176 | Unclassified | 4665 |
| 245 | Ga0105242_10177261 | 3300009176 | Unclassified | 1878 |
| 246 | Ga0105242_10250957 | 3300009176 | Bacteria | 1594 |
| 247 | Ga0105242_10269261 | 3300009176 | Unclassified | 1542 |
| 248 | Ga0105242_11648972 | 3300009176 | Bacteria | 676 |
| 249 | Ga0105242_12121081 | 3300009176 | Bacteria | 606 |
| 250 | Ga0105242_13037424 | 3300009176 | Bacteria | 520 |
| 251 | Ga0105248_10225161 | 3300009177 | Unclassified | 2111 |
| 252 | Ga0105248_10834133 | 3300009177 | Bacteria | 1040 |
| 253 | Ga0105248_11523997 | 3300009177 | Bacteria | 757 |
| 254 | Ga0105248_11999878 | 3300009177 | Unclassified | 658 |
| 255 | Ga0105237_10012365 | 3300009545 | Bacteria | 8995 |
| 256 | Ga0105249_10015498 | 3300009553 | Bacteria | 6747 |
| 257 | Ga0105249_10020990 | 3300009553 | Bacteria | 5844 |
| 258 | Ga0105249_10055960 | 3300009553 | Bacteria | 3611 |
| 259 | Ga0105249_10146222 | 3300009553 | Unclassified | 2271 |
| 260 | Ga0105249_10154060 | 3300009553 | Bacteria | 2215 |
| 261 | Ga0105249_11099725 | 3300009553 | Unclassified | 865 |
| 262 | Ga0105249_11331084 | 3300009553 | Unclassified | 790 |
| 263 | Ga0105249_11984712 | 3300009553 | Unclassified | 655 |
| 264 | Ga0105239_10006184 | 3300010375 | Bacteria | 13934 |
| 265 | Ga0105239_11150146 | 3300010375 | Unclassified | 894 |
| 266 | Ga0105239_11543578 | 3300010375 | Bacteria | 768 |
| 267 | Ga0105246_10087749 | 3300011119 | Bacteria | 2233 |
| 268 | Ga0105246_10118181 | 3300011119 | Unclassified | 1960 |
| 269 | Ga0157373_11550886 | 3300013100 | Unclassified | 506 |
| 270 | Ga0157370_10270778 | 3300013104 | Unclassified | 1569 |
| 271 | Ga0157370_10391965 | 3300013104 | Bacteria | 1279 |
| 272 | Ga0157370_10795013 | 3300013104 | Bacteria | 861 |
| 273 | Ga0157374_10055794 | 3300013296 | Bacteria | 3688 |
| 274 | Ga0157374_10117992 | 3300013296 | Bacteria | 2558 |
| 275 | Ga0157374_11397124 | 3300013296 | Bacteria | 723 |
| 276 | Ga0157378_10661608 | 3300013297 | Bacteria | 1061 |
| 277 | Ga0157378_10731467 | 3300013297 | Bacteria | 1011 |
| 278 | Ga0157378_11525129 | 3300013297 | Bacteria | 713 |
| 279 | Ga0163162_10029655 | 3300013306 | Bacteria | 5416 |
| 280 | Ga0163162_10088421 | 3300013306 | Unclassified | 3177 |
| 281 | Ga0163162_10803864 | 3300013306 | Bacteria | 1058 |
| 282 | Ga0157372_10991725 | 3300013307 | Unclassified | 973 |
| 283 | Ga0157372_11169548 | 3300013307 | Unclassified | 889 |
| 284 | Ga0157372_12595780 | 3300013307 | Unclassified | 581 |
| 285 | Ga0157372_12658660 | 3300013307 | Bacteria | 574 |
| 286 | Ga0157375_10072939 | 3300013308 | Bacteria | 3451 |
| 287 | Ga0157375_10743772 | 3300013308 | Bacteria | 1132 |
| 288 | Ga0157375_12604388 | 3300013308 | Bacteria | 604 |
| 289 | Ga0157375_12631231 | 3300013308 | Bacteria | 601 |
| 290 | Ga0163163_10057069 | 3300014325 | Unclassified | 3860 |
| 291 | Ga0163163_10112665 | 3300014325 | Bacteria | 2750 |
| 292 | Ga0163163_10549203 | 3300014325 | Bacteria | 1218 |
| 293 | Ga0163163_10564483 | 3300014325 | Unclassified | 1201 |
| 294 | Ga0157380_10024955 | 3300014326 | Bacteria | 4529 |
| 295 | Ga0157380_10029842 | 3300014326 | Bacteria | 4170 |
| 296 | Ga0157380_10215075 | 3300014326 | Bacteria | 1716 |
| 297 | Ga0157380_10356885 | 3300014326 | Bacteria | 1370 |
| 298 | Ga0157380_10390375 | 3300014326 | Bacteria | 1317 |
| 299 | Ga0157380_10458256 | 3300014326 | Bacteria | 1227 |
| 300 | Ga0157380_10730576 | 3300014326 | Bacteria | 999 |
| 301 | Ga0157380_10812123 | 3300014326 | Bacteria | 953 |
| 302 | Ga0157380_11568759 | 3300014326 | Bacteria | 713 |
| 303 | Ga0157380_13203270 | 3300014326 | Bacteria | 523 |
| 304 | Ga0157377_10089403 | 3300014745 | Unclassified | 1816 |
| 305 | Ga0157377_10230051 | 3300014745 | Bacteria | 1191 |
| 306 | Ga0157377_10342956 | 3300014745 | Unclassified | 1000 |
| 307 | Ga0157379_10155294 | 3300014968 | Unclassified | 2064 |
| 308 | Ga0157379_10228373 | 3300014968 | Unclassified | 1687 |
| 309 | Ga0157379_11601596 | 3300014968 | Bacteria | 636 |
| 310 | Ga0157379_12042297 | 3300014968 | Unclassified | 567 |
| 311 | Ga0157376_10263681 | 3300014969 | Unclassified | 1615 |
| 312 | Ga0157376_10266247 | 3300014969 | Unclassified | 1608 |
| 313 | Ga0157376_10546771 | 3300014969 | Bacteria | 1145 |
| 314 | Ga0157376_10601837 | 3300014969 | Bacteria | 1094 |
| 315 | Ga0157376_12519585 | 3300014969 | Bacteria | 554 |
| 316 | Ga0163161_10000890 | 3300017792 | Bacteria | 23195 |
| 317 | Ga0163161_10273208 | 3300017792 | Bacteria | 1323 |
| 318 | Ga0163161_10431474 | 3300017792 | Unclassified | 1062 |
| 319 | Ga0163161_10652137 | 3300017792 | Bacteria | 872 |
| 320 | Ga0163161_10750855 | 3300017792 | Bacteria | 816 |
| 321 | Ga0163161_11355543 | 3300017792 | Bacteria | 620 |
| 322 | Ga0163161_11389554 | 3300017792 | Unclassified | 613 |
| 323 | Ga0209646_1005623 | 3300025246 | Bacteria | 2166 |
| 324 | Ga0207697_10162640 | 3300025315 | Bacteria | 974 |
| 325 | Ga0207697_10190333 | 3300025315 | Bacteria | 901 |
| 326 | Ga0207656_10026103 | 3300025321 | Unclassified | 2378 |
| 327 | Ga0207642_10027412 | 3300025899 | Unclassified | 2331 |
| 328 | Ga0207710_10000852 | 3300025900 | Bacteria | 16442 |
| 329 | Ga0207688_10013484 | 3300025901 | Unclassified | 4442 |
| 330 | Ga0207680_10029382 | 3300025903 | Unclassified | 3087 |
| 331 | Ga0207645_10001934 | 3300025907 | Bacteria | 16720 |
| 332 | Ga0207645_10096614 | 3300025907 | Unclassified | 1903 |
| 333 | Ga0207643_10005138 | 3300025908 | Bacteria | 7002 |
| 334 | Ga0207643_10030001 | 3300025908 | Bacteria | 3025 |
| 335 | Ga0207654_11030141 | 3300025911 | Unclassified | 599 |
| 336 | Ga0207654_11149054 | 3300025911 | Unclassified | 566 |
| 337 | Ga0207695_10634553 | 3300025913 | Bacteria | 949 |
| 338 | Ga0207662_10021709 | 3300025918 | Unclassified | 3673 |
| 339 | Ga0207646_10204874 | 3300025922 | Bacteria | 1782 |
| 340 | Ga0207646_11410182 | 3300025922 | Bacteria | 606 |
| 341 | Ga0207681_10020255 | 3300025923 | Unclassified | 4212 |
| 342 | Ga0207681_10138611 | 3300025923 | Unclassified | 1809 |
| 343 | Ga0207681_11622583 | 3300025923 | Bacteria | 541 |
| 344 | Ga0207681_11800925 | 3300025923 | Bacteria | 511 |
| 345 | Ga0207650_10057288 | 3300025925 | Unclassified | 2898 |
| 346 | Ga0207650_10911328 | 3300025925 | Bacteria | 746 |
| 347 | Ga0207659_10028420 | 3300025926 | Bacteria | 3801 |
| 348 | Ga0207659_10050201 | 3300025926 | Bacteria | 2963 |
| 349 | Ga0207659_10136972 | 3300025926 | Unclassified | 1896 |
| 350 | Ga0207659_10730629 | 3300025926 | Unclassified | 849 |
| 351 | Ga0207659_11408963 | 3300025926 | Bacteria | 597 |
| 352 | Ga0207644_10427397 | 3300025931 | Unclassified | 1086 |
| 353 | Ga0207644_10690339 | 3300025931 | Unclassified | 851 |
| 354 | Ga0207644_11707347 | 3300025931 | Bacteria | 527 |
| 355 | Ga0207706_10027723 | 3300025933 | Bacteria | 5064 |
| 356 | Ga0207706_11411285 | 3300025933 | Bacteria | 571 |
| 357 | Ga0207686_10138188 | 3300025934 | Unclassified | 1680 |
| 358 | Ga0207686_10170855 | 3300025934 | Unclassified | 1533 |
| 359 | Ga0207686_10262791 | 3300025934 | Unclassified | 1266 |
| 360 | Ga0207686_10600542 | 3300025934 | Bacteria | 866 |
| 361 | Ga0207686_10816629 | 3300025934 | Bacteria | 748 |
| 362 | Ga0207670_10062831 | 3300025936 | Bacteria | 2539 |
| 363 | Ga0207670_10110623 | 3300025936 | Unclassified | 1979 |
| 364 | Ga0207670_10233537 | 3300025936 | Unclassified | 1413 |
| 365 | Ga0207669_10684285 | 3300025937 | Unclassified | 842 |
| 366 | Ga0207669_10755534 | 3300025937 | Bacteria | 803 |
| 367 | Ga0207704_10020737 | 3300025938 | Unclassified | 3484 |
| 368 | Ga0207704_10238726 | 3300025938 | Unclassified | 1356 |
| 369 | Ga0207704_10489295 | 3300025938 | Bacteria | 989 |
| 370 | Ga0207704_11190977 | 3300025938 | Bacteria | 649 |
| 371 | Ga0207691_10201402 | 3300025940 | Unclassified | 1732 |
| 372 | Ga0207691_10595724 | 3300025940 | Unclassified | 936 |
| 373 | Ga0207691_10903708 | 3300025940 | Unclassified | 739 |
| 374 | Ga0207691_11139245 | 3300025940 | Bacteria | 648 |
| 375 | Ga0207711_10515604 | 3300025941 | Bacteria | 1115 |
| 376 | Ga0207689_10015791 | 3300025942 | Bacteria | 6393 |
| 377 | Ga0207689_10067860 | 3300025942 | Unclassified | 2930 |
| 378 | Ga0207689_10104803 | 3300025942 | Unclassified | 2324 |
| 379 | Ga0207689_10215348 | 3300025942 | Unclassified | 1587 |
| 380 | Ga0207661_10988072 | 3300025944 | Unclassified | 775 |
| 381 | Ga0207679_10257658 | 3300025945 | Unclassified | 1486 |
| 382 | Ga0207679_11399723 | 3300025945 | Bacteria | 642 |
| 383 | Ga0207667_10183389 | 3300025949 | Bacteria | 2149 |
| 384 | Ga0207651_10031755 | 3300025960 | Bacteria | 3381 |
| 385 | Ga0207651_10044105 | 3300025960 | Bacteria | 2982 |
| 386 | Ga0207651_12036760 | 3300025960 | Bacteria | 516 |
| 387 | Ga0207712_10026024 | 3300025961 | Bacteria | 3894 |
| 388 | Ga0207712_10042119 | 3300025961 | Unclassified | 3143 |
| 389 | Ga0207712_10144811 | 3300025961 | Bacteria | 1828 |
| 390 | Ga0207712_10171962 | 3300025961 | Unclassified | 1694 |
| 391 | Ga0207712_10551407 | 3300025961 | Unclassified | 991 |
| 392 | Ga0207712_10713789 | 3300025961 | Bacteria | 876 |
| 393 | Ga0207712_11461293 | 3300025961 | Bacteria | 612 |
| 394 | Ga0207668_10098877 | 3300025972 | Bacteria | 2163 |
| 395 | Ga0207668_10265856 | 3300025972 | Bacteria | 1400 |
| 396 | Ga0207668_10276264 | 3300025972 | Bacteria | 1375 |
| 397 | Ga0207668_10952283 | 3300025972 | Bacteria | 766 |
| 398 | Ga0207640_10153003 | 3300025981 | Bacteria | 1697 |
| 399 | Ga0207640_10591306 | 3300025981 | Bacteria | 938 |
| 400 | Ga0207640_11644422 | 3300025981 | Bacteria | 579 |
| 401 | Ga0207658_10046164 | 3300025986 | Unclassified | 3180 |
| 402 | Ga0207658_10109364 | 3300025986 | Unclassified | 2182 |
| 403 | Ga0207658_10158804 | 3300025986 | Unclassified | 1851 |
| 404 | Ga0207658_10509640 | 3300025986 | Unclassified | 1073 |
| 405 | Ga0207677_10355045 | 3300026023 | Bacteria | 1230 |
| 406 | Ga0207677_10460297 | 3300026023 | Bacteria | 1092 |
| 407 | Ga0207677_10505142 | 3300026023 | Bacteria | 1046 |
| 408 | Ga0207703_10938205 | 3300026035 | Unclassified | 829 |
| 409 | Ga0207639_10201451 | 3300026041 | Unclassified | 1707 |
| 410 | Ga0207639_10213057 | 3300026041 | Unclassified | 1664 |
| 411 | Ga0207639_11851134 | 3300026041 | Unclassified | 564 |
| 412 | Ga0207678_10696207 | 3300026067 | Bacteria | 894 |
| 413 | Ga0207708_10345876 | 3300026075 | Unclassified | 1219 |
| 414 | Ga0207702_10196986 | 3300026078 | Unclassified | 1865 |
| 415 | Ga0207641_10000380 | 3300026088 | Bacteria | 52801 |
| 416 | Ga0207641_10210850 | 3300026088 | Unclassified | 1796 |
| 417 | Ga0207641_10507230 | 3300026088 | Bacteria | 1172 |
| 418 | Ga0207641_10509003 | 3300026088 | Bacteria | 1170 |
| 419 | Ga0207641_11047549 | 3300026088 | Bacteria | 813 |
| 420 | Ga0207641_11852119 | 3300026088 | Unclassified | 605 |
| 421 | Ga0207648_10003538 | 3300026089 | Bacteria | 16338 |
| 422 | Ga0207648_10110130 | 3300026089 | Unclassified | 2418 |
| 423 | Ga0207648_10361881 | 3300026089 | Bacteria | 1309 |
| 424 | Ga0207648_11648571 | 3300026089 | Bacteria | 602 |
| 425 | Ga0207676_10018751 | 3300026095 | Bacteria | 5037 |
| 426 | Ga0207676_10068244 | 3300026095 | Bacteria | 2843 |
| 427 | Ga0207676_10133718 | 3300026095 | Unclassified | 2113 |
| 428 | Ga0207676_10421707 | 3300026095 | Bacteria | 1252 |
| 429 | Ga0207676_10774923 | 3300026095 | Unclassified | 934 |
| 430 | Ga0207676_12445771 | 3300026095 | Bacteria | 519 |
| 431 | Ga0207674_10233105 | 3300026116 | Bacteria | 1789 |
| 432 | Ga0207675_100184283 | 3300026118 | Unclassified | 2000 |
| 433 | Ga0207675_100748762 | 3300026118 | Unclassified | 988 |
| 434 | Ga0207675_101063907 | 3300026118 | Unclassified | 828 |
| 435 | Ga0207675_101354720 | 3300026118 | Bacteria | 732 |
| 436 | Ga0207675_101615391 | 3300026118 | Bacteria | 669 |
| 437 | Ga0207675_101817623 | 3300026118 | Bacteria | 628 |
| 438 | Ga0207683_10000691 | 3300026121 | Bacteria | 30953 |
| 439 | Ga0207683_10049417 | 3300026121 | Bacteria | 3682 |
| 440 | Ga0207698_10375963 | 3300026142 | Unclassified | 1350 |
| 441 | Ga0207698_10477512 | 3300026142 | Unclassified | 1209 |
| 442 | Ga0207698_10977676 | 3300026142 | Bacteria | 856 |
| 443 | Ga0207698_11181630 | 3300026142 | Bacteria | 779 |
| 444 | Ga0207698_11367266 | 3300026142 | Bacteria | 723 |
| 445 | Ga0209996_1037412 | 3300027395 | Bacteria | 717 |
| 446 | Ga0207428_10575838 | 3300027907 | Bacteria | 813 |
| 447 | Ga0207428_10900508 | 3300027907 | Unclassified | 625 |
| 448 | Ga0268266_10011708 | 3300028379 | Bacteria | 7610 |
| 449 | Ga0268266_10064584 | 3300028379 | Unclassified | 3163 |
| 450 | Ga0268265_10301992 | 3300028380 | Unclassified | 1442 |
| 451 | Ga0268265_11554151 | 3300028380 | Bacteria | 666 |
| 452 | Ga0268265_12177172 | 3300028380 | Unclassified | 561 |
| 453 | Ga0268265_12364993 | 3300028380 | Bacteria | 538 |
| 454 | Ga0268264_10044674 | 3300028381 | Bacteria | 3675 |
| 455 | Ga0268264_10122469 | 3300028381 | Unclassified | 2294 |
| 456 | Ga0268264_10171452 | 3300028381 | Unclassified | 1963 |
| 457 | Ga0268264_11981028 | 3300028381 | Bacteria | 592 |
| 458 | Ga0307512_10340977 | 3300030522 | Bacteria | 667 |
| 459 | Ga0307512_10427024 | 3300030522 | Bacteria | 545 |
| 460 | Ga0265327_10007307 | 3300031251 | Bacteria | 8564 |
| 461 | Ga0265327_10173025 | 3300031251 | Bacteria | 991 |
| 462 | Ga0307513_10210849 | 3300031456 | Bacteria | 1774 |
| 463 | Ga0307513_10859008 | 3300031456 | Unclassified | 614 |
| 464 | Ga0307513_10918808 | 3300031456 | Bacteria | 583 |
| 465 | Ga0307509_10107276 | 3300031507 | Bacteria | 2809 |
| 466 | Ga0307516_10501757 | 3300031730 | Bacteria | 868 |
| 467 | Ga0307416_103479472 | 3300032002 | Unclassified | 527 |
| 468 | Ga0307414_10034778 | 3300032004 | Bacteria | 3346 |
| 469 | Ga0373943_0726622 | 3300035170 | Bacteria | 589 |
| 470 | Ga0373946_0372405 | 3300035171 | Bacteria | 717 |
| 471 | Ga0373931_1280048 | 3300035691 | Bacteria | 504 |
| 472 | Ga0373927_0721733 | 3300035695 | Bacteria | 658 |
| 473 | Ga0373937_0585538 | 3300036401 | Bacteria | 1059 |
| 474 | Ga0439436_0012382 | 3300041404 | Bacteria | 2590 |
| 475 | Ga0439453_0046763 | 3300041408 | Bacteria | 864 |
| 476 | Ga0451795_0056838 | 3300041456 | Bacteria | 698 |
| 477 | Ga0451800_0429729 | 3300041459 | Bacteria | 703 |
| 478 | Ga0451802_0622033 | 3300041460 | Bacteria | 734 |
| 479 | Ga0451802_1058775 | 3300041460 | Bacteria | 502 |
| 480 | Ga0451804_0981626 | 3300041463 | Bacteria | 617 |
| 481 | Ga0451807_2307153 | 3300041486 | Unclassified | 620 |
| 482 | Ga0451841_0886561 | 3300041498 | Bacteria | 1103 |
| 483 | Ga0451853_0925210 | 3300041512 | Bacteria | 635 |
| 484 | Ga0451853_1010871 | 3300041512 | Bacteria | 506 |
| 485 | Ga0451853_3208196 | 3300041512 | Bacteria | 1012 |
| 486 | Ga0451853_3668395 | 3300041512 | Bacteria | 1447 |
| 487 | Ga0451853_4052459 | 3300041512 | Bacteria | 523 |
| 488 | Ga0439449_0014815 | 3300042007 | Bacteria | 2930 |
| 489 | Ga0439457_000827 | 3300042014 | Bacteria | 9289 |
| 490 | Ga0439462_0052773 | 3300042015 | Bacteria | 1094 |
| 491 | Ga0450922_038939 | 3300042124 | Bacteria | 534 |
| 492 | Ga0450898_052481 | 3300042134 | Bacteria | 790 |
| 493 | Ga0439434_0318531 | 3300042435 | Bacteria | 540 |
| 494 | Ga0439435_0174463 | 3300042436 | Bacteria | 700 |
| 495 | Ga0451577_0605583 | 3300042876 | Unclassified | 994 |
| 496 | Ga0466969_0000103 | 3300044656 | Bacteria | 44804 |
| 497 | Ga0466972_0000012 | 3300044658 | Bacteria | 246338 |
| 498 | Ga0466972_0110891 | 3300044658 | Bacteria | 1296 |
| 499 | Ga0466965_0272273 | 3300044683 | Bacteria | 913 |
| 500 | Ga0466965_0695624 | 3300044683 | Unclassified | 583 |
| 501 | Ga0466966_0000097 | 3300044684 | Bacteria | 53836 |
| 502 | Ga0453684_0183994 | 3300044712 | Unclassified | 2450 |
| 503 | Ga0466968_0230113 | 3300044735 | Bacteria | 875 |
| 504 | Ga0466970_0740258 | 3300044765 | Bacteria | 574 |
| 505 | Ga0466957_0009079 | 3300044842 | Bacteria | 5667 |
| 506 | Ga0466957_0014317 | 3300044842 | Bacteria | 4618 |
| 507 | Ga0466959_0000049 | 3300045049 | Bacteria | 83496 |
| 508 | Ga0495638_0069041 | 3300046460 | Unclassified | 2166 |
| 509 | Ga0495607_0101333 | 3300046501 | Unclassified | 1542 |
| 510 | Ga0495607_0115363 | 3300046501 | Unclassified | 1418 |
| 511 | Ga0495632_0122710 | 3300046519 | Bacteria | 1213 |
| 512 | Ga0495632_0489216 | 3300046519 | Bacteria | 531 |
| 513 | Ga0495643_0063325 | 3300046522 | Bacteria | 1956 |
| 514 | Ga0495654_0239044 | 3300046530 | Unclassified | 761 |
| 515 | Ga0495598_0189939 | 3300046537 | Bacteria | 737 |
| 516 | Ga0495621_0028583 | 3300046539 | Unclassified | 1896 |
| 517 | Ga0495621_0116299 | 3300046539 | Bacteria | 1030 |
| 518 | Ga0495668_0000489 | 3300046616 | Bacteria | 49613 |
| 519 | Ga0495670_0053912 | 3300046691 | Bacteria | 2014 |
| 520 | Ga0495686_0061584 | 3300047472 | Unclassified | 2330 |
| 521 | Ga0495686_0188332 | 3300047472 | Bacteria | 1191 |
| 522 | Ga0496111_0931224 | 3300048914 | Bacteria | 625 |
| 523 | Ga0496126_0795040 | 3300048929 | Bacteria | 726 |
| 524 | Ga0501031_0400454 | 3300049568 | Bacteria | 888 |
| 525 | Ga0501033_0175488 | 3300049570 | Unclassified | 1538 |
| 526 | Ga0501034_0637895 | 3300049571 | Unclassified | 968 |
| 527 | Ga0501034_1273796 | 3300049571 | Unclassified | 612 |
| 528 | Ga0501034_1363491 | 3300049571 | Bacteria | 585 |
| 529 | Ga0501036_1634316 | 3300049572 | Unclassified | 520 |
| 530 | Ga0501043_0344141 | 3300049579 | Bacteria | 1134 |
| 531 | Ga0501047_0004068 | 3300049581 | Bacteria | 13756 |
| 532 | Ga0501047_0121669 | 3300049581 | Bacteria | 2491 |
| 533 | Ga0501047_0484911 | 3300049581 | Unclassified | 1064 |
| 534 | Ga0501233_054208 | 3300049668 | Unclassified | 979 |
| 535 | Ga0501257_018663 | 3300049686 | Bacteria | 1619 |
| 536 | Ga0501257_180274 | 3300049686 | Unclassified | 597 |
| 537 | Ga0501225_0002922 | 3300049705 | Bacteria | 5247 |
| 538 | Ga0501245_146200 | 3300049708 | Bacteria | 519 |
| 539 | Ga0501241_126903 | 3300049758 | Unclassified | 571 |
| 540 | Ga0501035_0239732 | 3300049822 | Bacteria | 1543 |
| 541 | Ga0501044_0033123 | 3300049823 | Bacteria | 5430 |
| 542 | Ga0501044_0963495 | 3300049823 | Bacteria | 726 |
| 543 | nmdc:mga0k408_206436_c1 | 3300050493 | Bacteria | 1173 |
| 544 | nmdc:mga0k408_265875_c1 | 3300050493 | Bacteria | 1024 |
| 545 | nmdc:mga0k408_32475_c1 | 3300050493 | Bacteria | 2982 |
| 546 | nmdc:mga0k408_34935_c1 | 3300050493 | Bacteria | 2880 |
| 547 | nmdc:mga0k408_4631_c1 | 3300050493 | Bacteria | 7285 |
| 548 | nmdc:mga0k408_480179_c1 | 3300050493 | Bacteria | 737 |
| 549 | nmdc:mga05p37_1276461_c1 | 3300050507 | Unclassified | 751 |
| 550 | nmdc:mga05p37_20024_c2 | 3300050507 | Bacteria | 7172 |
| 551 | nmdc:mga05p37_905856_c1 | 3300050507 | Bacteria | 950 |
| 552 | nmdc:mga09592_1122906_c1 | 3300050508 | Bacteria | 653 |
| 553 | nmdc:mga09592_153430_c1 | 3300050508 | Bacteria | 1988 |
| 554 | nmdc:mga09592_38049_c1 | 3300050508 | Unclassified | 4037 |
| 555 | nmdc:mga0qj67_143585_c1 | 3300050509 | Bacteria | 1935 |
| 556 | nmdc:mga0qj67_512782_c1 | 3300050509 | Bacteria | 963 |
| 557 | nmdc:mga06r32_758920_c1 | 3300050510 | Bacteria | 933 |
| 558 | nmdc:mga06r32_9671_c1 | 3300050510 | Bacteria | 8709 |
| 559 | nmdc:mga08y16_1061793_c1 | 3300050511 | Bacteria | 787 |
| 560 | nmdc:mga08y16_123242_c1 | 3300050511 | Bacteria | 2697 |
| 561 | nmdc:mga08y16_1466422_c1 | 3300050511 | Bacteria | 644 |
| 562 | nmdc:mga08y16_55351_c1 | 3300050511 | Bacteria | 4145 |
| 563 | Ga0500578_0000934 | 3300053086 | Bacteria | 32814 |
| 564 | Ga0500578_0047248 | 3300053086 | Bacteria | 2762 |
| 565 | Ga0500644_0146434 | 3300053088 | Unclassified | 943 |
| 566 | Ga0500644_0402556 | 3300053088 | Unclassified | 597 |
| 567 | Ga0500646_0007450 | 3300053090 | Bacteria | 2798 |
| 568 | Ga0500583_0000012 | 3300053092 | Bacteria | 154426 |
| 569 | Ga0500583_0002721 | 3300053092 | Bacteria | 5393 |
| 570 | Ga0500555_060840 | 3300053103 | Unclassified | 1016 |
| 571 | Ga0500556_0032665 | 3300053104 | Unclassified | 1780 |
| 572 | Ga0500569_289456 | 3300053109 | Bacteria | 552 |
| 573 | Ga0500594_0087378 | 3300053118 | Bacteria | 942 |
| 574 | Ga0500618_163139 | 3300053125 | Bacteria | 510 |
| 575 | Ga0500652_084026 | 3300053131 | Bacteria | 1327 |
| 576 | Ga0500658_0341292 | 3300053134 | Bacteria | 688 |
| 577 | Ga0500559_0239727 | 3300053136 | Bacteria | 855 |
| 578 | Ga0500561_0262185 | 3300053137 | Bacteria | 550 |
| 579 | Ga0500589_031996 | 3300053147 | Bacteria | 2452 |
| 580 | Ga0500603_084783 | 3300053150 | Bacteria | 923 |
| 581 | Ga0500616_0015278 | 3300053153 | Bacteria | 4394 |
| 582 | Ga0500616_0161055 | 3300053153 | Bacteria | 1029 |
| 583 | Ga0500616_0275983 | 3300053153 | Unclassified | 707 |
| 584 | Ga0500622_0026523 | 3300053156 | Bacteria | 3057 |
| 585 | Ga0500639_027948 | 3300053163 | Bacteria | 2981 |
| 586 | Ga0500637_0599881 | 3300053178 | Bacteria | 522 |
| 587 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 588 | Ga0500587_016627 | 3300053739 | Bacteria | 941 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041408 | Ga0439453_0046763 | Ga0439453_0046763_289_537 | 65 |
| 2 | 3300026095 | Ga0207676_10421707 | Ga0207676_104217073 | 70 |
| 3 | 3300005331 | Ga0070670_101197380 | Ga0070670_1011973802 | 71 |
| 4 | 3300017792 | Ga0163161_10652137 | Ga0163161_106521372 | 71 |
| 5 | 3300042435 | Ga0439434_0318531 | Ga0439434_0318531_283_510 | 75 |
| 6 | 3300046501 | Ga0495607_0101333 | Ga0495607_0101333_606_839 | 75 |
| 7 | 3300000041 | ARcpr5oldR_c019560 | ARcpr5oldR_0195602 | 76 |
| 8 | 3300000043 | ARcpr5yngRDRAFT_c013356 | ARcpr5yngRDRAFT_0133562 | 76 |
| 9 | 3300000044 | ARSoilOldRDRAFT_c023452 | ARSoilOldRDRAFT_0234522 | 76 |
| 10 | 3300001991 | JGI24743J22301_10083694 | JGI24743J22301_100836942 | 76 |
| 11 | 3300002077 | JGI24744J21845_10058120 | JGI24744J21845_100581202 | 76 |
| 12 | 3300002738 | JGI25154J39366_1016321 | JGI25154J39366_10163212 | 76 |
| 13 | 3300003320 | rootH2_10190875 | rootH2_101908752 | 76 |
| 14 | 3300003322 | rootL2_10171171 | rootL2_101711711 | 76 |
| 15 | 3300003323 | rootH1_10054153 | rootH1_100541535 | 76 |
| 16 | 3300005288 | Ga0065714_10198895 | Ga0065714_101988952 | 76 |
| 17 | 3300005289 | Ga0065704_10091501 | Ga0065704_100915013 | 76 |
| 18 | 3300005289 | Ga0065704_10602527 | Ga0065704_106025272 | 76 |
| 19 | 3300005290 | Ga0065712_10077592 | Ga0065712_100775925 | 76 |
| 20 | 3300005290 | Ga0065712_10134098 | Ga0065712_101340982 | 76 |
| 21 | 3300005290 | Ga0065712_10287453 | Ga0065712_102874531 | 76 |
| 22 | 3300005290 | Ga0065712_10293476 | Ga0065712_102934762 | 76 |
| 23 | 3300005293 | Ga0065715_10019353 | Ga0065715_100193533 | 76 |
| 24 | 3300005293 | Ga0065715_10273100 | Ga0065715_102731002 | 76 |
| 25 | 3300005293 | Ga0065715_10451627 | Ga0065715_104516272 | 76 |
| 26 | 3300005293 | Ga0065715_11170100 | Ga0065715_111701001 | 76 |
| 27 | 3300005295 | Ga0065707_10022333 | Ga0065707_100223332 | 76 |
| 28 | 3300005295 | Ga0065707_10165567 | Ga0065707_101655672 | 76 |
| 29 | 3300005295 | Ga0065707_10448943 | Ga0065707_104489432 | 76 |
| 30 | 3300005328 | Ga0070676_10014248 | Ga0070676_100142482 | 76 |
| 31 | 3300005329 | Ga0070683_100204187 | Ga0070683_1002041872 | 76 |
| 32 | 3300005330 | Ga0070690_100270516 | Ga0070690_1002705162 | 76 |
| 33 | 3300005331 | Ga0070670_100038715 | Ga0070670_1000387155 | 76 |
| 34 | 3300005331 | Ga0070670_100300457 | Ga0070670_1003004573 | 76 |
| 35 | 3300005331 | Ga0070670_100707651 | Ga0070670_1007076512 | 76 |
| 36 | 3300005333 | Ga0070677_10263826 | Ga0070677_102638261 | 76 |
| 37 | 3300005333 | Ga0070677_10313675 | Ga0070677_103136752 | 76 |
| 38 | 3300005334 | Ga0068869_100032681 | Ga0068869_1000326814 | 76 |
| 39 | 3300005334 | Ga0068869_100079604 | Ga0068869_1000796044 | 76 |
| 40 | 3300005334 | Ga0068869_101217139 | Ga0068869_1012171392 | 76 |
| 41 | 3300005334 | Ga0068869_101408855 | Ga0068869_1014088552 | 76 |
| 42 | 3300005335 | Ga0070666_10741832 | Ga0070666_107418322 | 76 |
| 43 | 3300005335 | Ga0070666_10826864 | Ga0070666_108268642 | 76 |
| 44 | 3300005337 | Ga0070682_101446636 | Ga0070682_1014466362 | 76 |
| 45 | 3300005338 | Ga0068868_100024597 | Ga0068868_1000245971 | 76 |
| 46 | 3300005338 | Ga0068868_100210932 | Ga0068868_1002109322 | 76 |
| 47 | 3300005338 | Ga0068868_100606692 | Ga0068868_1006066922 | 76 |
| 48 | 3300005338 | Ga0068868_101663998 | Ga0068868_1016639982 | 76 |
| 49 | 3300005340 | Ga0070689_100019130 | Ga0070689_1000191304 | 76 |
| 50 | 3300005340 | Ga0070689_100040492 | Ga0070689_1000404925 | 76 |
| 51 | 3300005340 | Ga0070689_100068440 | Ga0070689_1000684402 | 76 |
| 52 | 3300005343 | Ga0070687_100156614 | Ga0070687_1001566141 | 76 |
| 53 | 3300005343 | Ga0070687_100601345 | Ga0070687_1006013452 | 76 |
| 54 | 3300005344 | Ga0070661_101899658 | Ga0070661_1018996582 | 76 |
| 55 | 3300005347 | Ga0070668_100005828 | Ga0070668_1000058282 | 76 |
| 56 | 3300005347 | Ga0070668_100125658 | Ga0070668_1001256582 | 76 |
| 57 | 3300005353 | Ga0070669_100038346 | Ga0070669_1000383464 | 76 |
| 58 | 3300005353 | Ga0070669_100072872 | Ga0070669_1000728722 | 76 |
| 59 | 3300005353 | Ga0070669_100137279 | Ga0070669_1001372793 | 76 |
| 60 | 3300005353 | Ga0070669_101592448 | Ga0070669_1015924481 | 76 |
| 61 | 3300005353 | Ga0070669_101678048 | Ga0070669_1016780482 | 76 |
| 62 | 3300005354 | Ga0070675_100075014 | Ga0070675_1000750142 | 76 |
| 63 | 3300005354 | Ga0070675_100155160 | Ga0070675_1001551601 | 76 |
| 64 | 3300005354 | Ga0070675_100463979 | Ga0070675_1004639792 | 76 |
| 65 | 3300005354 | Ga0070675_100889776 | Ga0070675_1008897762 | 76 |
| 66 | 3300005354 | Ga0070675_101004958 | Ga0070675_1010049581 | 76 |
| 67 | 3300005355 | Ga0070671_100514063 | Ga0070671_1005140632 | 76 |
| 68 | 3300005356 | Ga0070674_100002262 | Ga0070674_1000022627 | 76 |
| 69 | 3300005356 | Ga0070674_100037295 | Ga0070674_1000372954 | 76 |
| 70 | 3300005364 | Ga0070673_100028166 | Ga0070673_1000281665 | 76 |
| 71 | 3300005364 | Ga0070673_100043512 | Ga0070673_1000435125 | 76 |
| 72 | 3300005364 | Ga0070673_100233601 | Ga0070673_1002336012 | 76 |
| 73 | 3300005364 | Ga0070673_100642412 | Ga0070673_1006424122 | 76 |
| 74 | 3300005364 | Ga0070673_101108604 | Ga0070673_1011086042 | 76 |
| 75 | 3300005364 | Ga0070673_101539764 | Ga0070673_1015397641 | 76 |
| 76 | 3300005364 | Ga0070673_101703307 | Ga0070673_1017033072 | 76 |
| 77 | 3300005364 | Ga0070673_102357824 | Ga0070673_1023578241 | 76 |
| 78 | 3300005365 | Ga0070688_100051239 | Ga0070688_1000512392 | 76 |
| 79 | 3300005365 | Ga0070688_100089746 | Ga0070688_1000897462 | 76 |
| 80 | 3300005365 | Ga0070688_100363963 | Ga0070688_1003639631 | 76 |
| 81 | 3300005365 | Ga0070688_100384287 | Ga0070688_1003842873 | 76 |
| 82 | 3300005365 | Ga0070688_100919032 | Ga0070688_1009190321 | 76 |
| 83 | 3300005365 | Ga0070688_101285714 | Ga0070688_1012857141 | 76 |
| 84 | 3300005367 | Ga0070667_100044780 | Ga0070667_1000447802 | 76 |
| 85 | 3300005367 | Ga0070667_100147215 | Ga0070667_1001472153 | 76 |
| 86 | 3300005367 | Ga0070667_100387567 | Ga0070667_1003875671 | 76 |
| 87 | 3300005367 | Ga0070667_101624042 | Ga0070667_1016240421 | 76 |
| 88 | 3300005367 | Ga0070667_101877193 | Ga0070667_1018771931 | 76 |
| 89 | 3300005440 | Ga0070705_100411366 | Ga0070705_1004113662 | 76 |
| 90 | 3300005441 | Ga0070700_101184056 | Ga0070700_1011840561 | 76 |
| 91 | 3300005441 | Ga0070700_101249204 | Ga0070700_1012492041 | 76 |
| 92 | 3300005441 | Ga0070700_101366520 | Ga0070700_1013665201 | 76 |
| 93 | 3300005441 | Ga0070700_101606815 | Ga0070700_1016068151 | 76 |
| 94 | 3300005444 | Ga0070694_101719674 | Ga0070694_1017196741 | 76 |
| 95 | 3300005455 | Ga0070663_102016675 | Ga0070663_1020166751 | 76 |
| 96 | 3300005456 | Ga0070678_100280384 | Ga0070678_1002803842 | 76 |
| 97 | 3300005457 | Ga0070662_100051494 | Ga0070662_1000514943 | 76 |
| 98 | 3300005459 | Ga0068867_100003798 | Ga0068867_1000037986 | 76 |
| 99 | 3300005459 | Ga0068867_100215252 | Ga0068867_1002152522 | 76 |
| 100 | 3300005459 | Ga0068867_100819270 | Ga0068867_1008192701 | 76 |
| 101 | 3300005459 | Ga0068867_101536767 | Ga0068867_1015367671 | 76 |
| 102 | 3300005459 | Ga0068867_101671655 | Ga0068867_1016716552 | 76 |
| 103 | 3300005459 | Ga0068867_102336363 | Ga0068867_1023363632 | 76 |
| 104 | 3300005466 | Ga0070685_10011303 | Ga0070685_100113036 | 76 |
| 105 | 3300005466 | Ga0070685_10168903 | Ga0070685_101689032 | 76 |
| 106 | 3300005466 | Ga0070685_10576485 | Ga0070685_105764852 | 76 |
| 107 | 3300005468 | Ga0070707_101170133 | Ga0070707_1011701332 | 76 |
| 108 | 3300005471 | Ga0070698_100068393 | Ga0070698_1000683935 | 76 |
| 109 | 3300005535 | Ga0070684_100044635 | Ga0070684_1000446354 | 76 |
| 110 | 3300005539 | Ga0068853_100052550 | Ga0068853_1000525502 | 76 |
| 111 | 3300005539 | Ga0068853_100079979 | Ga0068853_1000799792 | 76 |
| 112 | 3300005539 | Ga0068853_100618419 | Ga0068853_1006184192 | 76 |
| 113 | 3300005539 | Ga0068853_100914221 | Ga0068853_1009142211 | 76 |
| 114 | 3300005539 | Ga0068853_101250569 | Ga0068853_1012505692 | 76 |
| 115 | 3300005543 | Ga0070672_100041352 | Ga0070672_1000413524 | 76 |
| 116 | 3300005543 | Ga0070672_100597881 | Ga0070672_1005978812 | 76 |
| 117 | 3300005543 | Ga0070672_100776585 | Ga0070672_1007765852 | 76 |
| 118 | 3300005544 | Ga0070686_100794124 | Ga0070686_1007941241 | 76 |
| 119 | 3300005544 | Ga0070686_101469819 | Ga0070686_1014698192 | 76 |
| 120 | 3300005546 | Ga0070696_101286485 | Ga0070696_1012864852 | 76 |
| 121 | 3300005547 | Ga0070693_100152854 | Ga0070693_1001528542 | 76 |
| 122 | 3300005548 | Ga0070665_100016621 | Ga0070665_1000166212 | 76 |
| 123 | 3300005548 | Ga0070665_100057795 | Ga0070665_1000577955 | 76 |
| 124 | 3300005549 | Ga0070704_100188326 | Ga0070704_1001883263 | 76 |
| 125 | 3300005549 | Ga0070704_100276848 | Ga0070704_1002768481 | 76 |
| 126 | 3300005563 | Ga0068855_100306408 | Ga0068855_1003064082 | 76 |
| 127 | 3300005564 | Ga0070664_100073067 | Ga0070664_1000730673 | 76 |
| 128 | 3300005564 | Ga0070664_100723512 | Ga0070664_1007235122 | 76 |
| 129 | 3300005564 | Ga0070664_100823153 | Ga0070664_1008231531 | 76 |
| 130 | 3300005564 | Ga0070664_101356789 | Ga0070664_1013567892 | 76 |
| 131 | 3300005577 | Ga0068857_100509685 | Ga0068857_1005096852 | 76 |
| 132 | 3300005577 | Ga0068857_100577614 | Ga0068857_1005776142 | 76 |
| 133 | 3300005578 | Ga0068854_101027636 | Ga0068854_1010276361 | 76 |
| 134 | 3300005578 | Ga0068854_101029637 | Ga0068854_1010296372 | 76 |
| 135 | 3300005578 | Ga0068854_101404307 | Ga0068854_1014043072 | 76 |
| 136 | 3300005615 | Ga0070702_100677848 | Ga0070702_1006778482 | 76 |
| 137 | 3300005616 | Ga0068852_100282762 | Ga0068852_1002827622 | 76 |
| 138 | 3300005616 | Ga0068852_101755126 | Ga0068852_1017551262 | 76 |
| 139 | 3300005617 | Ga0068859_100004404 | Ga0068859_10000440410 | 76 |
| 140 | 3300005617 | Ga0068859_100038311 | Ga0068859_1000383112 | 76 |
| 141 | 3300005617 | Ga0068859_100114512 | Ga0068859_1001145123 | 76 |
| 142 | 3300005617 | Ga0068859_100214701 | Ga0068859_1002147014 | 76 |
| 143 | 3300005617 | Ga0068859_100218717 | Ga0068859_1002187171 | 76 |
| 144 | 3300005617 | Ga0068859_100239690 | Ga0068859_1002396903 | 76 |
| 145 | 3300005617 | Ga0068859_100304908 | Ga0068859_1003049082 | 76 |
| 146 | 3300005617 | Ga0068859_101294357 | Ga0068859_1012943572 | 76 |
| 147 | 3300005617 | Ga0068859_101415404 | Ga0068859_1014154042 | 76 |
| 148 | 3300005617 | Ga0068859_102101044 | Ga0068859_1021010442 | 76 |
| 149 | 3300005618 | Ga0068864_100023053 | Ga0068864_1000230538 | 76 |
| 150 | 3300005618 | Ga0068864_100524555 | Ga0068864_1005245553 | 76 |
| 151 | 3300005618 | Ga0068864_100525501 | Ga0068864_1005255012 | 76 |
| 152 | 3300005618 | Ga0068864_101201957 | Ga0068864_1012019572 | 76 |
| 153 | 3300005618 | Ga0068864_101353101 | Ga0068864_1013531012 | 76 |
| 154 | 3300005618 | Ga0068864_101711874 | Ga0068864_1017118741 | 76 |
| 155 | 3300005618 | Ga0068864_102330539 | Ga0068864_1023305392 | 76 |
| 156 | 3300005718 | Ga0068866_10053790 | Ga0068866_100537902 | 76 |
| 157 | 3300005718 | Ga0068866_11089471 | Ga0068866_110894711 | 76 |
| 158 | 3300005719 | Ga0068861_100191358 | Ga0068861_1001913581 | 76 |
| 159 | 3300005719 | Ga0068861_100330256 | Ga0068861_1003302562 | 76 |
| 160 | 3300005719 | Ga0068861_100487175 | Ga0068861_1004871752 | 76 |
| 161 | 3300005719 | Ga0068861_101143043 | Ga0068861_1011430432 | 76 |
| 162 | 3300005719 | Ga0068861_101373559 | Ga0068861_1013735592 | 76 |
| 163 | 3300005719 | Ga0068861_102421600 | Ga0068861_1024216002 | 76 |
| 164 | 3300005840 | Ga0068870_10039824 | Ga0068870_100398243 | 76 |
| 165 | 3300005840 | Ga0068870_10246999 | Ga0068870_102469993 | 76 |
| 166 | 3300005841 | Ga0068863_100395807 | Ga0068863_1003958072 | 76 |
| 167 | 3300005841 | Ga0068863_100597451 | Ga0068863_1005974512 | 76 |
| 168 | 3300005841 | Ga0068863_100747867 | Ga0068863_1007478672 | 76 |
| 169 | 3300005841 | Ga0068863_100766508 | Ga0068863_1007665082 | 76 |
| 170 | 3300005841 | Ga0068863_100815032 | Ga0068863_1008150322 | 76 |
| 171 | 3300005841 | Ga0068863_101031498 | Ga0068863_1010314982 | 76 |
| 172 | 3300005842 | Ga0068858_100127805 | Ga0068858_1001278053 | 76 |
| 173 | 3300005842 | Ga0068858_100129440 | Ga0068858_1001294402 | 76 |
| 174 | 3300005842 | Ga0068858_101660440 | Ga0068858_1016604402 | 76 |
| 175 | 3300005842 | Ga0068858_101986715 | Ga0068858_1019867151 | 76 |
| 176 | 3300005843 | Ga0068860_100066104 | Ga0068860_1000661042 | 76 |
| 177 | 3300005843 | Ga0068860_100092893 | Ga0068860_1000928933 | 76 |
| 178 | 3300005843 | Ga0068860_100144518 | Ga0068860_1001445183 | 76 |
| 179 | 3300005843 | Ga0068860_100289886 | Ga0068860_1002898861 | 76 |
| 180 | 3300005843 | Ga0068860_100348859 | Ga0068860_1003488592 | 76 |
| 181 | 3300005843 | Ga0068860_102161698 | Ga0068860_1021616982 | 76 |
| 182 | 3300005844 | Ga0068862_100050350 | Ga0068862_1000503505 | 76 |
| 183 | 3300005844 | Ga0068862_100739135 | Ga0068862_1007391352 | 76 |
| 184 | 3300005844 | Ga0068862_100939108 | Ga0068862_1009391082 | 76 |
| 185 | 3300005844 | Ga0068862_101031949 | Ga0068862_1010319492 | 76 |
| 186 | 3300005844 | Ga0068862_101912446 | Ga0068862_1019124462 | 76 |
| 187 | 3300006195 | Ga0075366_10013347 | Ga0075366_100133472 | 76 |
| 188 | 3300006195 | Ga0075366_10079110 | Ga0075366_100791103 | 76 |
| 189 | 3300006195 | Ga0075366_10090286 | Ga0075366_100902863 | 76 |
| 190 | 3300006195 | Ga0075366_10190269 | Ga0075366_101902693 | 76 |
| 191 | 3300006195 | Ga0075366_10234308 | Ga0075366_102343082 | 76 |
| 192 | 3300006237 | Ga0097621_100006252 | Ga0097621_1000062522 | 76 |
| 193 | 3300006237 | Ga0097621_100036651 | Ga0097621_1000366514 | 76 |
| 194 | 3300006237 | Ga0097621_100572893 | Ga0097621_1005728932 | 76 |
| 195 | 3300006237 | Ga0097621_100735477 | Ga0097621_1007354772 | 76 |
| 196 | 3300006237 | Ga0097621_102144460 | Ga0097621_1021444602 | 76 |
| 197 | 3300006237 | Ga0097621_102183760 | Ga0097621_1021837602 | 76 |
| 198 | 3300006358 | Ga0068871_100028294 | Ga0068871_1000282946 | 76 |
| 199 | 3300006358 | Ga0068871_100359833 | Ga0068871_1003598333 | 76 |
| 200 | 3300006358 | Ga0068871_100473591 | Ga0068871_1004735912 | 76 |
| 201 | 3300006358 | Ga0068871_101239007 | Ga0068871_1012390072 | 76 |
| 202 | 3300006358 | Ga0068871_101541575 | Ga0068871_1015415751 | 76 |
| 203 | 3300006844 | Ga0075428_100006620 | Ga0075428_1000066206 | 76 |
| 204 | 3300006844 | Ga0075428_100120899 | Ga0075428_1001208994 | 76 |
| 205 | 3300006844 | Ga0075428_102758584 | Ga0075428_1027585841 | 76 |
| 206 | 3300006846 | Ga0075430_100188341 | Ga0075430_1001883413 | 76 |
| 207 | 3300006846 | Ga0075430_100569402 | Ga0075430_1005694022 | 76 |
| 208 | 3300006847 | Ga0075431_100000866 | Ga0075431_1000008663 | 76 |
| 209 | 3300006847 | Ga0075431_100775352 | Ga0075431_1007753522 | 76 |
| 210 | 3300006847 | Ga0075431_101158091 | Ga0075431_1011580912 | 76 |
| 211 | 3300006871 | Ga0075434_102313250 | Ga0075434_1023132501 | 76 |
| 212 | 3300006880 | Ga0075429_100006687 | Ga0075429_1000066875 | 76 |
| 213 | 3300006880 | Ga0075429_100009709 | Ga0075429_1000097093 | 76 |
| 214 | 3300006880 | Ga0075429_100165515 | Ga0075429_1001655153 | 76 |
| 215 | 3300006881 | Ga0068865_100004271 | Ga0068865_1000042712 | 76 |
| 216 | 3300006881 | Ga0068865_100141827 | Ga0068865_1001418272 | 76 |
| 217 | 3300006881 | Ga0068865_101135540 | Ga0068865_1011355402 | 76 |
| 218 | 3300006881 | Ga0068865_101339377 | Ga0068865_1013393772 | 76 |
| 219 | 3300006931 | Ga0097620_100004404 | Ga0097620_10000440410 | 76 |
| 220 | 3300006931 | Ga0097620_100038312 | Ga0097620_1000383122 | 76 |
| 221 | 3300006931 | Ga0097620_100114503 | Ga0097620_1001145033 | 76 |
| 222 | 3300006931 | Ga0097620_100214718 | Ga0097620_1002147181 | 76 |
| 223 | 3300006931 | Ga0097620_100218737 | Ga0097620_1002187374 | 76 |
| 224 | 3300006931 | Ga0097620_100239699 | Ga0097620_1002396992 | 76 |
| 225 | 3300006931 | Ga0097620_100304931 | Ga0097620_1003049312 | 76 |
| 226 | 3300006931 | Ga0097620_101294580 | Ga0097620_1012945802 | 76 |
| 227 | 3300006931 | Ga0097620_101415290 | Ga0097620_1014152902 | 76 |
| 228 | 3300006931 | Ga0097620_102101023 | Ga0097620_1021010232 | 76 |
| 229 | 3300009093 | Ga0105240_10781773 | Ga0105240_107817733 | 76 |
| 230 | 3300009094 | Ga0111539_10095344 | Ga0111539_100953444 | 76 |
| 231 | 3300009094 | Ga0111539_10124969 | Ga0111539_101249695 | 76 |
| 232 | 3300009094 | Ga0111539_10246021 | Ga0111539_102460212 | 76 |
| 233 | 3300009094 | Ga0111539_10531161 | Ga0111539_105311612 | 76 |
| 234 | 3300009094 | Ga0111539_10742612 | Ga0111539_107426122 | 76 |
| 235 | 3300009094 | Ga0111539_13162744 | Ga0111539_131627442 | 76 |
| 236 | 3300009098 | Ga0105245_10567915 | Ga0105245_105679151 | 76 |
| 237 | 3300009098 | Ga0105245_13133618 | Ga0105245_131336182 | 76 |
| 238 | 3300009101 | Ga0105247_10007209 | Ga0105247_100072096 | 76 |
| 239 | 3300009101 | Ga0105247_10350512 | Ga0105247_103505122 | 76 |
| 240 | 3300009147 | Ga0114129_10001572 | Ga0114129_1000157211 | 76 |
| 241 | 3300009147 | Ga0114129_10003569 | Ga0114129_100035698 | 76 |
| 242 | 3300009147 | Ga0114129_10114463 | Ga0114129_101144631 | 76 |
| 243 | 3300009147 | Ga0114129_10259114 | Ga0114129_102591143 | 76 |
| 244 | 3300009147 | Ga0114129_10535051 | Ga0114129_105350513 | 76 |
| 245 | 3300009174 | Ga0105241_10070874 | Ga0105241_100708742 | 76 |
| 246 | 3300009174 | Ga0105241_10210813 | Ga0105241_102108133 | 76 |
| 247 | 3300009174 | Ga0105241_11227681 | Ga0105241_112276812 | 76 |
| 248 | 3300009174 | Ga0105241_11645805 | Ga0105241_116458052 | 76 |
| 249 | 3300009176 | Ga0105242_10025664 | Ga0105242_100256644 | 76 |
| 250 | 3300009176 | Ga0105242_10177261 | Ga0105242_101772612 | 76 |
| 251 | 3300009176 | Ga0105242_10250957 | Ga0105242_102509573 | 76 |
| 252 | 3300009176 | Ga0105242_10269261 | Ga0105242_102692612 | 76 |
| 253 | 3300009176 | Ga0105242_11648972 | Ga0105242_116489722 | 76 |
| 254 | 3300009176 | Ga0105242_12121081 | Ga0105242_121210812 | 76 |
| 255 | 3300009176 | Ga0105242_13037424 | Ga0105242_130374242 | 76 |
| 256 | 3300009177 | Ga0105248_10225161 | Ga0105248_102251613 | 76 |
| 257 | 3300009177 | Ga0105248_10834133 | Ga0105248_108341332 | 76 |
| 258 | 3300009177 | Ga0105248_11523997 | Ga0105248_115239972 | 76 |
| 259 | 3300009177 | Ga0105248_11999878 | Ga0105248_119998781 | 76 |
| 260 | 3300009545 | Ga0105237_10012365 | Ga0105237_100123654 | 76 |
| 261 | 3300009553 | Ga0105249_10015498 | Ga0105249_100154988 | 76 |
| 262 | 3300009553 | Ga0105249_10020990 | Ga0105249_100209904 | 76 |
| 263 | 3300009553 | Ga0105249_10055960 | Ga0105249_100559605 | 76 |
| 264 | 3300009553 | Ga0105249_10146222 | Ga0105249_101462222 | 76 |
| 265 | 3300009553 | Ga0105249_10154060 | Ga0105249_101540603 | 76 |
| 266 | 3300009553 | Ga0105249_11099725 | Ga0105249_110997252 | 76 |
| 267 | 3300009553 | Ga0105249_11331084 | Ga0105249_113310842 | 76 |
| 268 | 3300009553 | Ga0105249_11984712 | Ga0105249_119847122 | 76 |
| 269 | 3300010375 | Ga0105239_10006184 | Ga0105239_100061847 | 76 |
| 270 | 3300010375 | Ga0105239_11150146 | Ga0105239_111501461 | 76 |
| 271 | 3300010375 | Ga0105239_11543578 | Ga0105239_115435781 | 76 |
| 272 | 3300011119 | Ga0105246_10087749 | Ga0105246_100877492 | 76 |
| 273 | 3300011119 | Ga0105246_10118181 | Ga0105246_101181812 | 76 |
| 274 | 3300013100 | Ga0157373_11550886 | Ga0157373_115508862 | 76 |
| 275 | 3300013104 | Ga0157370_10270778 | Ga0157370_102707782 | 76 |
| 276 | 3300013104 | Ga0157370_10391965 | Ga0157370_103919652 | 76 |
| 277 | 3300013104 | Ga0157370_10795013 | Ga0157370_107950132 | 76 |
| 278 | 3300013296 | Ga0157374_10055794 | Ga0157374_100557943 | 76 |
| 279 | 3300013296 | Ga0157374_10117992 | Ga0157374_101179923 | 76 |
| 280 | 3300013296 | Ga0157374_11397124 | Ga0157374_113971242 | 76 |
| 281 | 3300013297 | Ga0157378_10661608 | Ga0157378_106616082 | 76 |
| 282 | 3300013297 | Ga0157378_10731467 | Ga0157378_107314672 | 76 |
| 283 | 3300013297 | Ga0157378_11525129 | Ga0157378_115251291 | 76 |
| 284 | 3300013306 | Ga0163162_10029655 | Ga0163162_100296552 | 76 |
| 285 | 3300013306 | Ga0163162_10088421 | Ga0163162_100884212 | 76 |
| 286 | 3300013306 | Ga0163162_10803864 | Ga0163162_108038643 | 76 |
| 287 | 3300013307 | Ga0157372_10991725 | Ga0157372_109917252 | 76 |
| 288 | 3300013307 | Ga0157372_11169548 | Ga0157372_111695482 | 76 |
| 289 | 3300013307 | Ga0157372_12595780 | Ga0157372_125957802 | 76 |
| 290 | 3300013307 | Ga0157372_12658660 | Ga0157372_126586601 | 76 |
| 291 | 3300013308 | Ga0157375_10072939 | Ga0157375_100729395 | 76 |
| 292 | 3300013308 | Ga0157375_10743772 | Ga0157375_107437722 | 76 |
| 293 | 3300013308 | Ga0157375_12604388 | Ga0157375_126043881 | 76 |
| 294 | 3300013308 | Ga0157375_12631231 | Ga0157375_126312312 | 76 |
| 295 | 3300014325 | Ga0163163_10057069 | Ga0163163_100570692 | 76 |
| 296 | 3300014325 | Ga0163163_10112665 | Ga0163163_101126653 | 76 |
| 297 | 3300014325 | Ga0163163_10549203 | Ga0163163_105492032 | 76 |
| 298 | 3300014325 | Ga0163163_10564483 | Ga0163163_105644831 | 76 |
| 299 | 3300014326 | Ga0157380_10024955 | Ga0157380_100249553 | 76 |
| 300 | 3300014326 | Ga0157380_10029842 | Ga0157380_100298423 | 76 |
| 301 | 3300014326 | Ga0157380_10215075 | Ga0157380_102150752 | 76 |
| 302 | 3300014326 | Ga0157380_10356885 | Ga0157380_103568852 | 76 |
| 303 | 3300014326 | Ga0157380_10390375 | Ga0157380_103903752 | 76 |
| 304 | 3300014326 | Ga0157380_10458256 | Ga0157380_104582562 | 76 |
| 305 | 3300014326 | Ga0157380_10730576 | Ga0157380_107305762 | 76 |
| 306 | 3300014326 | Ga0157380_10812123 | Ga0157380_108121232 | 76 |
| 307 | 3300014326 | Ga0157380_11568759 | Ga0157380_115687592 | 76 |
| 308 | 3300014326 | Ga0157380_13203270 | Ga0157380_132032701 | 76 |
| 309 | 3300014745 | Ga0157377_10089403 | Ga0157377_100894032 | 76 |
| 310 | 3300014745 | Ga0157377_10230051 | Ga0157377_102300513 | 76 |
| 311 | 3300014745 | Ga0157377_10342956 | Ga0157377_103429562 | 76 |
| 312 | 3300014968 | Ga0157379_10155294 | Ga0157379_101552943 | 76 |
| 313 | 3300014968 | Ga0157379_10228373 | Ga0157379_102283732 | 76 |
| 314 | 3300014968 | Ga0157379_11601596 | Ga0157379_116015962 | 76 |
| 315 | 3300014968 | Ga0157379_12042297 | Ga0157379_120422972 | 76 |
| 316 | 3300014969 | Ga0157376_10263681 | Ga0157376_102636812 | 76 |
| 317 | 3300014969 | Ga0157376_10266247 | Ga0157376_102662472 | 76 |
| 318 | 3300014969 | Ga0157376_10546771 | Ga0157376_105467713 | 76 |
| 319 | 3300014969 | Ga0157376_10601837 | Ga0157376_106018371 | 76 |
| 320 | 3300014969 | Ga0157376_12519585 | Ga0157376_125195851 | 76 |
| 321 | 3300017792 | Ga0163161_10000890 | Ga0163161_1000089016 | 76 |
| 322 | 3300017792 | Ga0163161_10273208 | Ga0163161_102732083 | 76 |
| 323 | 3300017792 | Ga0163161_10431474 | Ga0163161_104314742 | 76 |
| 324 | 3300017792 | Ga0163161_10750855 | Ga0163161_107508551 | 76 |
| 325 | 3300017792 | Ga0163161_11355543 | Ga0163161_113555432 | 76 |
| 326 | 3300017792 | Ga0163161_11389554 | Ga0163161_113895542 | 76 |
| 327 | 3300025246 | Ga0209646_1005623 | Ga0209646_10056233 | 76 |
| 328 | 3300025315 | Ga0207697_10162640 | Ga0207697_101626401 | 76 |
| 329 | 3300025315 | Ga0207697_10190333 | Ga0207697_101903332 | 76 |
| 330 | 3300025321 | Ga0207656_10026103 | Ga0207656_100261033 | 76 |
| 331 | 3300025899 | Ga0207642_10027412 | Ga0207642_100274124 | 76 |
| 332 | 3300025900 | Ga0207710_10000852 | Ga0207710_1000085212 | 76 |
| 333 | 3300025901 | Ga0207688_10013484 | Ga0207688_100134843 | 76 |
| 334 | 3300025903 | Ga0207680_10029382 | Ga0207680_100293822 | 76 |
| 335 | 3300025907 | Ga0207645_10001934 | Ga0207645_1000193414 | 76 |
| 336 | 3300025907 | Ga0207645_10096614 | Ga0207645_100966142 | 76 |
| 337 | 3300025908 | Ga0207643_10005138 | Ga0207643_100051386 | 76 |
| 338 | 3300025908 | Ga0207643_10030001 | Ga0207643_100300013 | 76 |
| 339 | 3300025911 | Ga0207654_11030141 | Ga0207654_110301411 | 76 |
| 340 | 3300025911 | Ga0207654_11149054 | Ga0207654_111490542 | 76 |
| 341 | 3300025913 | Ga0207695_10634553 | Ga0207695_106345531 | 76 |
| 342 | 3300025918 | Ga0207662_10021709 | Ga0207662_100217093 | 76 |
| 343 | 3300025922 | Ga0207646_10204874 | Ga0207646_102048745 | 76 |
| 344 | 3300025922 | Ga0207646_11410182 | Ga0207646_114101821 | 76 |
| 345 | 3300025923 | Ga0207681_10020255 | Ga0207681_100202552 | 76 |
| 346 | 3300025923 | Ga0207681_10138611 | Ga0207681_101386113 | 76 |
| 347 | 3300025923 | Ga0207681_11622583 | Ga0207681_116225832 | 76 |
| 348 | 3300025923 | Ga0207681_11800925 | Ga0207681_118009252 | 76 |
| 349 | 3300025925 | Ga0207650_10057288 | Ga0207650_100572884 | 76 |
| 350 | 3300025925 | Ga0207650_10911328 | Ga0207650_109113282 | 76 |
| 351 | 3300025926 | Ga0207659_10028420 | Ga0207659_100284202 | 76 |
| 352 | 3300025926 | Ga0207659_10050201 | Ga0207659_100502012 | 76 |
| 353 | 3300025926 | Ga0207659_10136972 | Ga0207659_101369723 | 76 |
| 354 | 3300025926 | Ga0207659_10730629 | Ga0207659_107306292 | 76 |
| 355 | 3300025926 | Ga0207659_11408963 | Ga0207659_114089631 | 76 |
| 356 | 3300025931 | Ga0207644_10427397 | Ga0207644_104273972 | 76 |
| 357 | 3300025931 | Ga0207644_10690339 | Ga0207644_106903392 | 76 |
| 358 | 3300025931 | Ga0207644_11707347 | Ga0207644_117073471 | 76 |
| 359 | 3300025933 | Ga0207706_10027723 | Ga0207706_100277234 | 76 |
| 360 | 3300025933 | Ga0207706_11411285 | Ga0207706_114112852 | 76 |
| 361 | 3300025934 | Ga0207686_10138188 | Ga0207686_101381882 | 76 |
| 362 | 3300025934 | Ga0207686_10170855 | Ga0207686_101708552 | 76 |
| 363 | 3300025934 | Ga0207686_10262791 | Ga0207686_102627912 | 76 |
| 364 | 3300025934 | Ga0207686_10600542 | Ga0207686_106005422 | 76 |
| 365 | 3300025934 | Ga0207686_10816629 | Ga0207686_108166292 | 76 |
| 366 | 3300025936 | Ga0207670_10062831 | Ga0207670_100628315 | 76 |
| 367 | 3300025936 | Ga0207670_10110623 | Ga0207670_101106232 | 76 |
| 368 | 3300025936 | Ga0207670_10233537 | Ga0207670_102335372 | 76 |
| 369 | 3300025937 | Ga0207669_10684285 | Ga0207669_106842852 | 76 |
| 370 | 3300025937 | Ga0207669_10755534 | Ga0207669_107555342 | 76 |
| 371 | 3300025938 | Ga0207704_10020737 | Ga0207704_100207374 | 76 |
| 372 | 3300025938 | Ga0207704_10238726 | Ga0207704_102387262 | 76 |
| 373 | 3300025938 | Ga0207704_10489295 | Ga0207704_104892952 | 76 |
| 374 | 3300025938 | Ga0207704_11190977 | Ga0207704_111909772 | 76 |
| 375 | 3300025940 | Ga0207691_10201402 | Ga0207691_102014023 | 76 |
| 376 | 3300025940 | Ga0207691_10595724 | Ga0207691_105957242 | 76 |
| 377 | 3300025940 | Ga0207691_10903708 | Ga0207691_109037081 | 76 |
| 378 | 3300025940 | Ga0207691_11139245 | Ga0207691_111392452 | 76 |
| 379 | 3300025941 | Ga0207711_10515604 | Ga0207711_105156042 | 76 |
| 380 | 3300025942 | Ga0207689_10015791 | Ga0207689_100157914 | 76 |
| 381 | 3300025942 | Ga0207689_10067860 | Ga0207689_100678603 | 76 |
| 382 | 3300025942 | Ga0207689_10104803 | Ga0207689_101048034 | 76 |
| 383 | 3300025942 | Ga0207689_10215348 | Ga0207689_102153483 | 76 |
| 384 | 3300025944 | Ga0207661_10988072 | Ga0207661_109880722 | 76 |
| 385 | 3300025945 | Ga0207679_10257658 | Ga0207679_102576582 | 76 |
| 386 | 3300025945 | Ga0207679_11399723 | Ga0207679_113997232 | 76 |
| 387 | 3300025949 | Ga0207667_10183389 | Ga0207667_101833893 | 76 |
| 388 | 3300025960 | Ga0207651_10031755 | Ga0207651_100317554 | 76 |
| 389 | 3300025960 | Ga0207651_10044105 | Ga0207651_100441052 | 76 |
| 390 | 3300025960 | Ga0207651_12036760 | Ga0207651_120367602 | 76 |
| 391 | 3300025961 | Ga0207712_10026024 | Ga0207712_100260244 | 76 |
| 392 | 3300025961 | Ga0207712_10042119 | Ga0207712_100421192 | 76 |
| 393 | 3300025961 | Ga0207712_10144811 | Ga0207712_101448112 | 76 |
| 394 | 3300025961 | Ga0207712_10171962 | Ga0207712_101719622 | 76 |
| 395 | 3300025961 | Ga0207712_10551407 | Ga0207712_105514072 | 76 |
| 396 | 3300025961 | Ga0207712_10713789 | Ga0207712_107137891 | 76 |
| 397 | 3300025961 | Ga0207712_11461293 | Ga0207712_114612932 | 76 |
| 398 | 3300025972 | Ga0207668_10098877 | Ga0207668_100988772 | 76 |
| 399 | 3300025972 | Ga0207668_10265856 | Ga0207668_102658561 | 76 |
| 400 | 3300025972 | Ga0207668_10276264 | Ga0207668_102762641 | 76 |
| 401 | 3300025972 | Ga0207668_10952283 | Ga0207668_109522832 | 76 |
| 402 | 3300025981 | Ga0207640_10153003 | Ga0207640_101530032 | 76 |
| 403 | 3300025981 | Ga0207640_10591306 | Ga0207640_105913061 | 76 |
| 404 | 3300025981 | Ga0207640_11644422 | Ga0207640_116444222 | 76 |
| 405 | 3300025986 | Ga0207658_10046164 | Ga0207658_100461644 | 76 |
| 406 | 3300025986 | Ga0207658_10109364 | Ga0207658_101093642 | 76 |
| 407 | 3300025986 | Ga0207658_10158804 | Ga0207658_101588041 | 76 |
| 408 | 3300025986 | Ga0207658_10509640 | Ga0207658_105096402 | 76 |
| 409 | 3300026023 | Ga0207677_10355045 | Ga0207677_103550452 | 76 |
| 410 | 3300026023 | Ga0207677_10460297 | Ga0207677_104602972 | 76 |
| 411 | 3300026023 | Ga0207677_10505142 | Ga0207677_105051422 | 76 |
| 412 | 3300026035 | Ga0207703_10938205 | Ga0207703_109382051 | 76 |
| 413 | 3300026041 | Ga0207639_10201451 | Ga0207639_102014512 | 76 |
| 414 | 3300026041 | Ga0207639_10213057 | Ga0207639_102130572 | 76 |
| 415 | 3300026041 | Ga0207639_11851134 | Ga0207639_118511341 | 76 |
| 416 | 3300026067 | Ga0207678_10696207 | Ga0207678_106962071 | 76 |
| 417 | 3300026075 | Ga0207708_10345876 | Ga0207708_103458761 | 76 |
| 418 | 3300026078 | Ga0207702_10196986 | Ga0207702_101969862 | 76 |
| 419 | 3300026088 | Ga0207641_10000380 | Ga0207641_100003809 | 76 |
| 420 | 3300026088 | Ga0207641_10210850 | Ga0207641_102108502 | 76 |
| 421 | 3300026088 | Ga0207641_10507230 | Ga0207641_105072302 | 76 |
| 422 | 3300026088 | Ga0207641_10509003 | Ga0207641_105090032 | 76 |
| 423 | 3300026088 | Ga0207641_11047549 | Ga0207641_110475492 | 76 |
| 424 | 3300026088 | Ga0207641_11852119 | Ga0207641_118521191 | 76 |
| 425 | 3300026089 | Ga0207648_10003538 | Ga0207648_100035389 | 76 |
| 426 | 3300026089 | Ga0207648_10110130 | Ga0207648_101101302 | 76 |
| 427 | 3300026089 | Ga0207648_10361881 | Ga0207648_103618812 | 76 |
| 428 | 3300026089 | Ga0207648_11648571 | Ga0207648_116485711 | 76 |
| 429 | 3300026095 | Ga0207676_10018751 | Ga0207676_100187511 | 76 |
| 430 | 3300026095 | Ga0207676_10068244 | Ga0207676_100682443 | 76 |
| 431 | 3300026095 | Ga0207676_10133718 | Ga0207676_101337183 | 76 |
| 432 | 3300026095 | Ga0207676_10774923 | Ga0207676_107749231 | 76 |
| 433 | 3300026095 | Ga0207676_12445771 | Ga0207676_124457711 | 76 |
| 434 | 3300026116 | Ga0207674_10233105 | Ga0207674_102331052 | 76 |
| 435 | 3300026118 | Ga0207675_100184283 | Ga0207675_1001842832 | 76 |
| 436 | 3300026118 | Ga0207675_100748762 | Ga0207675_1007487622 | 76 |
| 437 | 3300026118 | Ga0207675_101063907 | Ga0207675_1010639072 | 76 |
| 438 | 3300026118 | Ga0207675_101354720 | Ga0207675_1013547202 | 76 |
| 439 | 3300026118 | Ga0207675_101615391 | Ga0207675_1016153912 | 76 |
| 440 | 3300026118 | Ga0207675_101817623 | Ga0207675_1018176231 | 76 |
| 441 | 3300026121 | Ga0207683_10000691 | Ga0207683_1000069124 | 76 |
| 442 | 3300026121 | Ga0207683_10049417 | Ga0207683_100494175 | 76 |
| 443 | 3300026142 | Ga0207698_10375963 | Ga0207698_103759632 | 76 |
| 444 | 3300026142 | Ga0207698_10477512 | Ga0207698_104775122 | 76 |
| 445 | 3300026142 | Ga0207698_10977676 | Ga0207698_109776762 | 76 |
| 446 | 3300026142 | Ga0207698_11181630 | Ga0207698_111816302 | 76 |
| 447 | 3300026142 | Ga0207698_11367266 | Ga0207698_113672662 | 76 |
| 448 | 3300027395 | Ga0209996_1037412 | Ga0209996_10374122 | 76 |
| 449 | 3300027907 | Ga0207428_10575838 | Ga0207428_105758382 | 76 |
| 450 | 3300027907 | Ga0207428_10900508 | Ga0207428_109005082 | 76 |
| 451 | 3300028379 | Ga0268266_10011708 | Ga0268266_100117083 | 76 |
| 452 | 3300028379 | Ga0268266_10064584 | Ga0268266_100645843 | 76 |
| 453 | 3300028380 | Ga0268265_10301992 | Ga0268265_103019922 | 76 |
| 454 | 3300028380 | Ga0268265_11554151 | Ga0268265_115541512 | 76 |
| 455 | 3300028380 | Ga0268265_12177172 | Ga0268265_121771721 | 76 |
| 456 | 3300028380 | Ga0268265_12364993 | Ga0268265_123649932 | 76 |
| 457 | 3300028381 | Ga0268264_10044674 | Ga0268264_100446742 | 76 |
| 458 | 3300028381 | Ga0268264_10122469 | Ga0268264_101224692 | 76 |
| 459 | 3300028381 | Ga0268264_10171452 | Ga0268264_101714523 | 76 |
| 460 | 3300028381 | Ga0268264_11981028 | Ga0268264_119810282 | 76 |
| 461 | 3300030522 | Ga0307512_10340977 | Ga0307512_103409771 | 76 |
| 462 | 3300030522 | Ga0307512_10427024 | Ga0307512_104270242 | 76 |
| 463 | 3300031251 | Ga0265327_10007307 | Ga0265327_100073078 | 76 |
| 464 | 3300031251 | Ga0265327_10173025 | Ga0265327_101730252 | 76 |
| 465 | 3300031456 | Ga0307513_10210849 | Ga0307513_102108492 | 76 |
| 466 | 3300031456 | Ga0307513_10859008 | Ga0307513_108590081 | 76 |
| 467 | 3300031456 | Ga0307513_10918808 | Ga0307513_109188081 | 76 |
| 468 | 3300031507 | Ga0307509_10107276 | Ga0307509_101072764 | 76 |
| 469 | 3300031730 | Ga0307516_10501757 | Ga0307516_105017571 | 76 |
| 470 | 3300032002 | Ga0307416_103479472 | Ga0307416_1034794722 | 76 |
| 471 | 3300032004 | Ga0307414_10034778 | Ga0307414_100347784 | 76 |
| 472 | 3300035170 | Ga0373943_0726622 | Ga0373943_0726622_68_298 | 76 |
| 473 | 3300035171 | Ga0373946_0372405 | Ga0373946_0372405_418_648 | 76 |
| 474 | 3300035691 | Ga0373931_1280048 | Ga0373931_1280048_34_267 | 76 |
| 475 | 3300035695 | Ga0373927_0721733 | Ga0373927_0721733_357_590 | 76 |
| 476 | 3300036401 | Ga0373937_0585538 | Ga0373937_0585538_779_1009 | 76 |
| 477 | 3300041404 | Ga0439436_0012382 | Ga0439436_0012382_2243_2476 | 76 |
| 478 | 3300041456 | Ga0451795_0056838 | Ga0451795_0056838_205_438 | 76 |
| 479 | 3300041459 | Ga0451800_0429729 | Ga0451800_0429729_76_309 | 76 |
| 480 | 3300041460 | Ga0451802_0622033 | Ga0451802_0622033_167_400 | 76 |
| 481 | 3300041460 | Ga0451802_1058775 | Ga0451802_1058775_245_478 | 76 |
| 482 | 3300041463 | Ga0451804_0981626 | Ga0451804_0981626_210_443 | 76 |
| 483 | 3300041486 | Ga0451807_2307153 | Ga0451807_2307153_272_505 | 76 |
| 484 | 3300041498 | Ga0451841_0886561 | Ga0451841_0886561_750_983 | 76 |
| 485 | 3300041512 | Ga0451853_0925210 | Ga0451853_0925210_180_413 | 76 |
| 486 | 3300041512 | Ga0451853_1010871 | Ga0451853_1010871_104_337 | 76 |
| 487 | 3300041512 | Ga0451853_3208196 | Ga0451853_3208196_207_440 | 76 |
| 488 | 3300041512 | Ga0451853_3668395 | Ga0451853_3668395_894_1127 | 76 |
| 489 | 3300041512 | Ga0451853_4052459 | Ga0451853_4052459_67_300 | 76 |
| 490 | 3300042007 | Ga0439449_0014815 | Ga0439449_0014815_1639_1872 | 76 |
| 491 | 3300042014 | Ga0439457_000827 | Ga0439457_000827_8152_8385 | 76 |
| 492 | 3300042015 | Ga0439462_0052773 | Ga0439462_0052773_226_459 | 76 |
| 493 | 3300042124 | Ga0450922_038939 | Ga0450922_038939_234_467 | 76 |
| 494 | 3300042134 | Ga0450898_052481 | Ga0450898_052481_222_455 | 76 |
| 495 | 3300042436 | Ga0439435_0174463 | Ga0439435_0174463_42_272 | 76 |
| 496 | 3300042876 | Ga0451577_0605583 | Ga0451577_0605583_163_396 | 76 |
| 497 | 3300044656 | Ga0466969_0000103 | Ga0466969_0000103_32512_32745 | 76 |
| 498 | 3300044658 | Ga0466972_0000012 | Ga0466972_0000012_183116_183349 | 76 |
| 499 | 3300044658 | Ga0466972_0110891 | Ga0466972_0110891_671_904 | 76 |
| 500 | 3300044683 | Ga0466965_0272273 | Ga0466965_0272273_224_457 | 76 |
| 501 | 3300044683 | Ga0466965_0695624 | Ga0466965_0695624_118_351 | 76 |
| 502 | 3300044684 | Ga0466966_0000097 | Ga0466966_0000097_29648_29881 | 76 |
| 503 | 3300044712 | Ga0453684_0183994 | Ga0453684_0183994_1559_1792 | 76 |
| 504 | 3300044735 | Ga0466968_0230113 | Ga0466968_0230113_622_855 | 76 |
| 505 | 3300044765 | Ga0466970_0740258 | Ga0466970_0740258_76_309 | 76 |
| 506 | 3300044842 | Ga0466957_0009079 | Ga0466957_0009079_897_1130 | 76 |
| 507 | 3300044842 | Ga0466957_0014317 | Ga0466957_0014317_3340_3573 | 76 |
| 508 | 3300045049 | Ga0466959_0000049 | Ga0466959_0000049_2408_2641 | 76 |
| 509 | 3300046460 | Ga0495638_0069041 | Ga0495638_0069041_1489_1722 | 76 |
| 510 | 3300046501 | Ga0495607_0115363 | Ga0495607_0115363_267_500 | 76 |
| 511 | 3300046519 | Ga0495632_0122710 | Ga0495632_0122710_438_671 | 76 |
| 512 | 3300046519 | Ga0495632_0489216 | Ga0495632_0489216_30_263 | 76 |
| 513 | 3300046522 | Ga0495643_0063325 | Ga0495643_0063325_621_854 | 76 |
| 514 | 3300046530 | Ga0495654_0239044 | Ga0495654_0239044_227_457 | 76 |
| 515 | 3300046537 | Ga0495598_0189939 | Ga0495598_0189939_362_592 | 76 |
| 516 | 3300046539 | Ga0495621_0028583 | Ga0495621_0028583_484_714 | 76 |
| 517 | 3300046539 | Ga0495621_0116299 | Ga0495621_0116299_289_519 | 76 |
| 518 | 3300046616 | Ga0495668_0000489 | Ga0495668_0000489_15498_15731 | 76 |
| 519 | 3300046691 | Ga0495670_0053912 | Ga0495670_0053912_755_985 | 76 |
| 520 | 3300047472 | Ga0495686_0061584 | Ga0495686_0061584_2041_2271 | 76 |
| 521 | 3300047472 | Ga0495686_0188332 | Ga0495686_0188332_298_531 | 76 |
| 522 | 3300048914 | Ga0496111_0931224 | Ga0496111_0931224_295_525 | 76 |
| 523 | 3300048929 | Ga0496126_0795040 | Ga0496126_0795040_158_391 | 76 |
| 524 | 3300049568 | Ga0501031_0400454 | Ga0501031_0400454_463_696 | 76 |
| 525 | 3300049570 | Ga0501033_0175488 | Ga0501033_0175488_1253_1486 | 76 |
| 526 | 3300049571 | Ga0501034_0637895 | Ga0501034_0637895_155_385 | 76 |
| 527 | 3300049571 | Ga0501034_1273796 | Ga0501034_1273796_331_564 | 76 |
| 528 | 3300049571 | Ga0501034_1363491 | Ga0501034_1363491_329_562 | 76 |
| 529 | 3300049572 | Ga0501036_1634316 | Ga0501036_1634316_95_328 | 76 |
| 530 | 3300049579 | Ga0501043_0344141 | Ga0501043_0344141_576_809 | 76 |
| 531 | 3300049581 | Ga0501047_0004068 | Ga0501047_0004068_6235_6468 | 76 |
| 532 | 3300049581 | Ga0501047_0121669 | Ga0501047_0121669_1165_1398 | 76 |
| 533 | 3300049581 | Ga0501047_0484911 | Ga0501047_0484911_701_934 | 76 |
| 534 | 3300049668 | Ga0501233_054208 | Ga0501233_054208_558_797 | 76 |
| 535 | 3300049686 | Ga0501257_018663 | Ga0501257_018663_67_300 | 76 |
| 536 | 3300049686 | Ga0501257_180274 | Ga0501257_180274_14_247 | 76 |
| 537 | 3300049705 | Ga0501225_0002922 | Ga0501225_0002922_2244_2477 | 76 |
| 538 | 3300049708 | Ga0501245_146200 | Ga0501245_146200_11_250 | 76 |
| 539 | 3300049758 | Ga0501241_126903 | Ga0501241_126903_244_477 | 76 |
| 540 | 3300049822 | Ga0501035_0239732 | Ga0501035_0239732_550_783 | 76 |
| 541 | 3300049823 | Ga0501044_0033123 | Ga0501044_0033123_4290_4523 | 76 |
| 542 | 3300049823 | Ga0501044_0963495 | Ga0501044_0963495_402_635 | 76 |
| 543 | 3300050493 | nmdc:mga0k408_206436_c1 | nmdc:mga0k408_206436_c1_25_258 | 76 |
| 544 | 3300050493 | nmdc:mga0k408_265875_c1 | nmdc:mga0k408_265875_c1_135_365 | 76 |
| 545 | 3300050493 | nmdc:mga0k408_32475_c1 | nmdc:mga0k408_32475_c1_855_1088 | 76 |
| 546 | 3300050493 | nmdc:mga0k408_34935_c1 | nmdc:mga0k408_34935_c1_421_654 | 76 |
| 547 | 3300050493 | nmdc:mga0k408_4631_c1 | nmdc:mga0k408_4631_c1_1176_1406 | 76 |
| 548 | 3300050493 | nmdc:mga0k408_480179_c1 | nmdc:mga0k408_480179_c1_59_292 | 76 |
| 549 | 3300050507 | nmdc:mga05p37_1276461_c1 | nmdc:mga05p37_1276461_c1_350_583 | 76 |
| 550 | 3300050507 | nmdc:mga05p37_20024_c2 | nmdc:mga05p37_20024_c2_4856_5089 | 76 |
| 551 | 3300050507 | nmdc:mga05p37_905856_c1 | nmdc:mga05p37_905856_c1_348_578 | 76 |
| 552 | 3300050508 | nmdc:mga09592_1122906_c1 | nmdc:mga09592_1122906_c1_304_534 | 76 |
| 553 | 3300050508 | nmdc:mga09592_153430_c1 | nmdc:mga09592_153430_c1_1688_1918 | 76 |
| 554 | 3300050508 | nmdc:mga09592_38049_c1 | nmdc:mga09592_38049_c1_3579_3812 | 76 |
| 555 | 3300050509 | nmdc:mga0qj67_143585_c1 | nmdc:mga0qj67_143585_c1_1309_1590 | 76 |
| 556 | 3300050509 | nmdc:mga0qj67_512782_c1 | nmdc:mga0qj67_512782_c1_251_484 | 76 |
| 557 | 3300050510 | nmdc:mga06r32_758920_c1 | nmdc:mga06r32_758920_c1_324_605 | 76 |
| 558 | 3300050510 | nmdc:mga06r32_9671_c1 | nmdc:mga06r32_9671_c1_6028_6261 | 76 |
| 559 | 3300050511 | nmdc:mga08y16_1061793_c1 | nmdc:mga08y16_1061793_c1_452_682 | 76 |
| 560 | 3300050511 | nmdc:mga08y16_123242_c1 | nmdc:mga08y16_123242_c1_2440_2670 | 76 |
| 561 | 3300050511 | nmdc:mga08y16_1466422_c1 | nmdc:mga08y16_1466422_c1_133_369 | 76 |
| 562 | 3300050511 | nmdc:mga08y16_55351_c1 | nmdc:mga08y16_55351_c1_298_528 | 76 |
| 563 | 3300053086 | Ga0500578_0000934 | Ga0500578_0000934_3940_4173 | 76 |
| 564 | 3300053086 | Ga0500578_0047248 | Ga0500578_0047248_324_557 | 76 |
| 565 | 3300053088 | Ga0500644_0146434 | Ga0500644_0146434_27_260 | 76 |
| 566 | 3300053088 | Ga0500644_0402556 | Ga0500644_0402556_225_458 | 76 |
| 567 | 3300053090 | Ga0500646_0007450 | Ga0500646_0007450_2060_2293 | 76 |
| 568 | 3300053092 | Ga0500583_0000012 | Ga0500583_0000012_123926_124159 | 76 |
| 569 | 3300053092 | Ga0500583_0002721 | Ga0500583_0002721_618_851 | 76 |
| 570 | 3300053103 | Ga0500555_060840 | Ga0500555_060840_483_716 | 76 |
| 571 | 3300053104 | Ga0500556_0032665 | Ga0500556_0032665_1421_1654 | 76 |
| 572 | 3300053109 | Ga0500569_289456 | Ga0500569_289456_144_377 | 76 |
| 573 | 3300053118 | Ga0500594_0087378 | Ga0500594_0087378_641_874 | 76 |
| 574 | 3300053125 | Ga0500618_163139 | Ga0500618_163139_133_366 | 76 |
| 575 | 3300053131 | Ga0500652_084026 | Ga0500652_084026_310_543 | 76 |
| 576 | 3300053134 | Ga0500658_0341292 | Ga0500658_0341292_85_318 | 76 |
| 577 | 3300053136 | Ga0500559_0239727 | Ga0500559_0239727_234_467 | 76 |
| 578 | 3300053137 | Ga0500561_0262185 | Ga0500561_0262185_200_433 | 76 |
| 579 | 3300053147 | Ga0500589_031996 | Ga0500589_031996_1368_1601 | 76 |
| 580 | 3300053150 | Ga0500603_084783 | Ga0500603_084783_654_887 | 76 |
| 581 | 3300053153 | Ga0500616_0015278 | Ga0500616_0015278_3439_3672 | 76 |
| 582 | 3300053153 | Ga0500616_0161055 | Ga0500616_0161055_524_757 | 76 |
| 583 | 3300053153 | Ga0500616_0275983 | Ga0500616_0275983_232_465 | 76 |
| 584 | 3300053156 | Ga0500622_0026523 | Ga0500622_0026523_86_319 | 76 |
| 585 | 3300053163 | Ga0500639_027948 | Ga0500639_027948_1383_1616 | 76 |
| 586 | 3300053178 | Ga0500637_0599881 | Ga0500637_0599881_182_415 | 76 |
| 587 | 3300053727 | Ga0500611_000002 | Ga0500611_000002_49608_49841 | 76 |
| 588 | 3300053739 | Ga0500587_016627 | Ga0500587_016627_529_819 | 76 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vjk-assembly1.cif.gz_A | putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 | 0.8899 | 1 | 72 |
| 5djo-assembly1.cif.gz_A | crystal structure of the cc1-fha tandem of kinesin-3 kif13a | 0.8852 | 46 | 70 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8662 | 1 | 76 |
| 2qie-assembly1.cif.gz_D | staphylococcus aureus molybdopterin synthase in complex with precursor z | 0.8651 | 3 | 76 |
| 2g1l-assembly1.cif.gz_A | crystal structure of the fha domain of human kinesin family member c | 0.8649 | 46 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8948 | 3 | 76 | 3.10.20.30 |
| af_E7F6P4_395_521_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.888 | 46 | 69 | 2.60.200.20 |
| af_I6XWG2_11_92_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8869 | 1 | 76 | 3.10.20.30 |
| af_Q9VN82_366_475_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8835 | 46 | 70 | 2.60.200.20 |
| af_A0A0R4IFD5_328_446_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8821 | 45 | 70 | 2.60.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7M3MZC0-F1-model_v4 | MoaD/ThiS family protein | 0.9763 | 1 | 76 |
|
| AF-A0A2U1A499-F1-model_v4 | deleted | 0.9723 | 1 | 76 |
|
| AF-A0A7G5XL76-F1-model_v4 | MoaD/ThiS family protein | 0.9666 | 1 | 76 |
|
| AF-A0A4Q3RZK4-F1-model_v4 | MoaD/ThiS family protein | 0.9643 | 1 | 76 |
|
| AF-A0A4V2A605-F1-model_v4 | MoaD/ThiS family protein | 0.964 | 1 | 76 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar