F466603

General Info

Members Datasets Scaffolds Average Seq Length
586 279 1172 147

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0021378|Ga0501033_0021378_222_734
Length 170
Sequence MDNESDGMRRAPRARTTTMSDRQPELSHVDPVGGVRMVNVGAKPLSRRRAVARATVRMAPETAARLRALPKGDALATAQLAGIMAAKRTSDLIPLCHPLPLSAVDVRLEVGERAVEIEGIAETTAHTGVEMEALVAVSVAALTVYDMAKAIDGQMSVTDVVLVEKTKDVV

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
176 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.48
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0021378 3300049570 Bacteria 4881
2 JGI25407J50210_10061972 3300003373 Bacteria 939
3 Ga0070658_10337975 3300005327 Bacteria 1288
4 Ga0070683_100984345 3300005329 Bacteria 809
5 Ga0070670_101342444 3300005331 Bacteria 655
6 Ga0070682_101614882 3300005337 Bacteria 561
7 Ga0070689_100311887 3300005340 Bacteria 1312
8 Ga0070661_100164822 3300005344 Bacteria 1680
9 Ga0070668_100646042 3300005347 Bacteria 929
10 Ga0070669_100213676 3300005353 Bacteria 1523
11 Ga0070675_100073596 3300005354 Bacteria 2837
12 Ga0070671_100150374 3300005355 Bacteria 1966
13 Ga0070674_101092015 3300005356 Bacteria 704
14 Ga0070688_100043928 3300005365 Bacteria 2756
15 Ga0070659_100150596 3300005366 Bacteria 1898
16 Ga0070709_10028844 3300005434 Bacteria 3313
17 Ga0070709_10205279 3300005434 Bacteria 1398
18 Ga0070709_10364371 3300005434 Bacteria 1071
19 Ga0070714_100023312 3300005435 Bacteria 5083
20 Ga0070714_100210438 3300005435 Bacteria 1782
21 Ga0070714_101543632 3300005435 Bacteria 649
22 Ga0070713_100001060 3300005436 Bacteria 17565
23 Ga0070713_100017251 3300005436 Bacteria 5455
24 Ga0070713_100079018 3300005436 Bacteria 2801
25 Ga0070713_100254701 3300005436 Bacteria 1602
26 Ga0070713_100350975 3300005436 Bacteria 1369
27 Ga0070710_10057608 3300005437 Bacteria 2202
28 Ga0070711_100021588 3300005439 Bacteria 4165
29 Ga0070705_100492078 3300005440 Bacteria 929
30 Ga0070705_100697902 3300005440 Bacteria 797
31 Ga0070708_100025914 3300005445 Bacteria 5014
32 Ga0070663_100239468 3300005455 Bacteria 1432
33 Ga0070662_100941784 3300005457 Bacteria 738
34 Ga0070681_10123323 3300005458 Bacteria 2524
35 Ga0070681_10250043 3300005458 Bacteria 1686
36 Ga0068867_100512723 3300005459 Bacteria 1033
37 Ga0070685_10396501 3300005466 Bacteria 955
38 Ga0070706_100052928 3300005467 Bacteria 3746
39 Ga0070706_100280169 3300005467 Bacteria 1556
40 Ga0070707_100011501 3300005468 Bacteria 8253
41 Ga0070707_100117432 3300005468 Bacteria 2582
42 Ga0070707_100335033 3300005468 Bacteria 1470
43 Ga0070707_100663188 3300005468 Bacteria 1006
44 Ga0070698_100017424 3300005471 Bacteria 7572
45 Ga0070698_100034960 3300005471 Bacteria 5197
46 Ga0070698_100359094 3300005471 Bacteria 1388
47 Ga0070699_100033806 3300005518 Bacteria 4418
48 Ga0070679_100211637 3300005530 Bacteria 1902
49 Ga0070684_100124698 3300005535 Bacteria 2319
50 Ga0070684_100190829 3300005535 Bacteria 1864
51 Ga0070697_100064098 3300005536 Bacteria 3001
52 Ga0070686_100177069 3300005544 Bacteria 1513
53 Ga0070695_100210224 3300005545 Bacteria 1396
54 Ga0070693_100004375 3300005547 Bacteria 6669
55 Ga0070693_100010510 3300005547 Bacteria 4640
56 Ga0070665_100811364 3300005548 Bacteria 949
57 Ga0070665_101838715 3300005548 Bacteria 612
58 Ga0068855_100446927 3300005563 Bacteria 1411
59 Ga0068855_101093229 3300005563 Bacteria 834
60 Ga0070664_101125270 3300005564 Bacteria 740
61 Ga0068856_100099669 3300005614 Bacteria 2896
62 Ga0068852_100733158 3300005616 Bacteria 1000
63 Ga0068864_100025713 3300005618 Bacteria 4961
64 Ga0068866_10052927 3300005718 Bacteria 2073
65 Ga0068863_101896908 3300005841 Bacteria 606
66 Ga0081455_10834168 3300005937 Bacteria 577
67 Ga0081538_10000755 3300005981 Bacteria 35288
68 Ga0081538_10005147 3300005981 Bacteria 11853
69 Ga0081538_10071302 3300005981 Bacteria 1912
70 Ga0070717_10005558 3300006028 Bacteria 9196
71 Ga0070717_10030563 3300006028 Bacteria 4327
72 Ga0070717_10159132 3300006028 Bacteria 1958
73 Ga0070715_10001395 3300006163 Bacteria 6980
74 Ga0070716_100005635 3300006173 Bacteria 6082
75 Ga0070712_100559745 3300006175 Bacteria 964
76 Ga0070712_100861788 3300006175 Bacteria 780
77 Ga0075434_100049773 3300006871 Bacteria 4162
78 Ga0075435_100493987 3300007076 Bacteria 1058
79 Ga0111539_11467343 3300009094 Bacteria 791
80 Ga0105245_10032064 3300009098 Bacteria 4652
81 Ga0105245_10721004 3300009098 Bacteria 1031
82 Ga0105245_12066850 3300009098 Bacteria 623
83 Ga0114129_10110499 3300009147 Bacteria 3794
84 Ga0114129_12446061 3300009147 Bacteria 625
85 Ga0105243_10351627 3300009148 Bacteria 1353
86 Ga0105241_10208191 3300009174 Bacteria 1637
87 Ga0105242_10189090 3300009176 Bacteria 1822
88 Ga0105242_10568378 3300009176 Bacteria 1090
89 Ga0157373_10232005 3300013100 Bacteria 1304
90 Ga0157369_10002742 3300013105 Bacteria 21036
91 Ga0157369_10035760 3300013105 Bacteria 5445
92 Ga0157374_10897009 3300013296 Bacteria 904
93 Ga0163162_10404913 3300013306 Bacteria 1497
94 Ga0157375_10516764 3300013308 Bacteria 1358
95 Ga0157375_10636477 3300013308 Bacteria 1223
96 Ga0163163_10149744 3300014325 Bacteria 2378
97 Ga0163163_10235616 3300014325 Bacteria 1880
98 Ga0163163_11692616 3300014325 Bacteria 693
99 Ga0157380_10023035 3300014326 Bacteria 4696
100 Ga0157380_10149719 3300014326 Bacteria 2016
101 Ga0182008_10250599 3300014497 Bacteria 913
102 Ga0157377_10057913 3300014745 Bacteria 2205
103 Ga0157377_10428536 3300014745 Bacteria 908
104 Ga0157379_10248888 3300014968 Bacteria 1613
105 Ga0157379_10710106 3300014968 Bacteria 944
106 Ga0157379_10878056 3300014968 Bacteria 850
107 Ga0157376_10649174 3300014969 Bacteria 1055
108 Ga0157376_10760729 3300014969 Bacteria 979
109 Ga0206354_11541713 3300020081 Bacteria 726
110 Ga0206354_11591820 3300020081 Bacteria 1407
111 Ga0206354_11622228 3300020081 Bacteria 596
112 Ga0206353_11776332 3300020082 Bacteria 796
113 Ga0207697_10128108 3300025315 Bacteria 1096
114 Ga0207692_10043244 3300025898 Bacteria 2240
115 Ga0207642_10055415 3300025899 Bacteria 1813
116 Ga0207642_10502625 3300025899 Bacteria 742
117 Ga0207642_10716574 3300025899 Bacteria 631
118 Ga0207685_10077178 3300025905 Bacteria 1368
119 Ga0207699_10018015 3300025906 Bacteria 3733
120 Ga0207699_10184370 3300025906 Bacteria 1405
121 Ga0207699_10274134 3300025906 Bacteria 1170
122 Ga0207705_10138056 3300025909 Bacteria 1819
123 Ga0207705_10333800 3300025909 Bacteria 1166
124 Ga0207684_10103641 3300025910 Bacteria 2432
125 Ga0207654_10062066 3300025911 Bacteria 2188
126 Ga0207707_10180183 3300025912 Bacteria 1845
127 Ga0207707_10420971 3300025912 Bacteria 1145
128 Ga0207695_10232742 3300025913 Bacteria 1746
129 Ga0207693_10015138 3300025915 Bacteria 6191
130 Ga0207693_10505232 3300025915 Bacteria 944
131 Ga0207693_10795674 3300025915 Bacteria 729
132 Ga0207663_10101132 3300025916 Bacteria 1936
133 Ga0207660_10711770 3300025917 Bacteria 819
134 Ga0207649_10245787 3300025920 Bacteria 1286
135 Ga0207652_10149837 3300025921 Bacteria 2088
136 Ga0207646_10002982 3300025922 Bacteria 19556
137 Ga0207646_10598546 3300025922 Bacteria 990
138 Ga0207650_10339276 3300025925 Bacteria 1234
139 Ga0207659_10040213 3300025926 Bacteria 3268
140 Ga0207687_10018686 3300025927 Bacteria 4580
141 Ga0207687_10484182 3300025927 Bacteria 1031
142 Ga0207687_11133318 3300025927 Bacteria 672
143 Ga0207700_10033783 3300025928 Bacteria 3663
144 Ga0207700_10252655 3300025928 Bacteria 1506
145 Ga0207664_10018300 3300025929 Bacteria 5155
146 Ga0207664_10044151 3300025929 Bacteria 3489
147 Ga0207664_10072301 3300025929 Bacteria 2780
148 Ga0207664_10200174 3300025929 Bacteria 1723
149 Ga0207664_10325139 3300025929 Bacteria 1357
150 Ga0207644_10044880 3300025931 Bacteria 3142
151 Ga0207644_10051087 3300025931 Bacteria 2966
152 Ga0207690_10118173 3300025932 Bacteria 1921
153 Ga0207686_10612988 3300025934 Bacteria 858
154 Ga0207670_10245311 3300025936 Bacteria 1382
155 Ga0207669_10201334 3300025937 Bacteria 1446
156 Ga0207669_10529196 3300025937 Bacteria 948
157 Ga0207665_10002358 3300025939 Bacteria 12754
158 Ga0207665_10203673 3300025939 Bacteria 1443
159 Ga0207691_10881210 3300025940 Bacteria 750
160 Ga0207689_11279348 3300025942 Bacteria 616
161 Ga0207661_10613302 3300025944 Bacteria 999
162 Ga0207661_10719034 3300025944 Bacteria 919
163 Ga0207667_10255969 3300025949 Bacteria 1791
164 Ga0207668_10265976 3300025972 Bacteria 1400
165 Ga0207640_10402271 3300025981 Bacteria 1115
166 Ga0207677_10430020 3300026023 Bacteria 1127
167 Ga0207678_10001478 3300026067 Bacteria 21558
168 Ga0207676_10021755 3300026095 Bacteria 4708
169 Ga0207675_100403066 3300026118 Bacteria 1348
170 Ga0207683_10132233 3300026121 Bacteria 2245
171 Ga0207683_11077545 3300026121 Bacteria 745
172 Ga0207683_11196567 3300026121 Bacteria 704
173 Ga0268266_10450212 3300028379 Bacteria 1224
174 Ga0268266_10848501 3300028379 Bacteria 883
175 Ga0265326_10128518 3300028558 Bacteria 722
176 Ga0265319_1000635 3300028563 Bacteria 23180
177 Ga0265319_1013398 3300028563 Bacteria 3262
178 Ga0265319_1064650 3300028563 Bacteria 1181
179 Ga0265334_10003435 3300028573 Bacteria 7203
180 Ga0265334_10156547 3300028573 Bacteria 802
181 Ga0265318_10000338 3300028577 Bacteria 37223
182 Ga0265318_10053394 3300028577 Bacteria 1515
183 Ga0265318_10130768 3300028577 Bacteria 923
184 Ga0265323_10021941 3300028653 Bacteria 2443
185 Ga0265322_10011765 3300028654 Bacteria 2533
186 Ga0265322_10037275 3300028654 Bacteria 1385
187 Ga0265336_10001093 3300028666 Bacteria 13087
188 Ga0265336_10024688 3300028666 Bacteria 1897
189 Ga0265338_10007510 3300028800 Bacteria 13496
190 Ga0265338_10362584 3300028800 Bacteria 1039
191 Ga0265330_10000327 3300031235 Bacteria 34205
192 Ga0265332_10006061 3300031238 Bacteria 5524
193 Ga0265328_10000520 3300031239 Bacteria 17888
194 Ga0265320_10006577 3300031240 Bacteria 7306
195 Ga0265325_10000102 3300031241 Bacteria 59998
196 Ga0265325_10492691 3300031241 Bacteria 532
197 Ga0265329_10000373 3300031242 Bacteria 23681
198 Ga0265340_10002339 3300031247 Bacteria 10824
199 Ga0265339_10001624 3300031249 Bacteria 16616
200 Ga0265339_10086271 3300031249 Bacteria 1651
201 Ga0265331_10005697 3300031250 Bacteria 7474
202 Ga0265331_10056389 3300031250 Bacteria 1866
203 Ga0265327_10008083 3300031251 Bacteria 7923
204 Ga0265327_10044866 3300031251 Bacteria 2353
205 Ga0265316_10021395 3300031344 Bacteria 5477
206 Ga0265316_10137913 3300031344 Bacteria 1834
207 Ga0265316_10318203 3300031344 Bacteria 1131
208 Ga0307408_100156397 3300031548 Bacteria 1806
209 Ga0307408_100357744 3300031548 Bacteria 1241
210 Ga0307408_101220321 3300031548 Bacteria 702
211 Ga0265313_10002639 3300031595 Bacteria 15258
212 Ga0265314_10002591 3300031711 Bacteria 18287
213 Ga0265314_10007659 3300031711 Bacteria 9338
214 Ga0265342_10006401 3300031712 Bacteria 8772
215 Ga0265342_10042300 3300031712 Bacteria 2753
216 Ga0307413_10462760 3300031824 Bacteria 1009
217 Ga0307413_11344369 3300031824 Bacteria 627
218 Ga0307410_10176923 3300031852 Bacteria 1612
219 Ga0307406_10277508 3300031901 Bacteria 1276
220 Ga0307407_10091816 3300031903 Bacteria 1863
221 Ga0307407_11257581 3300031903 Bacteria 580
222 Ga0307409_100202033 3300031995 Bacteria 1779
223 Ga0307409_100316493 3300031995 Bacteria 1459
224 Ga0307409_100348387 3300031995 Bacteria 1397
225 Ga0307409_101112504 3300031995 Bacteria 811
226 Ga0307409_101120587 3300031995 Bacteria 808
227 Ga0307416_100100631 3300032002 Bacteria 2514
228 Ga0307416_100146534 3300032002 Bacteria 2157
229 Ga0307416_100174197 3300032002 Bacteria 2007
230 Ga0307416_100586563 3300032002 Bacteria 1193
231 Ga0307416_101077793 3300032002 Bacteria 908
232 Ga0307416_101204831 3300032002 Bacteria 863
233 Ga0307416_101746073 3300032002 Bacteria 727
234 Ga0307416_101934315 3300032002 Bacteria 693
235 Ga0307414_10559736 3300032004 Bacteria 1020
236 Ga0307411_10929358 3300032005 Bacteria 774
237 Ga0307415_100062191 3300032126 Bacteria 2588
238 Ga0307415_100122255 3300032126 Bacteria 1954
239 Ga0316583_10233199 3300032133 Bacteria 638
240 Ga0373934_0345978 3300035086 Bacteria 619
241 Ga0373941_0199888 3300035115 Bacteria 759
242 Ga0373945_0020902 3300035116 Bacteria 2245
243 Ga0373945_0392477 3300035116 Bacteria 607
244 Ga0373953_0299404 3300035117 Bacteria 702
245 Ga0373956_0055371 3300035119 Bacteria 1789
246 Ga0373943_0050136 3300035170 Bacteria 2050
247 Ga0373955_0344204 3300035172 Bacteria 902
248 Ga0373924_0326542 3300035410 Bacteria 683
249 Ga0373931_0007846 3300035691 Bacteria 5046
250 Ga0373931_0529145 3300035691 Bacteria 764
251 Ga0373931_0534686 3300035691 Bacteria 760
252 Ga0373935_0086476 3300035692 Bacteria 2046
253 Ga0373927_0102392 3300035695 Bacteria 1863
254 Ga0373933_0201422 3300035724 Bacteria 1274
255 Ga0373947_0002635 3300035725 Bacteria 10776
256 Ga0373947_0285921 3300035725 Bacteria 1097
257 Ga0373937_0874521 3300036401 Bacteria 847
258 Ga0316584_0074384 3300036712 Bacteria 2547
259 Ga0373925_0094313 3300037068 Bacteria 2292
260 Ga0395899_0005918 3300037312 Bacteria 9496
261 Ga0395899_0026385 3300037312 Bacteria 4384
262 Ga0395899_0071055 3300037312 Bacteria 2547
263 Ga0395900_0000936 3300037418 Bacteria 38235
264 Ga0395900_0587149 3300037418 Bacteria 1055
265 Ga0395900_0710330 3300037418 Bacteria 938
266 Ga0395900_0854906 3300037418 Bacteria 835
267 Ga0395900_0989560 3300037418 Bacteria 761
268 Ga0395898_0004426 3300037466 Bacteria 15372
269 Ga0395898_0113363 3300037466 Bacteria 2599
270 Ga0395898_0141428 3300037466 Bacteria 2304
271 Ga0395898_0447605 3300037466 Bacteria 1230
272 Ga0395898_0712123 3300037466 Bacteria 945
273 Ga0395898_0769941 3300037466 Bacteria 903
274 Ga0395898_1235564 3300037466 Bacteria 678
275 Ga0395905_0028476 3300037471 Bacteria 5267
276 Ga0395905_0219889 3300037471 Bacteria 1778
277 Ga0436364_1485526 3300037853 Unclassified 1058
278 Ga0395901_0003282 3300038443 Bacteria 16280
279 Ga0395901_0041503 3300038443 Bacteria 4768
280 Ga0395901_0627923 3300038443 Bacteria 1080
281 Ga0436360_0248969 3300039438 Bacteria 1518
282 Ga0439461_0016252 3300041410 Bacteria 1434
283 Ga0439466_0018341 3300041411 Bacteria 2511
284 Ga0451849_0517794 3300041505 Bacteria 1041
285 Ga0439437_002749 3300042000 Bacteria 1892
286 Ga0439441_036454 3300042001 Bacteria 972
287 Ga0439448_0056729 3300042005 Bacteria 1290
288 Ga0439432_161394 3300042006 Bacteria 656
289 Ga0450898_012159 3300042134 Bacteria 1419
290 Ga0450907_028083 3300042146 Bacteria 954
291 Ga0439446_0078963 3300042156 Bacteria 1017
292 Ga0439434_0186388 3300042435 Bacteria 696
293 Ga0450918_032284 3300042531 Bacteria 926
294 Ga0466969_0241450 3300044656 Bacteria 820
295 Ga0466961_0008109 3300044693 Bacteria 6687
296 Ga0466961_0488902 3300044693 Bacteria 744
297 Ga0466963_0014736 3300044694 Bacteria 4825
298 Ga0466963_0028626 3300044694 Bacteria 3579
299 Ga0466963_0040014 3300044694 Bacteria 3072
300 Ga0466964_0004150 3300044706 Bacteria 5329
301 Ga0466964_0010305 3300044706 Bacteria 3525
302 Ga0466964_0015210 3300044706 Bacteria 2929
303 Ga0466964_0099212 3300044706 Bacteria 1281
304 Ga0466971_0043768 3300044719 Bacteria 2011
305 Ga0466971_0124989 3300044719 Bacteria 1192
306 Ga0466968_0118187 3300044735 Bacteria 1198
307 Ga0466957_0041509 3300044842 Bacteria 2782
308 Ga0466957_0092470 3300044842 Bacteria 1897
309 Ga0466957_0445949 3300044842 Bacteria 891
310 Ga0466958_0009418 3300045836 Bacteria 5443
311 Ga0466958_0024116 3300045836 Bacteria 3578
312 Ga0466967_0027427 3300045976 Bacteria 4737
313 Ga0466967_0027599 3300045976 Bacteria 4724
314 Ga0466967_0164809 3300045976 Bacteria 2082
315 Ga0466967_0169689 3300045976 Bacteria 2052
316 Ga0466967_0209914 3300045976 Bacteria 1846
317 Ga0466967_0210861 3300045976 Bacteria 1842
318 Ga0466967_0217489 3300045976 Bacteria 1814
319 Ga0466967_0257747 3300045976 Bacteria 1668
320 Ga0466967_0288889 3300045976 Bacteria 1575
321 Ga0466967_0601670 3300045976 Bacteria 1085
322 Ga0466967_0712130 3300045976 Bacteria 995
323 Ga0466967_1687790 3300045976 Unclassified 631
324 Ga0495603_0022206 3300046455 Bacteria 3843
325 Ga0495591_085869 3300046458 Unclassified 796
326 Ga0495629_0171018 3300046459 Bacteria 1508
327 Ga0495629_0384254 3300046459 Bacteria 955
328 Ga0495629_0851014 3300046459 Bacteria 600
329 Ga0495651_0355292 3300046462 Bacteria 967
330 Ga0495651_0858546 3300046462 Bacteria 557
331 Ga0495653_0090134 3300046463 Bacteria 2245
332 Ga0495653_0222775 3300046463 Unclassified 1267
333 Ga0495582_0652009 3300046473 Bacteria 609
334 Ga0495664_0294627 3300046477 Bacteria 980
335 Ga0495584_0048613 3300046491 Bacteria 2138
336 Ga0495584_0174442 3300046491 Bacteria 1093
337 Ga0495596_0236790 3300046500 Bacteria 708
338 Ga0495608_0103579 3300046511 Bacteria 1834
339 Ga0495608_0151891 3300046511 Bacteria 1475
340 Ga0495608_0247071 3300046511 Bacteria 1113
341 Ga0495630_1199184 3300046517 Bacteria 574
342 Ga0495631_0228023 3300046518 Bacteria 795
343 Ga0495663_0034106 3300046525 Bacteria 1522
344 Ga0495640_0230850 3300046533 Bacteria 1164
345 Ga0495587_0116154 3300046536 Bacteria 1535
346 Ga0495587_0137088 3300046536 Bacteria 1398
347 Ga0495609_0059130 3300046538 Bacteria 1695
348 Ga0495609_0150032 3300046538 Bacteria 992
349 Ga0495667_0018143 3300046559 Bacteria 4754
350 Ga0495667_0207478 3300046559 Bacteria 1253
351 Ga0495667_0259218 3300046559 Bacteria 1106
352 Ga0495656_0024202 3300046615 Bacteria 2396
353 Ga0495656_0076254 3300046615 Unclassified 1502
354 Ga0495656_0220537 3300046615 Bacteria 948
355 Ga0495656_0252874 3300046615 Bacteria 891
356 Ga0495634_0053079 3300046642 Bacteria 2716
357 Ga0495635_0098981 3300046663 Bacteria 1993
358 Ga0495635_0149339 3300046663 Bacteria 1591
359 Ga0495635_0598653 3300046663 Bacteria 720
360 Ga0495657_0072542 3300046675 Bacteria 2245
361 Ga0495658_0330405 3300046683 Bacteria 967
362 Ga0495658_0506943 3300046683 Bacteria 772
363 Ga0495613_0580955 3300046689 Bacteria 747
364 Ga0495589_0380775 3300046794 Bacteria 648
365 Ga0495581_0524450 3300047315 Bacteria 688
366 Ga0495604_0185668 3300047317 Bacteria 1452
367 Ga0495680_0018905 3300047322 Bacteria 5834
368 Ga0495680_0077775 3300047322 Bacteria 2512
369 Ga0495675_0212696 3300047444 Bacteria 1173
370 Ga0495677_0109777 3300047445 Unclassified 1048
371 Ga0495684_0050894 3300047471 Bacteria 3162
372 Ga0495684_0585540 3300047471 Bacteria 755
373 Ga0495593_0251448 3300047673 Bacteria 885
374 Ga0495614_0287501 3300048089 Bacteria 758
375 Ga0495626_0337532 3300048091 Bacteria 590
376 Ga0496100_0082846 3300048903 Bacteria 2170
377 Ga0496101_0035886 3300048904 Bacteria 3508
378 Ga0496101_0307247 3300048904 Bacteria 1243
379 Ga0496102_0121116 3300048905 Bacteria 2443
380 Ga0496102_0616278 3300048905 Bacteria 1008
381 Ga0496103_0173891 3300048906 Bacteria 1383
382 Ga0496103_0829439 3300048906 Bacteria 582
383 Ga0496103_0849788 3300048906 Bacteria 574
384 Ga0496104_0000865 3300048907 Bacteria 26083
385 Ga0496104_0139359 3300048907 Bacteria 2331
386 Ga0496105_0000775 3300048908 Bacteria 21608
387 Ga0496105_0128886 3300048908 Bacteria 2086
388 Ga0496106_0013216 3300048909 Bacteria 6092
389 Ga0496107_0001734 3300048910 Bacteria 13705
390 Ga0496108_0018106 3300048911 Bacteria 5763
391 Ga0496108_0028356 3300048911 Bacteria 4631
392 Ga0496108_1094053 3300048911 Bacteria 678
393 Ga0496109_0001239 3300048912 Bacteria 21163
394 Ga0496109_0032272 3300048912 Bacteria 4707
395 Ga0496109_0082429 3300048912 Bacteria 2964
396 Ga0496109_0321749 3300048912 Bacteria 1460
397 Ga0496109_0983761 3300048912 Bacteria 781
398 Ga0496109_1193547 3300048912 Unclassified 698
399 Ga0496110_0000769 3300048913 Bacteria 22239
400 Ga0496110_0010243 3300048913 Bacteria 7615
401 Ga0496110_0163347 3300048913 Bacteria 2019
402 Ga0496111_0000081 3300048914 Bacteria 39898
403 Ga0496111_0151590 3300048914 Bacteria 1719
404 Ga0496111_0285267 3300048914 Bacteria 1225
405 Ga0496111_0821877 3300048914 Bacteria 672
406 Ga0496112_0003845 3300048915 Bacteria 12539
407 Ga0496112_0225019 3300048915 Bacteria 1831
408 Ga0496113_0162913 3300048916 Bacteria 1764
409 Ga0496113_0638490 3300048916 Bacteria 852
410 Ga0496113_0839259 3300048916 Bacteria 729
411 Ga0496114_0018394 3300048917 Bacteria 5649
412 Ga0496115_0002328 3300048918 Bacteria 13615
413 Ga0496115_0244212 3300048918 Bacteria 1479
414 Ga0501299_161658 3300049522 Bacteria 573
415 Ga0501031_0008694 3300049568 Bacteria 6602
416 Ga0501031_0085533 3300049568 Bacteria 2056
417 Ga0501031_0736295 3300049568 Bacteria 633
418 Ga0501032_0001554 3300049569 Bacteria 18314
419 Ga0501032_0008127 3300049569 Bacteria 7648
420 Ga0501032_0059046 3300049569 Bacteria 2574
421 Ga0501032_0459606 3300049569 Bacteria 815
422 Ga0501033_0000899 3300049570 Bacteria 27196
423 Ga0501033_0068861 3300049570 Bacteria 2601
424 Ga0501033_0284670 3300049570 Bacteria 1166
425 Ga0501034_0058838 3300049571 Bacteria 3860
426 Ga0501036_0020205 3300049572 Bacteria 5592
427 Ga0501036_0048923 3300049572 Bacteria 3579
428 Ga0501036_0071870 3300049572 Bacteria 2925
429 Ga0501036_0473512 3300049572 Bacteria 1043
430 Ga0501036_0829634 3300049572 Bacteria 761
431 Ga0501037_0001731 3300049573 Bacteria 15846
432 Ga0501037_0007386 3300049573 Bacteria 8039
433 Ga0501037_0061310 3300049573 Bacteria 2742
434 Ga0501037_0166889 3300049573 Bacteria 1567
435 Ga0501038_0003802 3300049574 Bacteria 14046
436 Ga0501038_0015616 3300049574 Bacteria 6902
437 Ga0501038_0045995 3300049574 Bacteria 3785
438 Ga0501038_1152726 3300049574 Bacteria 564
439 Ga0501039_0006599 3300049575 Bacteria 8814
440 Ga0501039_0038218 3300049575 Bacteria 3708
441 Ga0501039_0411067 3300049575 Bacteria 1063
442 Ga0501040_0001448 3300049576 Bacteria 15032
443 Ga0501040_0002266 3300049576 Bacteria 12360
444 Ga0501040_0005343 3300049576 Bacteria 8305
445 Ga0501040_0016677 3300049576 Bacteria 4866
446 Ga0501040_0016915 3300049576 Bacteria 4835
447 Ga0501041_0000474 3300049577 Bacteria 20418
448 Ga0501041_0002807 3300049577 Bacteria 9951
449 Ga0501041_0014006 3300049577 Bacteria 4758
450 Ga0501041_0016523 3300049577 Bacteria 4388
451 Ga0501041_0069596 3300049577 Bacteria 2159
452 Ga0501042_0000695 3300049578 Bacteria 18274
453 Ga0501042_0000930 3300049578 Bacteria 16501
454 Ga0501042_0011934 3300049578 Bacteria 5871
455 Ga0501042_0019636 3300049578 Bacteria 4696
456 Ga0501043_0000693 3300049579 Bacteria 29791
457 Ga0501043_0001696 3300049579 Bacteria 19096
458 Ga0501043_0067282 3300049579 Bacteria 2814
459 Ga0501043_0156265 3300049579 Bacteria 1783
460 Ga0501046_0000977 3300049580 Bacteria 28011
461 Ga0501046_0001855 3300049580 Bacteria 20125
462 Ga0501046_0013699 3300049580 Bacteria 6856
463 Ga0501046_0415085 3300049580 Bacteria 971
464 Ga0501047_0009198 3300049581 Bacteria 9328
465 Ga0501047_0014688 3300049581 Bacteria 7451
466 Ga0501048_0002297 3300049582 Bacteria 14588
467 Ga0501048_0002843 3300049582 Bacteria 13219
468 Ga0501048_0042581 3300049582 Bacteria 3250
469 Ga0501067_0157010 3300049583 Bacteria 1267
470 Ga0501068_0001514 3300049584 Bacteria 12364
471 Ga0501068_0001541 3300049584 Bacteria 12248
472 Ga0501068_0004782 3300049584 Bacteria 7369
473 Ga0501068_0017476 3300049584 Bacteria 4148
474 Ga0501068_0160991 3300049584 Bacteria 1415
475 Ga0501068_0298401 3300049584 Bacteria 1031
476 Ga0501068_0562020 3300049584 Bacteria 742
477 Ga0501069_0012964 3300049585 Bacteria 4439
478 Ga0501069_0014588 3300049585 Bacteria 4201
479 Ga0501069_0016712 3300049585 Bacteria 3943
480 Ga0501069_0020417 3300049585 Bacteria 3589
481 Ga0501069_0023599 3300049585 Bacteria 3355
482 Ga0501069_0055909 3300049585 Bacteria 2198
483 Ga0501069_0064528 3300049585 Bacteria 2047
484 Ga0501069_0092823 3300049585 Bacteria 1708
485 Ga0501070_0003573 3300049586 Bacteria 13450
486 Ga0501070_0007108 3300049586 Bacteria 9518
487 Ga0501070_0389587 3300049586 Bacteria 1128
488 Ga0501070_1103731 3300049586 Bacteria 612
489 Ga0501071_0018706 3300049587 Bacteria 4802
490 Ga0501071_0028535 3300049587 Bacteria 3934
491 Ga0501071_0035652 3300049587 Bacteria 3544
492 Ga0501071_0040047 3300049587 Bacteria 3353
493 Ga0501071_0196616 3300049587 Bacteria 1514
494 Ga0501072_0011384 3300049588 Bacteria 6798
495 Ga0501072_0013190 3300049588 Bacteria 6328
496 Ga0501072_0040323 3300049588 Bacteria 3666
497 Ga0501072_0254153 3300049588 Bacteria 1399
498 Ga0501072_1124909 3300049588 Bacteria 611
499 Ga0501073_0009280 3300049589 Bacteria 7256
500 Ga0501073_0043952 3300049589 Bacteria 3149
501 Ga0501073_0393127 3300049589 Bacteria 958
502 Ga0501074_0014752 3300049590 Bacteria 5683
503 Ga0501074_0020418 3300049590 Bacteria 4814
504 Ga0501074_0098013 3300049590 Bacteria 2098
505 Ga0501074_0576362 3300049590 Bacteria 796
506 Ga0501075_0007131 3300049591 Bacteria 7732
507 Ga0501075_0011485 3300049591 Bacteria 6269
508 Ga0501075_0019126 3300049591 Bacteria 4967
509 Ga0501075_0023721 3300049591 Bacteria 4492
510 Ga0501075_0109230 3300049591 Bacteria 2103
511 Ga0501075_0172743 3300049591 Bacteria 1649
512 Ga0501075_0184973 3300049591 Bacteria 1589
513 Ga0501076_0002835 3300049592 Bacteria 11987
514 Ga0501076_0005537 3300049592 Bacteria 9099
515 Ga0501076_0012435 3300049592 Bacteria 6362
516 Ga0501076_0067940 3300049592 Bacteria 2847
517 Ga0501076_0160843 3300049592 Bacteria 1829
518 Ga0501076_0261043 3300049592 Bacteria 1418
519 Ga0501076_0603911 3300049592 Bacteria 905
520 Ga0501077_0002484 3300049593 Bacteria 11045
521 Ga0501077_0007499 3300049593 Bacteria 6730
522 Ga0501077_0007845 3300049593 Bacteria 6591
523 Ga0501077_0588372 3300049593 Bacteria 714
524 Ga0501077_0926535 3300049593 Bacteria 560
525 Ga0501079_0001222 3300049741 Bacteria 17989
526 Ga0501079_0003088 3300049741 Bacteria 12192
527 Ga0501079_0008837 3300049741 Bacteria 7627
528 Ga0501079_0014711 3300049741 Bacteria 5963
529 Ga0501079_0098860 3300049741 Bacteria 2262
530 Ga0501079_0202190 3300049741 Bacteria 1552
531 Ga0501080_0016416 3300049742 Bacteria 6837
532 Ga0501080_0031199 3300049742 Bacteria 4965
533 Ga0501080_0135182 3300049742 Bacteria 2282
534 Ga0501080_0291153 3300049742 Bacteria 1482
535 Ga0501080_0312429 3300049742 Bacteria 1424
536 Ga0501080_0704856 3300049742 Bacteria 890
537 Ga0501080_0915887 3300049742 Bacteria 763
538 Ga0501081_0002176 3300049743 Bacteria 12311
539 Ga0501081_0004722 3300049743 Bacteria 8760
540 Ga0501081_0027203 3300049743 Bacteria 3859
541 Ga0501081_0033343 3300049743 Bacteria 3498
542 Ga0501081_0057928 3300049743 Bacteria 2680
543 Ga0501081_0216621 3300049743 Bacteria 1392
544 Ga0501081_0585722 3300049743 Bacteria 835
545 Ga0501083_0002444 3300049744 Bacteria 12712
546 Ga0501083_0007136 3300049744 Bacteria 7933
547 Ga0501083_0203422 3300049744 Bacteria 1291
548 Ga0501083_0716474 3300049744 Bacteria 651
549 Ga0501035_0001594 3300049822 Bacteria 22969
550 Ga0501035_0008865 3300049822 Bacteria 9360
551 Ga0501044_0011094 3300049823 Bacteria 9773
552 Ga0501044_0046006 3300049823 Bacteria 4520
553 Ga0501044_0046555 3300049823 Bacteria 4489
554 Ga0501044_0303792 3300049823 Bacteria 1524
555 Ga0501044_0629730 3300049823 Bacteria 963
556 Ga0501044_0635396 3300049823 Bacteria 958
557 Ga0501045_0002001 3300049824 Bacteria 13768
558 Ga0501045_0010241 3300049824 Bacteria 6564
559 Ga0501045_0022017 3300049824 Bacteria 4560
560 Ga0501045_0076746 3300049824 Bacteria 2462
561 Ga0501045_0103954 3300049824 Bacteria 2104
562 nmdc:mga05p37_957297_c1 3300050507 Unclassified 915
563 nmdc:mga0rr50_192196_c1 3300050513 Bacteria 1673
564 nmdc:mga0a205_222114_c1 3300050515 Bacteria 1774
565 Ga0495619_0011100 3300053085 Bacteria 5664
566 Ga0495619_0180417 3300053085 Bacteria 1461
567 Ga0495619_0353152 3300053085 Bacteria 1017
568 Ga0501084_0002144 3300054114 Bacteria 15775
569 Ga0501084_0028831 3300054114 Bacteria 4640
570 Ga0501084_0052612 3300054114 Bacteria 3406
571 Ga0501084_0087887 3300054114 Bacteria 2609
572 Ga0501084_0166349 3300054114 Bacteria 1861
573 Ga0501084_0463250 3300054114 Bacteria 1072
574 Ga0501084_0624170 3300054114 Bacteria 910
575 Ga0590071_020327 3300059421 Bacteria 1564
576 Ga0501082_0000690 3300060353 Bacteria 29775
577 Ga0501082_0138849 3300060353 Bacteria 2109
578 Ga0501082_0199658 3300060353 Bacteria 1740
579 Ga0466962_0006696 3300061719 Bacteria 5525
580 Ga0530510_0000474 3300061734 Bacteria 25778
581 Ga0530510_0003924 3300061734 Bacteria 10260
582 Ga0530510_0005435 3300061734 Bacteria 8816
583 Ga0530510_0009390 3300061734 Bacteria 6858
584 Ga0530510_0020115 3300061734 Bacteria 4746
585 Ga0530510_0133766 3300061734 Bacteria 1825
586 Ga0530510_0222248 3300061734 Bacteria 1404
587 Ga0501033_0021378
588 JGI25407J50210_10061972
589 Ga0070658_10337975
590 Ga0070683_100984345
591 Ga0070670_101342444
592 Ga0070682_101614882
593 Ga0070689_100311887
594 Ga0070661_100164822
595 Ga0070668_100646042
596 Ga0070669_100213676
597 Ga0070675_100073596
598 Ga0070671_100150374
599 Ga0070674_101092015
600 Ga0070688_100043928
601 Ga0070659_100150596
602 Ga0070709_10028844
603 Ga0070709_10205279
604 Ga0070709_10364371
605 Ga0070714_100023312
606 Ga0070714_100210438
607 Ga0070714_101543632
608 Ga0070713_100001060
609 Ga0070713_100017251
610 Ga0070713_100079018
611 Ga0070713_100254701
612 Ga0070713_100350975
613 Ga0070710_10057608
614 Ga0070711_100021588
615 Ga0070705_100492078
616 Ga0070705_100697902
617 Ga0070708_100025914
618 Ga0070663_100239468
619 Ga0070662_100941784
620 Ga0070681_10123323
621 Ga0070681_10250043
622 Ga0068867_100512723
623 Ga0070685_10396501
624 Ga0070706_100052928
625 Ga0070706_100280169
626 Ga0070707_100011501
627 Ga0070707_100117432
628 Ga0070707_100335033
629 Ga0070707_100663188
630 Ga0070698_100017424
631 Ga0070698_100034960
632 Ga0070698_100359094
633 Ga0070699_100033806
634 Ga0070679_100211637
635 Ga0070684_100124698
636 Ga0070684_100190829
637 Ga0070697_100064098
638 Ga0070686_100177069
639 Ga0070695_100210224
640 Ga0070693_100004375
641 Ga0070693_100010510
642 Ga0070665_100811364
643 Ga0070665_101838715
644 Ga0068855_100446927
645 Ga0068855_101093229
646 Ga0070664_101125270
647 Ga0068856_100099669
648 Ga0068852_100733158
649 Ga0068864_100025713
650 Ga0068866_10052927
651 Ga0068863_101896908
652 Ga0081455_10834168
653 Ga0081538_10000755
654 Ga0081538_10005147
655 Ga0081538_10071302
656 Ga0070717_10005558
657 Ga0070717_10030563
658 Ga0070717_10159132
659 Ga0070715_10001395
660 Ga0070716_100005635
661 Ga0070712_100559745
662 Ga0070712_100861788
663 Ga0075434_100049773
664 Ga0075435_100493987
665 Ga0111539_11467343
666 Ga0105245_10032064
667 Ga0105245_10721004
668 Ga0105245_12066850
669 Ga0114129_10110499
670 Ga0114129_12446061
671 Ga0105243_10351627
672 Ga0105241_10208191
673 Ga0105242_10189090
674 Ga0105242_10568378
675 Ga0157373_10232005
676 Ga0157369_10002742
677 Ga0157369_10035760
678 Ga0157374_10897009
679 Ga0163162_10404913
680 Ga0157375_10516764
681 Ga0157375_10636477
682 Ga0163163_10149744
683 Ga0163163_10235616
684 Ga0163163_11692616
685 Ga0157380_10023035
686 Ga0157380_10149719
687 Ga0182008_10250599
688 Ga0157377_10057913
689 Ga0157377_10428536
690 Ga0157379_10248888
691 Ga0157379_10710106
692 Ga0157379_10878056
693 Ga0157376_10649174
694 Ga0157376_10760729
695 Ga0206354_11541713
696 Ga0206354_11591820
697 Ga0206354_11622228
698 Ga0206353_11776332
699 Ga0207697_10128108
700 Ga0207692_10043244
701 Ga0207642_10055415
702 Ga0207642_10502625
703 Ga0207642_10716574
704 Ga0207685_10077178
705 Ga0207699_10018015
706 Ga0207699_10184370
707 Ga0207699_10274134
708 Ga0207705_10138056
709 Ga0207705_10333800
710 Ga0207684_10103641
711 Ga0207654_10062066
712 Ga0207707_10180183
713 Ga0207707_10420971
714 Ga0207695_10232742
715 Ga0207693_10015138
716 Ga0207693_10505232
717 Ga0207693_10795674
718 Ga0207663_10101132
719 Ga0207660_10711770
720 Ga0207649_10245787
721 Ga0207652_10149837
722 Ga0207646_10002982
723 Ga0207646_10598546
724 Ga0207650_10339276
725 Ga0207659_10040213
726 Ga0207687_10018686
727 Ga0207687_10484182
728 Ga0207687_11133318
729 Ga0207700_10033783
730 Ga0207700_10252655
731 Ga0207664_10018300
732 Ga0207664_10044151
733 Ga0207664_10072301
734 Ga0207664_10200174
735 Ga0207664_10325139
736 Ga0207644_10044880
737 Ga0207644_10051087
738 Ga0207690_10118173
739 Ga0207686_10612988
740 Ga0207670_10245311
741 Ga0207669_10201334
742 Ga0207669_10529196
743 Ga0207665_10002358
744 Ga0207665_10203673
745 Ga0207691_10881210
746 Ga0207689_11279348
747 Ga0207661_10613302
748 Ga0207661_10719034
749 Ga0207667_10255969
750 Ga0207668_10265976
751 Ga0207640_10402271
752 Ga0207677_10430020
753 Ga0207678_10001478
754 Ga0207676_10021755
755 Ga0207675_100403066
756 Ga0207683_10132233
757 Ga0207683_11077545
758 Ga0207683_11196567
759 Ga0268266_10450212
760 Ga0268266_10848501
761 Ga0265326_10128518
762 Ga0265319_1000635
763 Ga0265319_1013398
764 Ga0265319_1064650
765 Ga0265334_10003435
766 Ga0265334_10156547
767 Ga0265318_10000338
768 Ga0265318_10053394
769 Ga0265318_10130768
770 Ga0265323_10021941
771 Ga0265322_10011765
772 Ga0265322_10037275
773 Ga0265336_10001093
774 Ga0265336_10024688
775 Ga0265338_10007510
776 Ga0265338_10362584
777 Ga0265330_10000327
778 Ga0265332_10006061
779 Ga0265328_10000520
780 Ga0265320_10006577
781 Ga0265325_10000102
782 Ga0265325_10492691
783 Ga0265329_10000373
784 Ga0265340_10002339
785 Ga0265339_10001624
786 Ga0265339_10086271
787 Ga0265331_10005697
788 Ga0265331_10056389
789 Ga0265327_10008083
790 Ga0265327_10044866
791 Ga0265316_10021395
792 Ga0265316_10137913
793 Ga0265316_10318203
794 Ga0307408_100156397
795 Ga0307408_100357744
796 Ga0307408_101220321
797 Ga0265313_10002639
798 Ga0265314_10002591
799 Ga0265314_10007659
800 Ga0265342_10006401
801 Ga0265342_10042300
802 Ga0307413_10462760
803 Ga0307413_11344369
804 Ga0307410_10176923
805 Ga0307406_10277508
806 Ga0307407_10091816
807 Ga0307407_11257581
808 Ga0307409_100202033
809 Ga0307409_100316493
810 Ga0307409_100348387
811 Ga0307409_101112504
812 Ga0307409_101120587
813 Ga0307416_100100631
814 Ga0307416_100146534
815 Ga0307416_100174197
816 Ga0307416_100586563
817 Ga0307416_101077793
818 Ga0307416_101204831
819 Ga0307416_101746073
820 Ga0307416_101934315
821 Ga0307414_10559736
822 Ga0307411_10929358
823 Ga0307415_100062191
824 Ga0307415_100122255
825 Ga0316583_10233199
826 Ga0373934_0345978
827 Ga0373941_0199888
828 Ga0373945_0020902
829 Ga0373945_0392477
830 Ga0373953_0299404
831 Ga0373956_0055371
832 Ga0373943_0050136
833 Ga0373955_0344204
834 Ga0373924_0326542
835 Ga0373931_0007846
836 Ga0373931_0529145
837 Ga0373931_0534686
838 Ga0373935_0086476
839 Ga0373927_0102392
840 Ga0373933_0201422
841 Ga0373947_0002635
842 Ga0373947_0285921
843 Ga0373937_0874521
844 Ga0316584_0074384
845 Ga0373925_0094313
846 Ga0395899_0005918
847 Ga0395899_0026385
848 Ga0395899_0071055
849 Ga0395900_0000936
850 Ga0395900_0587149
851 Ga0395900_0710330
852 Ga0395900_0854906
853 Ga0395900_0989560
854 Ga0395898_0004426
855 Ga0395898_0113363
856 Ga0395898_0141428
857 Ga0395898_0447605
858 Ga0395898_0712123
859 Ga0395898_0769941
860 Ga0395898_1235564
861 Ga0395905_0028476
862 Ga0395905_0219889
863 Ga0436364_1485526
864 Ga0395901_0003282
865 Ga0395901_0041503
866 Ga0395901_0627923
867 Ga0436360_0248969
868 Ga0439461_0016252
869 Ga0439466_0018341
870 Ga0451849_0517794
871 Ga0439437_002749
872 Ga0439441_036454
873 Ga0439448_0056729
874 Ga0439432_161394
875 Ga0450898_012159
876 Ga0450907_028083
877 Ga0439446_0078963
878 Ga0439434_0186388
879 Ga0450918_032284
880 Ga0466969_0241450
881 Ga0466961_0008109
882 Ga0466961_0488902
883 Ga0466963_0014736
884 Ga0466963_0028626
885 Ga0466963_0040014
886 Ga0466964_0004150
887 Ga0466964_0010305
888 Ga0466964_0015210
889 Ga0466964_0099212
890 Ga0466971_0043768
891 Ga0466971_0124989
892 Ga0466968_0118187
893 Ga0466957_0041509
894 Ga0466957_0092470
895 Ga0466957_0445949
896 Ga0466958_0009418
897 Ga0466958_0024116
898 Ga0466967_0027427
899 Ga0466967_0027599
900 Ga0466967_0164809
901 Ga0466967_0169689
902 Ga0466967_0209914
903 Ga0466967_0210861
904 Ga0466967_0217489
905 Ga0466967_0257747
906 Ga0466967_0288889
907 Ga0466967_0601670
908 Ga0466967_0712130
909 Ga0466967_1687790
910 Ga0495603_0022206
911 Ga0495591_085869
912 Ga0495629_0171018
913 Ga0495629_0384254
914 Ga0495629_0851014
915 Ga0495651_0355292
916 Ga0495651_0858546
917 Ga0495653_0090134
918 Ga0495653_0222775
919 Ga0495582_0652009
920 Ga0495664_0294627
921 Ga0495584_0048613
922 Ga0495584_0174442
923 Ga0495596_0236790
924 Ga0495608_0103579
925 Ga0495608_0151891
926 Ga0495608_0247071
927 Ga0495630_1199184
928 Ga0495631_0228023
929 Ga0495663_0034106
930 Ga0495640_0230850
931 Ga0495587_0116154
932 Ga0495587_0137088
933 Ga0495609_0059130
934 Ga0495609_0150032
935 Ga0495667_0018143
936 Ga0495667_0207478
937 Ga0495667_0259218
938 Ga0495656_0024202
939 Ga0495656_0076254
940 Ga0495656_0220537
941 Ga0495656_0252874
942 Ga0495634_0053079
943 Ga0495635_0098981
944 Ga0495635_0149339
945 Ga0495635_0598653
946 Ga0495657_0072542
947 Ga0495658_0330405
948 Ga0495658_0506943
949 Ga0495613_0580955
950 Ga0495589_0380775
951 Ga0495581_0524450
952 Ga0495604_0185668
953 Ga0495680_0018905
954 Ga0495680_0077775
955 Ga0495675_0212696
956 Ga0495677_0109777
957 Ga0495684_0050894
958 Ga0495684_0585540
959 Ga0495593_0251448
960 Ga0495614_0287501
961 Ga0495626_0337532
962 Ga0496100_0082846
963 Ga0496101_0035886
964 Ga0496101_0307247
965 Ga0496102_0121116
966 Ga0496102_0616278
967 Ga0496103_0173891
968 Ga0496103_0829439
969 Ga0496103_0849788
970 Ga0496104_0000865
971 Ga0496104_0139359
972 Ga0496105_0000775
973 Ga0496105_0128886
974 Ga0496106_0013216
975 Ga0496107_0001734
976 Ga0496108_0018106
977 Ga0496108_0028356
978 Ga0496108_1094053
979 Ga0496109_0001239
980 Ga0496109_0032272
981 Ga0496109_0082429
982 Ga0496109_0321749
983 Ga0496109_0983761
984 Ga0496109_1193547
985 Ga0496110_0000769
986 Ga0496110_0010243
987 Ga0496110_0163347
988 Ga0496111_0000081
989 Ga0496111_0151590
990 Ga0496111_0285267
991 Ga0496111_0821877
992 Ga0496112_0003845
993 Ga0496112_0225019
994 Ga0496113_0162913
995 Ga0496113_0638490
996 Ga0496113_0839259
997 Ga0496114_0018394
998 Ga0496115_0002328
999 Ga0496115_0244212
1000 Ga0501299_161658
1001 Ga0501031_0008694
1002 Ga0501031_0085533
1003 Ga0501031_0736295
1004 Ga0501032_0001554
1005 Ga0501032_0008127
1006 Ga0501032_0059046
1007 Ga0501032_0459606
1008 Ga0501033_0000899
1009 Ga0501033_0068861
1010 Ga0501033_0284670
1011 Ga0501034_0058838
1012 Ga0501036_0020205
1013 Ga0501036_0048923
1014 Ga0501036_0071870
1015 Ga0501036_0473512
1016 Ga0501036_0829634
1017 Ga0501037_0001731
1018 Ga0501037_0007386
1019 Ga0501037_0061310
1020 Ga0501037_0166889
1021 Ga0501038_0003802
1022 Ga0501038_0015616
1023 Ga0501038_0045995
1024 Ga0501038_1152726
1025 Ga0501039_0006599
1026 Ga0501039_0038218
1027 Ga0501039_0411067
1028 Ga0501040_0001448
1029 Ga0501040_0002266
1030 Ga0501040_0005343
1031 Ga0501040_0016677
1032 Ga0501040_0016915
1033 Ga0501041_0000474
1034 Ga0501041_0002807
1035 Ga0501041_0014006
1036 Ga0501041_0016523
1037 Ga0501041_0069596
1038 Ga0501042_0000695
1039 Ga0501042_0000930
1040 Ga0501042_0011934
1041 Ga0501042_0019636
1042 Ga0501043_0000693
1043 Ga0501043_0001696
1044 Ga0501043_0067282
1045 Ga0501043_0156265
1046 Ga0501046_0000977
1047 Ga0501046_0001855
1048 Ga0501046_0013699
1049 Ga0501046_0415085
1050 Ga0501047_0009198
1051 Ga0501047_0014688
1052 Ga0501048_0002297
1053 Ga0501048_0002843
1054 Ga0501048_0042581
1055 Ga0501067_0157010
1056 Ga0501068_0001514
1057 Ga0501068_0001541
1058 Ga0501068_0004782
1059 Ga0501068_0017476
1060 Ga0501068_0160991
1061 Ga0501068_0298401
1062 Ga0501068_0562020
1063 Ga0501069_0012964
1064 Ga0501069_0014588
1065 Ga0501069_0016712
1066 Ga0501069_0020417
1067 Ga0501069_0023599
1068 Ga0501069_0055909
1069 Ga0501069_0064528
1070 Ga0501069_0092823
1071 Ga0501070_0003573
1072 Ga0501070_0007108
1073 Ga0501070_0389587
1074 Ga0501070_1103731
1075 Ga0501071_0018706
1076 Ga0501071_0028535
1077 Ga0501071_0035652
1078 Ga0501071_0040047
1079 Ga0501071_0196616
1080 Ga0501072_0011384
1081 Ga0501072_0013190
1082 Ga0501072_0040323
1083 Ga0501072_0254153
1084 Ga0501072_1124909
1085 Ga0501073_0009280
1086 Ga0501073_0043952
1087 Ga0501073_0393127
1088 Ga0501074_0014752
1089 Ga0501074_0020418
1090 Ga0501074_0098013
1091 Ga0501074_0576362
1092 Ga0501075_0007131
1093 Ga0501075_0011485
1094 Ga0501075_0019126
1095 Ga0501075_0023721
1096 Ga0501075_0109230
1097 Ga0501075_0172743
1098 Ga0501075_0184973
1099 Ga0501076_0002835
1100 Ga0501076_0005537
1101 Ga0501076_0012435
1102 Ga0501076_0067940
1103 Ga0501076_0160843
1104 Ga0501076_0261043
1105 Ga0501076_0603911
1106 Ga0501077_0002484
1107 Ga0501077_0007499
1108 Ga0501077_0007845
1109 Ga0501077_0588372
1110 Ga0501077_0926535
1111 Ga0501079_0001222
1112 Ga0501079_0003088
1113 Ga0501079_0008837
1114 Ga0501079_0014711
1115 Ga0501079_0098860
1116 Ga0501079_0202190
1117 Ga0501080_0016416
1118 Ga0501080_0031199
1119 Ga0501080_0135182
1120 Ga0501080_0291153
1121 Ga0501080_0312429
1122 Ga0501080_0704856
1123 Ga0501080_0915887
1124 Ga0501081_0002176
1125 Ga0501081_0004722
1126 Ga0501081_0027203
1127 Ga0501081_0033343
1128 Ga0501081_0057928
1129 Ga0501081_0216621
1130 Ga0501081_0585722
1131 Ga0501083_0002444
1132 Ga0501083_0007136
1133 Ga0501083_0203422
1134 Ga0501083_0716474
1135 Ga0501035_0001594
1136 Ga0501035_0008865
1137 Ga0501044_0011094
1138 Ga0501044_0046006
1139 Ga0501044_0046555
1140 Ga0501044_0303792
1141 Ga0501044_0629730
1142 Ga0501044_0635396
1143 Ga0501045_0002001
1144 Ga0501045_0010241
1145 Ga0501045_0022017
1146 Ga0501045_0076746
1147 Ga0501045_0103954
1148 nmdc:mga05p37_957297_c1
1149 nmdc:mga0rr50_192196_c1
1150 nmdc:mga0a205_222114_c1
1151 Ga0495619_0011100
1152 Ga0495619_0180417
1153 Ga0495619_0353152
1154 Ga0501084_0002144
1155 Ga0501084_0028831
1156 Ga0501084_0052612
1157 Ga0501084_0087887
1158 Ga0501084_0166349
1159 Ga0501084_0463250
1160 Ga0501084_0624170
1161 Ga0590071_020327
1162 Ga0501082_0000690
1163 Ga0501082_0138849
1164 Ga0501082_0199658
1165 Ga0466962_0006696
1166 Ga0530510_0000474
1167 Ga0530510_0003924
1168 Ga0530510_0005435
1169 Ga0530510_0009390
1170 Ga0530510_0020115
1171 Ga0530510_0133766
1172 Ga0530510_0222248

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

37

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_F moac in complex with cpmp crystallized in space group p212121 0.9685 27 143
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.9659 13 146
1eks-assembly1.cif.gz_A asp128ala variant of moac protein from e. coli 0.963 17 146
4pya-assembly1.cif.gz_A moac k51a in complex with 3',8-ch2gtp 0.9536 26 144
4pyd-assembly1.cif.gz_B moac in complex with cpmp crystallized in space group p212121 0.9441 9 146
ID Description Score Start End Superfamily
4pydF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9685 27 143 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9659 13 146 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9362 17 144 3.30.70.640
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9327 13 145 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9308 5 145 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A1V5JNP1-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9653 17 151 GO:0006777
GO:0061799
AF-A0A7C1Z3Q1-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9629 17 151 GO:0006777
GO:0061798
GO:0061799
AF-A0A2V7N548-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9617 17 151 GO:0006777
GO:0061798
GO:0061799
AF-A0A838Q804-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9612 26 149 GO:0006777
GO:0016829
AF-A0A7C6UF69-F1-model_v4 Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C) 0.9606 3 146 GO:0005525
GO:0006777
GO:0061799

Map