F466557

General Info

Members Datasets Scaffolds Average Seq Length
586 381 1172 203

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10032694|Ga0157380_100326944
Length 236
Sequence VRGAGRFGGAPSALRRAMMAGRSCVRSSGDLPMTLSFLLTSLIVVISPGTGVLYTLAVALTQGAKAGVAAAFGCTLGIVPHMTAAMLGLAAVLHTSALAFAALKWCGVLYLLYMAWQALRETGALAIDPRPAPGRSSQRVIVTGFLINILNPKLSIFFLAFLPQFIAVDESSPLARMLELSAAFMAMTFAVFVVYGLFAAGVRDRIITRPRVMTWLRRSFAAGFAALGARLAFSER

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
187 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
323 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
324 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
325 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
326 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
329 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
330 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
334 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
335 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
336 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
337 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
338 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
339 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
340 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
341 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
342 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
343 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
344 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
345 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
346 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
347 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
348 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
349 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
350 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
351 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
352 2904699407
353 2906610324
354 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
355 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
356 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
357 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
358 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
359 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
360 2922425934
361 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
362 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
363 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
364 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
365 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
366 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
367 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
368 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
369 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
370 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
371 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
372 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
373 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
374 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
375 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
376 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
377 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
378 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
379 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
380 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
381 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 5.63
Rhizoplane 4.78
Rhizosphere 72.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10032694 3300014326 Bacteria 4004
2 RicEn_C6373 2010549000 Bacteria 1154
3 JGI25406J46586_10080307 3300003203 Bacteria 1002
4 JGI25165J46597_1010393 3300003214 Bacteria 1359
5 JGI25160J50197_1005573 3300003354 Bacteria 5218
6 Ga0055539_1002738 3300003752 Bacteria 2600
7 Ga0065704_10076531 3300005289 Bacteria 5086
8 Ga0065712_10018854 3300005290 Bacteria 1956
9 Ga0070670_100341806 3300005331 Bacteria 1314
10 Ga0070670_100407162 3300005331 Bacteria 1201
11 Ga0068869_100047574 3300005334 Bacteria 3098
12 Ga0070680_100032205 3300005336 Bacteria 4219
13 Ga0068868_100060981 3300005338 Bacteria 2987
14 Ga0068868_100129188 3300005338 Bacteria 2066
15 Ga0068868_100149790 3300005338 Bacteria 1921
16 Ga0070689_100695163 3300005340 Bacteria 888
17 Ga0070691_10043426 3300005341 Bacteria 2129
18 Ga0070692_10283484 3300005345 Bacteria 1005
19 Ga0070668_100066148 3300005347 Bacteria 2804
20 Ga0070668_100067130 3300005347 Bacteria 2785
21 Ga0070668_100385489 3300005347 Bacteria 1194
22 Ga0070668_100593744 3300005347 Bacteria 968
23 Ga0070669_100608925 3300005353 Bacteria 916
24 Ga0070671_100464528 3300005355 Bacteria 1086
25 Ga0070674_100623781 3300005356 Bacteria 914
26 Ga0070673_100586562 3300005364 Bacteria 1015
27 Ga0070667_100113596 3300005367 Bacteria 2351
28 Ga0070667_100476288 3300005367 Bacteria 1143
29 Ga0070700_100177753 3300005441 Bacteria 1479
30 Ga0070700_100206090 3300005441 Bacteria 1384
31 Ga0070708_100156225 3300005445 Bacteria 2124
32 Ga0070663_100078755 3300005455 Bacteria 2416
33 Ga0070663_100080848 3300005455 Bacteria 2387
34 Ga0070678_100133915 3300005456 Bacteria 1973
35 Ga0070678_100190139 3300005456 Bacteria 1687
36 Ga0070678_100288441 3300005456 Bacteria 1390
37 Ga0070678_100457763 3300005456 Bacteria 1118
38 Ga0070678_100574618 3300005456 Bacteria 1003
39 Ga0070681_10110134 3300005458 Bacteria 2693
40 Ga0070681_10312601 3300005458 Bacteria 1480
41 Ga0070706_100253523 3300005467 Bacteria 1643
42 Ga0070706_100855719 3300005467 Bacteria 841
43 Ga0070698_100283941 3300005471 Bacteria 1586
44 Ga0070679_100074940 3300005530 Bacteria 3374
45 Ga0070672_100215921 3300005543 Bacteria 1608
46 Ga0070686_100131458 3300005544 Bacteria 1731
47 Ga0070695_100023395 3300005545 Bacteria 3796
48 Ga0070695_100727567 3300005545 Bacteria 790
49 Ga0070693_100551952 3300005547 Bacteria 825
50 Ga0070665_100013952 3300005548 Bacteria 8082
51 Ga0070665_100078296 3300005548 Bacteria 3312
52 Ga0070704_100049828 3300005549 Bacteria 2940
53 Ga0068855_100084929 3300005563 Bacteria 3663
54 Ga0068855_100152078 3300005563 Bacteria 2631
55 Ga0068855_100889522 3300005563 Bacteria 941
56 Ga0070664_100253666 3300005564 Bacteria 1582
57 Ga0070664_100535940 3300005564 Bacteria 1081
58 Ga0068854_100113615 3300005578 Bacteria 2046
59 Ga0068854_100250666 3300005578 Bacteria 1413
60 Ga0068856_100053265 3300005614 Bacteria 3989
61 Ga0068856_100647468 3300005614 Bacteria 1077
62 Ga0070702_100041108 3300005615 Bacteria 2591
63 Ga0070702_100284993 3300005615 Bacteria 1136
64 Ga0068852_100298727 3300005616 Bacteria 1558
65 Ga0068852_100369520 3300005616 Bacteria 1405
66 Ga0068859_100150756 3300005617 Bacteria 2401
67 Ga0068859_100173757 3300005617 Bacteria 2236
68 Ga0068866_10024229 3300005718 Bacteria 2834
69 Ga0068861_100060169 3300005719 Bacteria 2910
70 Ga0068861_100115553 3300005719 Bacteria 2156
71 Ga0068861_100450232 3300005719 Bacteria 1153
72 Ga0068861_100462016 3300005719 Bacteria 1140
73 Ga0068861_100965993 3300005719 Bacteria 811
74 Ga0068851_10260094 3300005834 Bacteria 987
75 Ga0068851_10341729 3300005834 Bacteria 869
76 Ga0068870_10106507 3300005840 Bacteria 1593
77 Ga0068858_100085112 3300005842 Bacteria 2941
78 Ga0068858_100137326 3300005842 Bacteria 2295
79 Ga0068858_100420983 3300005842 Bacteria 1284
80 Ga0068860_100292777 3300005843 Bacteria 1593
81 Ga0068860_100437421 3300005843 Bacteria 1299
82 Ga0068860_100711469 3300005843 Bacteria 1014
83 Ga0068862_100174827 3300005844 Bacteria 1924
84 Ga0068862_100484304 3300005844 Bacteria 1171
85 Ga0068862_100644253 3300005844 Bacteria 1021
86 Ga0081455_10007620 3300005937 Bacteria 11376
87 Ga0081540_1021896 3300005983 Bacteria 3787
88 Ga0081540_1050162 3300005983 Bacteria 2075
89 Ga0081540_1051997 3300005983 Bacteria 2021
90 Ga0081539_10017617 3300005985 Bacteria 5004
91 Ga0075365_10131202 3300006038 Bacteria 1734
92 Ga0075365_10777756 3300006038 Bacteria 676
93 Ga0075368_10028731 3300006042 Bacteria 2149
94 Ga0075363_100014531 3300006048 Bacteria 3850
95 Ga0075363_100059006 3300006048 Bacteria 2062
96 Ga0075363_100181566 3300006048 Bacteria 1198
97 Ga0075364_10098013 3300006051 Bacteria 1950
98 Ga0075364_10213592 3300006051 Bacteria 1308
99 Ga0075432_10084495 3300006058 Bacteria 1155
100 Ga0070712_100105685 3300006175 Bacteria 2091
101 Ga0075362_10036953 3300006177 Bacteria 2139
102 Ga0075362_10130115 3300006177 Bacteria 1196
103 Ga0075367_10029907 3300006178 Bacteria 3119
104 Ga0075367_10334730 3300006178 Bacteria 954
105 Ga0075369_10056476 3300006186 Bacteria 1706
106 Ga0075369_10066103 3300006186 Bacteria 1586
107 Ga0075366_10131817 3300006195 Bacteria 1508
108 Ga0075366_10296136 3300006195 Bacteria 989
109 Ga0075366_10497344 3300006195 Bacteria 754
110 Ga0097621_100463788 3300006237 Bacteria 1143
111 Ga0075370_10005204 3300006353 Bacteria 6434
112 Ga0075370_10023238 3300006353 Bacteria 3413
113 Ga0075370_10314418 3300006353 Bacteria 932
114 Ga0068871_100057607 3300006358 Bacteria 3161
115 Ga0068871_100455257 3300006358 Bacteria 1148
116 Ga0075428_100048939 3300006844 Bacteria 4638
117 Ga0075428_100080918 3300006844 Bacteria 3545
118 Ga0075428_100119714 3300006844 Bacteria 2866
119 Ga0075434_100085245 3300006871 Bacteria 3158
120 Ga0075434_100811734 3300006871 Bacteria 951
121 Ga0075429_100235833 3300006880 Bacteria 1602
122 Ga0068865_100364269 3300006881 Bacteria 1175
123 Ga0097620_100150751 3300006931 Bacteria 2401
124 Ga0097620_100173751 3300006931 Bacteria 2236
125 Ga0075435_100692424 3300007076 Bacteria 886
126 Ga0105250_10021291 3300009092 Bacteria 2618
127 Ga0105240_10136192 3300009093 Bacteria 2941
128 Ga0111539_10000633 3300009094 Bacteria 45453
129 Ga0111539_10061096 3300009094 Bacteria 4464
130 Ga0111539_10216076 3300009094 Bacteria 2233
131 Ga0111539_10300842 3300009094 Bacteria 1867
132 Ga0105247_10341243 3300009101 Bacteria 1051
133 Ga0114129_10195311 3300009147 Bacteria 2745
134 Ga0114129_10677638 3300009147 Bacteria 1328
135 Ga0114129_10730992 3300009147 Bacteria 1269
136 Ga0105243_10312159 3300009148 Bacteria 1429
137 Ga0105243_10943798 3300009148 Bacteria 861
138 Ga0105241_10055891 3300009174 Bacteria 3025
139 Ga0105242_10141532 3300009176 Bacteria 2088
140 Ga0105242_10292125 3300009176 Bacteria 1485
141 Ga0105248_10029798 3300009177 Bacteria 6090
142 Ga0105248_10128765 3300009177 Bacteria 2856
143 Ga0105248_10300483 3300009177 Bacteria 1807
144 Ga0105248_10710992 3300009177 Bacteria 1134
145 Ga0105238_10304971 3300009551 Bacteria 1576
146 Ga0105249_10078868 3300009553 Bacteria 3056
147 Ga0105246_10192893 3300011119 Bacteria 1578
148 Ga0157370_10055170 3300013104 Bacteria 3786
149 Ga0157370_10093045 3300013104 Bacteria 2829
150 Ga0157374_10901918 3300013296 Bacteria 902
151 Ga0163162_10635721 3300013306 Bacteria 1192
152 Ga0157375_10048776 3300013308 Bacteria 4144
153 Ga0157375_10793860 3300013308 Bacteria 1096
154 Ga0157375_12203961 3300013308 Bacteria 656
155 Ga0163163_10166289 3300014325 Bacteria 2252
156 Ga0163163_10169881 3300014325 Bacteria 2227
157 Ga0163163_10944606 3300014325 Bacteria 926
158 Ga0157380_10317218 3300014326 Bacteria 1443
159 Ga0157380_10912089 3300014326 Bacteria 905
160 Ga0157377_10113475 3300014745 Bacteria 1632
161 Ga0157379_10135007 3300014968 Bacteria 2222
162 Ga0157376_10393562 3300014969 Bacteria 1338
163 Ga0163161_10120350 3300017792 Bacteria 1972
164 Ga0163161_10220999 3300017792 Bacteria 1467
165 Ga0213876_10032461 3300021384 Bacteria 2754
166 Ga0209233_1004822 3300025261 Bacteria 4541
167 Ga0209455_1015746 3300025272 Bacteria 1648
168 Ga0209455_1030591 3300025272 Bacteria 915
169 Ga0209758_1030578 3300025297 Bacteria 2228
170 Ga0207697_10016454 3300025315 Bacteria 3046
171 Ga0207656_10143457 3300025321 Bacteria 1127
172 Ga0207696_1013907 3300025711 Bacteria 2779
173 Ga0207653_10010891 3300025885 Bacteria 2837
174 Ga0207642_10229504 3300025899 Bacteria 1042
175 Ga0207710_10014804 3300025900 Bacteria 3294
176 Ga0207688_10024852 3300025901 Bacteria 3286
177 Ga0207688_10119817 3300025901 Bacteria 1535
178 Ga0207688_10196564 3300025901 Bacteria 1208
179 Ga0207680_10296379 3300025903 Bacteria 1126
180 Ga0207643_10033798 3300025908 Bacteria 2862
181 Ga0207705_10108089 3300025909 Bacteria 2053
182 Ga0207654_10053697 3300025911 Bacteria 2327
183 Ga0207707_10185324 3300025912 Bacteria 1816
184 Ga0207671_10081478 3300025914 Bacteria 2427
185 Ga0207671_10211913 3300025914 Bacteria 1516
186 Ga0207693_10065324 3300025915 Bacteria 2850
187 Ga0207660_10454326 3300025917 Bacteria 1036
188 Ga0207662_10078058 3300025918 Bacteria 2015
189 Ga0207657_10069593 3300025919 Bacteria 2985
190 Ga0207649_10077157 3300025920 Bacteria 2146
191 Ga0207652_10172602 3300025921 Bacteria 1941
192 Ga0207652_10270149 3300025921 Bacteria 1534
193 Ga0207694_10294752 3300025924 Bacteria 1334
194 Ga0207650_10072224 3300025925 Bacteria 2597
195 Ga0207687_10067640 3300025927 Bacteria 2542
196 Ga0207644_10106767 3300025931 Bacteria 2111
197 Ga0207644_10416409 3300025931 Bacteria 1100
198 Ga0207706_10124263 3300025933 Bacteria 2270
199 Ga0207669_10785892 3300025937 Bacteria 788
200 Ga0207691_10330396 3300025940 Bacteria 1306
201 Ga0207691_10558517 3300025940 Bacteria 970
202 Ga0207691_10566332 3300025940 Bacteria 963
203 Ga0207711_10052801 3300025941 Bacteria 3484
204 Ga0207711_10657313 3300025941 Bacteria 978
205 Ga0207689_10166135 3300025942 Bacteria 1818
206 Ga0207667_10184722 3300025949 Bacteria 2140
207 Ga0207667_10615425 3300025949 Bacteria 1094
208 Ga0207651_10152064 3300025960 Bacteria 1803
209 Ga0207651_10310921 3300025960 Bacteria 1314
210 Ga0207668_10042229 3300025972 Bacteria 3087
211 Ga0207668_10122931 3300025972 Bacteria 1968
212 Ga0207668_10258252 3300025972 Bacteria 1418
213 Ga0207668_11336544 3300025972 Bacteria 646
214 Ga0207658_10547507 3300025986 Bacteria 1035
215 Ga0207677_10071749 3300026023 Bacteria 2445
216 Ga0207677_10121290 3300026023 Bacteria 1967
217 Ga0207703_10133110 3300026035 Bacteria 2149
218 Ga0207703_10279208 3300026035 Bacteria 1516
219 Ga0207678_10090097 3300026067 Bacteria 2622
220 Ga0207678_10100354 3300026067 Bacteria 2473
221 Ga0207678_10192694 3300026067 Bacteria 1742
222 Ga0207678_10221616 3300026067 Bacteria 1619
223 Ga0207708_10081755 3300026075 Bacteria 2483
224 Ga0207708_10123001 3300026075 Bacteria 2023
225 Ga0207702_10180603 3300026078 Bacteria 1943
226 Ga0207702_10434345 3300026078 Bacteria 1271
227 Ga0207648_10024253 3300026089 Bacteria 5417
228 Ga0207648_10238566 3300026089 Bacteria 1618
229 Ga0207676_11064759 3300026095 Bacteria 798
230 Ga0207674_10127924 3300026116 Bacteria 2505
231 Ga0207675_100058504 3300026118 Bacteria 3597
232 Ga0207675_100125245 3300026118 Bacteria 2434
233 Ga0207675_100246402 3300026118 Bacteria 1728
234 Ga0207675_100618288 3300026118 Bacteria 1088
235 Ga0207675_100897398 3300026118 Bacteria 903
236 Ga0207683_10081064 3300026121 Bacteria 2880
237 Ga0207683_10096182 3300026121 Bacteria 2641
238 Ga0207683_10220146 3300026121 Bacteria 1729
239 Ga0207683_10266112 3300026121 Bacteria 1566
240 Ga0207698_10280621 3300026142 Bacteria 1541
241 Ga0207698_10287605 3300026142 Bacteria 1524
242 Ga0207698_10331404 3300026142 Bacteria 1430
243 Ga0207428_10003997 3300027907 Bacteria 14155
244 Ga0207428_10014069 3300027907 Bacteria 6968
245 Ga0207428_10062538 3300027907 Bacteria 2943
246 Ga0268266_10001169 3300028379 Bacteria 32459
247 Ga0268266_10004436 3300028379 Bacteria 13434
248 Ga0268266_10028572 3300028379 Bacteria 4739
249 Ga0268266_10297632 3300028379 Bacteria 1504
250 Ga0268265_10110227 3300028380 Bacteria 2245
251 Ga0268264_10064030 3300028381 Bacteria 3093
252 Ga0268264_10077509 3300028381 Bacteria 2831
253 Ga0268264_10481447 3300028381 Bacteria 1207
254 Ga0268264_10877890 3300028381 Bacteria 899
255 Ga0268264_11016664 3300028381 Bacteria 836
256 Ga0307517_10000196 3300028786 Bacteria 102384
257 Ga0307517_10126030 3300028786 Bacteria 1868
258 Ga0307515_10022977 3300028794 Bacteria 10964
259 Ga0307512_10231568 3300030522 Bacteria 949
260 Ga0265328_10053303 3300031239 Bacteria 1484
261 Ga0307513_10105242 3300031456 Bacteria 2832
262 Ga0307513_10213007 3300031456 Bacteria 1761
263 Ga0307513_10705965 3300031456 Bacteria 714
264 Ga0307509_10059839 3300031507 Bacteria 4029
265 Ga0307508_10078747 3300031616 Bacteria 2876
266 Ga0307516_10008341 3300031730 Bacteria 11744
267 Ga0307516_10481382 3300031730 Bacteria 896
268 Ga0307405_10219117 3300031731 Bacteria 1395
269 Ga0307413_10057425 3300031824 Bacteria 2380
270 Ga0307413_10187670 3300031824 Bacteria 1481
271 Ga0307406_10725493 3300031901 Bacteria 832
272 Ga0307412_10480555 3300031911 Bacteria 1030
273 Ga0307412_11098350 3300031911 Bacteria 708
274 Ga0307416_100206511 3300032002 Bacteria 1869
275 Ga0307416_100237457 3300032002 Bacteria 1763
276 Ga0307416_100749588 3300032002 Bacteria 1069
277 Ga0307414_10489859 3300032004 Bacteria 1086
278 Ga0307411_10243657 3300032005 Bacteria 1409
279 Ga0307411_10428046 3300032005 Bacteria 1101
280 Ga0307411_10708965 3300032005 Bacteria 877
281 Ga0307415_100392347 3300032126 Bacteria 1182
282 Ga0307510_10105802 3300033180 Bacteria 2580
283 Ga0307510_10110015 3300033180 Bacteria 2502
284 Ga0315911_1000012 3300033442 Bacteria 248988
285 Ga0373929_0056733 3300035085 Bacteria 908
286 Ga0373934_0022224 3300035086 Bacteria 2446
287 Ga0373934_0079412 3300035086 Bacteria 1317
288 Ga0373944_0107480 3300035089 Bacteria 949
289 Ga0373936_0008600 3300035113 Bacteria 3844
290 Ga0373941_0078371 3300035115 Bacteria 1111
291 Ga0373945_0044150 3300035116 Bacteria 1620
292 Ga0373954_0129098 3300035118 Bacteria 1230
293 Ga0373943_0001715 3300035170 Bacteria 9938
294 Ga0373946_0008900 3300035171 Bacteria 3690
295 Ga0373946_0202134 3300035171 Bacteria 952
296 Ga0373955_0026628 3300035172 Bacteria 2981
297 Ga0373931_0007107 3300035691 Bacteria 5263
298 Ga0373935_0002990 3300035692 Bacteria 9750
299 Ga0373927_0001230 3300035695 Bacteria 19452
300 Ga0373927_0161951 3300035695 Bacteria 1466
301 Ga0373933_0027010 3300035724 Bacteria 3302
302 Ga0373947_0001223 3300035725 Bacteria 15824
303 Ga0316582_0205982 3300036647 Bacteria 1343
304 Ga0373925_0002121 3300037068 Bacteria 16252
305 Ga0395899_0242736 3300037312 Bacteria 1239
306 Ga0395900_0411345 3300037418 Bacteria 1315
307 Ga0395898_0070484 3300037466 Bacteria 3379
308 Ga0395898_0086003 3300037466 Bacteria 3031
309 Ga0436364_1462129 3300037853 Bacteria 853
310 Ga0436365_1721552 3300039437 Bacteria 2260
311 Ga0436365_1752216 3300039437 Bacteria 2867
312 Ga0436363_1284934 3300039450 Bacteria 1245
313 Ga0439465_0023767 3300041413 Bacteria 1930
314 Ga0451793_1476757 3300041452 Bacteria 820
315 Ga0451845_0221124 3300041501 Bacteria 859
316 Ga0439449_0000954 3300042007 Bacteria 11332
317 Ga0466965_0074668 3300044683 Bacteria 1709
318 Ga0466961_0077841 3300044693 Bacteria 2100
319 Ga0466960_0002751 3300044901 Bacteria 6656
320 Ga0466959_0305402 3300045049 Bacteria 1089
321 Ga0451576_0266571 3300045051 Bacteria 1790
322 Ga0466967_0286087 3300045976 Bacteria 1583
323 Ga0495592_0046659 3300046454 Bacteria 3229
324 Ga0495603_0000667 3300046455 Bacteria 19417
325 Ga0495603_0055101 3300046455 Bacteria 2356
326 Ga0495603_0055135 3300046455 Bacteria 2355
327 Ga0495603_0235026 3300046455 Bacteria 1056
328 Ga0495591_044894 3300046458 Bacteria 1235
329 Ga0495629_0000283 3300046459 Bacteria 43929
330 Ga0495629_0316029 3300046459 Bacteria 1068
331 Ga0495638_0064033 3300046460 Bacteria 2265
332 Ga0495638_0070790 3300046460 Bacteria 2134
333 Ga0495638_0368462 3300046460 Bacteria 754
334 Ga0495651_0594109 3300046462 Bacteria 699
335 Ga0495653_0042720 3300046463 Bacteria 3528
336 Ga0495653_0058878 3300046463 Bacteria 2919
337 Ga0495653_0297548 3300046463 Bacteria 1053
338 Ga0495580_0002411 3300046472 Bacteria 16335
339 Ga0495580_0174305 3300046472 Bacteria 1486
340 Ga0495582_0000555 3300046473 Bacteria 20612
341 Ga0495605_0029956 3300046474 Bacteria 2795
342 Ga0495639_0000423 3300046475 Bacteria 20176
343 Ga0495639_0058072 3300046475 Bacteria 1769
344 Ga0495662_0009557 3300046476 Bacteria 4756
345 Ga0495664_0028448 3300046477 Bacteria 3264
346 Ga0495585_0101363 3300046492 Bacteria 1539
347 Ga0495585_0325162 3300046492 Bacteria 751
348 Ga0495594_0001986 3300046499 Bacteria 10660
349 Ga0495594_0090781 3300046499 Bacteria 1712
350 Ga0495607_0143095 3300046501 Bacteria 1232
351 Ga0495607_0159838 3300046501 Bacteria 1146
352 Ga0495583_0202148 3300046506 Bacteria 807
353 Ga0495606_0158639 3300046507 Bacteria 1322
354 Ga0495618_0079247 3300046514 Bacteria 2095
355 Ga0495620_0242831 3300046515 Bacteria 687
356 Ga0495628_0028687 3300046516 Bacteria 4520
357 Ga0495628_0290309 3300046516 Bacteria 1212
358 Ga0495630_0016818 3300046517 Bacteria 5350
359 Ga0495631_0013532 3300046518 Bacteria 3959
360 Ga0495631_0064388 3300046518 Bacteria 1587
361 Ga0495632_0153804 3300046519 Bacteria 1062
362 Ga0495648_0110827 3300046524 Bacteria 1494
363 Ga0495648_0184160 3300046524 Bacteria 1059
364 Ga0495648_0229014 3300046524 Bacteria 911
365 Ga0495666_0269344 3300046526 Bacteria 773
366 Ga0495642_0231537 3300046528 Bacteria 807
367 Ga0495652_0020504 3300046529 Bacteria 5877
368 Ga0495665_0001096 3300046531 Bacteria 14317
369 Ga0495665_0085120 3300046531 Bacteria 1662
370 Ga0495640_0010928 3300046533 Bacteria 6997
371 Ga0495586_0052485 3300046535 Bacteria 2208
372 Ga0495598_0122150 3300046537 Bacteria 884
373 Ga0495621_0020103 3300046539 Bacteria 2187
374 Ga0495622_0003133 3300046557 Bacteria 7832
375 Ga0495656_0008823 3300046615 Bacteria 3614
376 Ga0495668_0107562 3300046616 Bacteria 1525
377 Ga0495668_0223703 3300046616 Bacteria 1030
378 Ga0495634_0004577 3300046642 Bacteria 10802
379 Ga0495611_0044250 3300046648 Bacteria 1991
380 Ga0495625_0044897 3300046660 Bacteria 3197
381 Ga0495635_0002530 3300046663 Bacteria 12506
382 Ga0495635_0527166 3300046663 Bacteria 776
383 Ga0495659_0045810 3300046664 Bacteria 1577
384 Ga0495659_0131967 3300046664 Bacteria 991
385 Ga0495588_0078413 3300046674 Bacteria 1723
386 Ga0495588_0130305 3300046674 Bacteria 1327
387 Ga0495623_0217364 3300046679 Bacteria 1091
388 Ga0495647_0001720 3300046681 Bacteria 6784
389 Ga0495647_0051509 3300046681 Bacteria 1600
390 Ga0495658_0002218 3300046683 Bacteria 9819
391 Ga0495669_0012048 3300046684 Bacteria 3676
392 Ga0495669_0022466 3300046684 Bacteria 2740
393 Ga0495613_0001910 3300046689 Bacteria 15801
394 Ga0495613_0102715 3300046689 Bacteria 2064
395 Ga0495624_0001800 3300046690 Bacteria 16366
396 Ga0495671_0100850 3300046692 Bacteria 1411
397 Ga0495649_0345900 3300046694 Bacteria 752
398 Ga0495581_0000346 3300047315 Bacteria 23081
399 Ga0495581_0031159 3300047315 Bacteria 3090
400 Ga0495581_0184121 3300047315 Bacteria 1222
401 Ga0495674_0018654 3300047319 Bacteria 6455
402 Ga0495674_0197951 3300047319 Bacteria 1668
403 Ga0495672_0065171 3300047320 Bacteria 2083
404 Ga0495676_0012424 3300047321 Bacteria 7670
405 Ga0495680_0067137 3300047322 Bacteria 2742
406 Ga0495677_0051098 3300047445 Bacteria 1522
407 Ga0495685_130392 3300047447 Bacteria 822
408 Ga0495684_0022580 3300047471 Bacteria 4838
409 Ga0495684_0030766 3300047471 Bacteria 4121
410 Ga0495686_0061651 3300047472 Bacteria 2329
411 Ga0495593_0001297 3300047673 Bacteria 14662
412 Ga0495593_0076408 3300047673 Bacteria 1736
413 Ga0495602_0289316 3300048088 Bacteria 1203
414 Ga0496100_0514991 3300048903 Bacteria 923
415 Ga0496102_0052661 3300048905 Bacteria 3709
416 Ga0496103_0346102 3300048906 Bacteria 956
417 Ga0496104_0083343 3300048907 Bacteria 3049
418 Ga0496104_0212066 3300048907 Bacteria 1848
419 Ga0496104_0329004 3300048907 Bacteria 1441
420 Ga0496105_0174891 3300048908 Bacteria 1759
421 Ga0496106_0213857 3300048909 Bacteria 1536
422 Ga0496106_0562863 3300048909 Bacteria 914
423 Ga0496107_0019279 3300048910 Bacteria 4813
424 Ga0496108_0049556 3300048911 Bacteria 3513
425 Ga0496108_0420981 3300048911 Bacteria 1166
426 Ga0496109_0049457 3300048912 Bacteria 3827
427 Ga0496109_0116700 3300048912 Bacteria 2484
428 Ga0496109_0127317 3300048912 Bacteria 2375
429 Ga0496110_0033183 3300048913 Bacteria 4463
430 Ga0496110_0526496 3300048913 Bacteria 1075
431 Ga0496110_0735885 3300048913 Bacteria 889
432 Ga0496111_0079930 3300048914 Bacteria 2385
433 Ga0496112_0084110 3300048915 Bacteria 3147
434 Ga0496112_0103978 3300048915 Bacteria 2810
435 Ga0496113_0122819 3300048916 Bacteria 2032
436 Ga0496114_0186767 3300048917 Bacteria 1812
437 Ga0496114_0208530 3300048917 Bacteria 1713
438 Ga0496114_0438242 3300048917 Bacteria 1157
439 Ga0496115_0032088 3300048918 Bacteria 4143
440 Ga0496115_0371379 3300048918 Bacteria 1164
441 Ga0496117_0369797 3300048920 Bacteria 734
442 Ga0496118_0289971 3300048921 Bacteria 905
443 Ga0496118_0377964 3300048921 Bacteria 744
444 Ga0496119_0312850 3300048922 Bacteria 771
445 Ga0496121_0049602 3300048924 Bacteria 3557
446 Ga0496121_0050081 3300048924 Bacteria 3533
447 Ga0496121_0094580 3300048924 Bacteria 2324
448 Ga0496124_0334539 3300048927 Bacteria 1078
449 Ga0496125_0053776 3300048928 Bacteria 3297
450 Ga0496126_0006987 3300048929 Bacteria 12473
451 Ga0496126_0060445 3300048929 Bacteria 3407
452 Ga0496126_0101333 3300048929 Bacteria 2519
453 Ga0501031_0009340 3300049568 Bacteria 6375
454 Ga0501031_0023694 3300049568 Bacteria 4001
455 Ga0501031_0460455 3300049568 Bacteria 821
456 Ga0501032_0002147 3300049569 Bacteria 15526
457 Ga0501032_0173931 3300049569 Bacteria 1411
458 Ga0501033_0000060 3300049570 Bacteria 103159
459 Ga0501034_0000117 3300049571 Bacteria 144865
460 Ga0501036_0000188 3300049572 Bacteria 41101
461 Ga0501037_0000402 3300049573 Bacteria 36091
462 Ga0501038_0000540 3300049574 Bacteria 33178
463 Ga0501039_0000431 3300049575 Bacteria 30281
464 Ga0501042_0014849 3300049578 Bacteria 5321
465 Ga0501043_0002749 3300049579 Bacteria 14715
466 Ga0501043_0757639 3300049579 Bacteria 705
467 Ga0501046_0001915 3300049580 Bacteria 19766
468 Ga0501046_0214954 3300049580 Bacteria 1426
469 Ga0501047_0000246 3300049581 Bacteria 64361
470 Ga0501048_0000878 3300049582 Bacteria 22207
471 Ga0501048_0344371 3300049582 Bacteria 1063
472 Ga0501067_0000320 3300049583 Bacteria 26233
473 Ga0501068_0018821 3300049584 Bacteria 4001
474 Ga0501069_0005497 3300049585 Bacteria 6595
475 Ga0501070_0000779 3300049586 Bacteria 28961
476 Ga0501070_0244396 3300049586 Bacteria 1469
477 Ga0501070_0568221 3300049586 Bacteria 906
478 Ga0501071_0172407 3300049587 Bacteria 1620
479 Ga0501071_0749900 3300049587 Bacteria 752
480 Ga0501072_0004819 3300049588 Bacteria 10273
481 Ga0501073_0000093 3300049589 Bacteria 56882
482 Ga0501074_0000127 3300049590 Bacteria 38795
483 Ga0501077_0477703 3300049593 Bacteria 799
484 Ga0501235_072286 3300049669 Bacteria 817
485 Ga0501079_0001174 3300049741 Bacteria 18341
486 Ga0501080_0004375 3300049742 Bacteria 12547
487 Ga0501080_0070794 3300049742 Bacteria 3244
488 Ga0501083_0009493 3300049744 Bacteria 6872
489 Ga0501083_0450341 3300049744 Bacteria 838
490 Ga0501282_006553 3300049778 Bacteria 1244
491 Ga0501044_0005195 3300049823 Bacteria 14487
492 Ga0501044_0341636 3300049823 Bacteria 1418
493 Ga0501044_0462291 3300049823 Bacteria 1174
494 nmdc:mga03683_23171_c1 3300050489 Bacteria 2415
495 nmdc:mga03683_389047_c1 3300050489 Bacteria 665
496 nmdc:mga03n38_20957_c1 3300050490 Bacteria 2623
497 nmdc:mga03n38_6892_c1 3300050490 Bacteria 3987
498 nmdc:mga00v17_149396_c1 3300050491 Bacteria 1501
499 nmdc:mga00v17_160199_c1 3300050491 Bacteria 1448
500 nmdc:mga00v17_217749_c1 3300050491 Bacteria 1236
501 nmdc:mga00v17_61141_c1 3300050491 Bacteria 2315
502 nmdc:mga00v17_70683_c1 3300050491 Bacteria 2162
503 nmdc:mga0yw44_105286_c1 3300050492 Bacteria 1802
504 nmdc:mga0yw44_158075_c1 3300050492 Bacteria 1482
505 nmdc:mga0yw44_95714_c1 3300050492 Bacteria 1884
506 nmdc:mga0k408_215256_c1 3300050493 Bacteria 1147
507 nmdc:mga0k408_366395_c1 3300050493 Bacteria 859
508 nmdc:mga06z11_2511_c1 3300050494 Bacteria 7013
509 nmdc:mga06z11_26600_c1 3300050494 Bacteria 2755
510 nmdc:mga07m45_2468_c1 3300050496 Bacteria 8671
511 nmdc:mga05p37_350912_c1 3300050507 Bacteria 1737
512 nmdc:mga05p37_394055_c1 3300050507 Bacteria 1619
513 nmdc:mga05p37_97072_c2 3300050507 Bacteria 1333
514 nmdc:mga09592_83693_c1 3300050508 Bacteria 2719
515 nmdc:mga08y16_19662_c1 3300050511 Bacteria 7121
516 nmdc:mga08y16_91218_c1 3300050511 Bacteria 3176
517 nmdc:mga0n895_3005_c1 3300050512 Bacteria 13399
518 nmdc:mga0n895_59955_c1 3300050512 Bacteria 3754
519 nmdc:mga0rr50_470847_c1 3300050513 Bacteria 1066
520 nmdc:mga0sz30_195133_c1 3300050516 Bacteria 899
521 nmdc:mga0sz30_55574_c2 3300050516 Bacteria 1339
522 Ga0495601_0015350 3300053077 Bacteria 4630
523 Ga0495601_0107518 3300053077 Bacteria 1805
524 Ga0495655_0032287 3300053083 Bacteria 1280
525 Ga0495595_0003385 3300053084 Bacteria 6333
526 Ga0500651_0142140 3300053093 Bacteria 1446
527 Ga0500555_024354 3300053103 Bacteria 1735
528 Ga0500572_001516 3300053111 Bacteria 6243
529 Ga0500594_0177657 3300053118 Bacteria 694
530 Ga0500595_003114 3300053119 Bacteria 7852
531 Ga0500622_0308841 3300053156 Bacteria 671
532 Ga0500633_0238065 3300053160 Bacteria 678
533 Ga0500638_048928 3300053162 Bacteria 2046
534 Ga0500637_0182354 3300053178 Bacteria 1202
535 Ga0501084_0028191 3300054114 Bacteria 4692
536 Ga0501084_0476951 3300054114 Bacteria 1054
537 Ga0501082_0004139 3300060353 Bacteria 12672
538 2513655731 2513237096 Bacteria 8722461
539 2513862781 2513237137 Bacteria 9558895
540 2513916191 2513237145 Bacteria 8979722
541 2517890202 2517572143 Bacteria 9484767
542 2524438240 2524023205 Bacteria 8918781
543 2723848677 2721755755 Bacteria 8322773
544 2745077330 2744054633 Bacteria 8678936
545 2793067822 2791355197 Bacteria 8420563
546 2867307855 2867302475 Bacteria 7087181
547 2867315231 2867312974 Bacteria 7058875
548 2867319772 2867319477 Bacteria 7069771
549 2873156447 2873151551 Bacteria 8625867
550 2874631060 2874628541 Bacteria 8630250
551 2876765956 2876761206 Bacteria 10111113
552 2879113138 2879110137 Bacteria 8907982
553 2885414872 2885409591 Bacteria 9235467
554 2889036751 2889033259 Bacteria 9099371
555 2896109875 2896109856 Bacteria 7140722
556 2903755212 2903748898 Bacteria 9972761
557 2904710480
558 2906612034
559 2906634576 2906626472 Bacteria 8826946
560 2906636262 2906635258 Bacteria 8601019
561 2906663580 2906660503 Bacteria 8595048
562 2908758031 2908756301 Bacteria 8864324
563 2922363758 2922361189 Bacteria 7436256
564 2922389690 2922386360 Bacteria 7017218
565 2922427261
566 2929620210 2929615660 Bacteria 9193770
567 2929629523 2929624759 Bacteria 9339455
568 2933582127 2933577622 Bacteria 9116884
569 2935636295 2935630451 Bacteria 8169952
570 2935965558 2935959822 Bacteria 7869783
571 2941512926 2941507105 Bacteria 8166816
572 2941520772 2941515067 Bacteria 8166720
573 2941528787 2941523033 Bacteria 8169134
574 3005476439 3005474847 Bacteria 9259049
575 3005601352 3005594810 Bacteria 8716512
576 3005716791 3005710791 Bacteria 7622528
577 8006973054 8006964411 Bacteria 8966052
578 8006977825 8006973647 Bacteria 10679141
579 8006986399 8006984368 Bacteria 9651211
580 8006999088 8006994254 Bacteria 8309700
581 8016587994 8016583857 Bacteria 10421953
582 8019560855 8019555841 Bacteria 9642137
583 8019570936 8019565922 Bacteria 9639779
584 8055750037 8055742211 Bacteria 9226248
585 8056676468 8056673599 Bacteria 7871253
586 8056695526 8056689827 Bacteria 6712655
587 Ga0157380_10032694
588 RicEn_C6373
589 JGI25406J46586_10080307
590 JGI25165J46597_1010393
591 JGI25160J50197_1005573
592 Ga0055539_1002738
593 Ga0065704_10076531
594 Ga0065712_10018854
595 Ga0070670_100341806
596 Ga0070670_100407162
597 Ga0068869_100047574
598 Ga0070680_100032205
599 Ga0068868_100060981
600 Ga0068868_100129188
601 Ga0068868_100149790
602 Ga0070689_100695163
603 Ga0070691_10043426
604 Ga0070692_10283484
605 Ga0070668_100066148
606 Ga0070668_100067130
607 Ga0070668_100385489
608 Ga0070668_100593744
609 Ga0070669_100608925
610 Ga0070671_100464528
611 Ga0070674_100623781
612 Ga0070673_100586562
613 Ga0070667_100113596
614 Ga0070667_100476288
615 Ga0070700_100177753
616 Ga0070700_100206090
617 Ga0070708_100156225
618 Ga0070663_100078755
619 Ga0070663_100080848
620 Ga0070678_100133915
621 Ga0070678_100190139
622 Ga0070678_100288441
623 Ga0070678_100457763
624 Ga0070678_100574618
625 Ga0070681_10110134
626 Ga0070681_10312601
627 Ga0070706_100253523
628 Ga0070706_100855719
629 Ga0070698_100283941
630 Ga0070679_100074940
631 Ga0070672_100215921
632 Ga0070686_100131458
633 Ga0070695_100023395
634 Ga0070695_100727567
635 Ga0070693_100551952
636 Ga0070665_100013952
637 Ga0070665_100078296
638 Ga0070704_100049828
639 Ga0068855_100084929
640 Ga0068855_100152078
641 Ga0068855_100889522
642 Ga0070664_100253666
643 Ga0070664_100535940
644 Ga0068854_100113615
645 Ga0068854_100250666
646 Ga0068856_100053265
647 Ga0068856_100647468
648 Ga0070702_100041108
649 Ga0070702_100284993
650 Ga0068852_100298727
651 Ga0068852_100369520
652 Ga0068859_100150756
653 Ga0068859_100173757
654 Ga0068866_10024229
655 Ga0068861_100060169
656 Ga0068861_100115553
657 Ga0068861_100450232
658 Ga0068861_100462016
659 Ga0068861_100965993
660 Ga0068851_10260094
661 Ga0068851_10341729
662 Ga0068870_10106507
663 Ga0068858_100085112
664 Ga0068858_100137326
665 Ga0068858_100420983
666 Ga0068860_100292777
667 Ga0068860_100437421
668 Ga0068860_100711469
669 Ga0068862_100174827
670 Ga0068862_100484304
671 Ga0068862_100644253
672 Ga0081455_10007620
673 Ga0081540_1021896
674 Ga0081540_1050162
675 Ga0081540_1051997
676 Ga0081539_10017617
677 Ga0075365_10131202
678 Ga0075365_10777756
679 Ga0075368_10028731
680 Ga0075363_100014531
681 Ga0075363_100059006
682 Ga0075363_100181566
683 Ga0075364_10098013
684 Ga0075364_10213592
685 Ga0075432_10084495
686 Ga0070712_100105685
687 Ga0075362_10036953
688 Ga0075362_10130115
689 Ga0075367_10029907
690 Ga0075367_10334730
691 Ga0075369_10056476
692 Ga0075369_10066103
693 Ga0075366_10131817
694 Ga0075366_10296136
695 Ga0075366_10497344
696 Ga0097621_100463788
697 Ga0075370_10005204
698 Ga0075370_10023238
699 Ga0075370_10314418
700 Ga0068871_100057607
701 Ga0068871_100455257
702 Ga0075428_100048939
703 Ga0075428_100080918
704 Ga0075428_100119714
705 Ga0075434_100085245
706 Ga0075434_100811734
707 Ga0075429_100235833
708 Ga0068865_100364269
709 Ga0097620_100150751
710 Ga0097620_100173751
711 Ga0075435_100692424
712 Ga0105250_10021291
713 Ga0105240_10136192
714 Ga0111539_10000633
715 Ga0111539_10061096
716 Ga0111539_10216076
717 Ga0111539_10300842
718 Ga0105247_10341243
719 Ga0114129_10195311
720 Ga0114129_10677638
721 Ga0114129_10730992
722 Ga0105243_10312159
723 Ga0105243_10943798
724 Ga0105241_10055891
725 Ga0105242_10141532
726 Ga0105242_10292125
727 Ga0105248_10029798
728 Ga0105248_10128765
729 Ga0105248_10300483
730 Ga0105248_10710992
731 Ga0105238_10304971
732 Ga0105249_10078868
733 Ga0105246_10192893
734 Ga0157370_10055170
735 Ga0157370_10093045
736 Ga0157374_10901918
737 Ga0163162_10635721
738 Ga0157375_10048776
739 Ga0157375_10793860
740 Ga0157375_12203961
741 Ga0163163_10166289
742 Ga0163163_10169881
743 Ga0163163_10944606
744 Ga0157380_10317218
745 Ga0157380_10912089
746 Ga0157377_10113475
747 Ga0157379_10135007
748 Ga0157376_10393562
749 Ga0163161_10120350
750 Ga0163161_10220999
751 Ga0213876_10032461
752 Ga0209233_1004822
753 Ga0209455_1015746
754 Ga0209455_1030591
755 Ga0209758_1030578
756 Ga0207697_10016454
757 Ga0207656_10143457
758 Ga0207696_1013907
759 Ga0207653_10010891
760 Ga0207642_10229504
761 Ga0207710_10014804
762 Ga0207688_10024852
763 Ga0207688_10119817
764 Ga0207688_10196564
765 Ga0207680_10296379
766 Ga0207643_10033798
767 Ga0207705_10108089
768 Ga0207654_10053697
769 Ga0207707_10185324
770 Ga0207671_10081478
771 Ga0207671_10211913
772 Ga0207693_10065324
773 Ga0207660_10454326
774 Ga0207662_10078058
775 Ga0207657_10069593
776 Ga0207649_10077157
777 Ga0207652_10172602
778 Ga0207652_10270149
779 Ga0207694_10294752
780 Ga0207650_10072224
781 Ga0207687_10067640
782 Ga0207644_10106767
783 Ga0207644_10416409
784 Ga0207706_10124263
785 Ga0207669_10785892
786 Ga0207691_10330396
787 Ga0207691_10558517
788 Ga0207691_10566332
789 Ga0207711_10052801
790 Ga0207711_10657313
791 Ga0207689_10166135
792 Ga0207667_10184722
793 Ga0207667_10615425
794 Ga0207651_10152064
795 Ga0207651_10310921
796 Ga0207668_10042229
797 Ga0207668_10122931
798 Ga0207668_10258252
799 Ga0207668_11336544
800 Ga0207658_10547507
801 Ga0207677_10071749
802 Ga0207677_10121290
803 Ga0207703_10133110
804 Ga0207703_10279208
805 Ga0207678_10090097
806 Ga0207678_10100354
807 Ga0207678_10192694
808 Ga0207678_10221616
809 Ga0207708_10081755
810 Ga0207708_10123001
811 Ga0207702_10180603
812 Ga0207702_10434345
813 Ga0207648_10024253
814 Ga0207648_10238566
815 Ga0207676_11064759
816 Ga0207674_10127924
817 Ga0207675_100058504
818 Ga0207675_100125245
819 Ga0207675_100246402
820 Ga0207675_100618288
821 Ga0207675_100897398
822 Ga0207683_10081064
823 Ga0207683_10096182
824 Ga0207683_10220146
825 Ga0207683_10266112
826 Ga0207698_10280621
827 Ga0207698_10287605
828 Ga0207698_10331404
829 Ga0207428_10003997
830 Ga0207428_10014069
831 Ga0207428_10062538
832 Ga0268266_10001169
833 Ga0268266_10004436
834 Ga0268266_10028572
835 Ga0268266_10297632
836 Ga0268265_10110227
837 Ga0268264_10064030
838 Ga0268264_10077509
839 Ga0268264_10481447
840 Ga0268264_10877890
841 Ga0268264_11016664
842 Ga0307517_10000196
843 Ga0307517_10126030
844 Ga0307515_10022977
845 Ga0307512_10231568
846 Ga0265328_10053303
847 Ga0307513_10105242
848 Ga0307513_10213007
849 Ga0307513_10705965
850 Ga0307509_10059839
851 Ga0307508_10078747
852 Ga0307516_10008341
853 Ga0307516_10481382
854 Ga0307405_10219117
855 Ga0307413_10057425
856 Ga0307413_10187670
857 Ga0307406_10725493
858 Ga0307412_10480555
859 Ga0307412_11098350
860 Ga0307416_100206511
861 Ga0307416_100237457
862 Ga0307416_100749588
863 Ga0307414_10489859
864 Ga0307411_10243657
865 Ga0307411_10428046
866 Ga0307411_10708965
867 Ga0307415_100392347
868 Ga0307510_10105802
869 Ga0307510_10110015
870 Ga0315911_1000012
871 Ga0373929_0056733
872 Ga0373934_0022224
873 Ga0373934_0079412
874 Ga0373944_0107480
875 Ga0373936_0008600
876 Ga0373941_0078371
877 Ga0373945_0044150
878 Ga0373954_0129098
879 Ga0373943_0001715
880 Ga0373946_0008900
881 Ga0373946_0202134
882 Ga0373955_0026628
883 Ga0373931_0007107
884 Ga0373935_0002990
885 Ga0373927_0001230
886 Ga0373927_0161951
887 Ga0373933_0027010
888 Ga0373947_0001223
889 Ga0316582_0205982
890 Ga0373925_0002121
891 Ga0395899_0242736
892 Ga0395900_0411345
893 Ga0395898_0070484
894 Ga0395898_0086003
895 Ga0436364_1462129
896 Ga0436365_1721552
897 Ga0436365_1752216
898 Ga0436363_1284934
899 Ga0439465_0023767
900 Ga0451793_1476757
901 Ga0451845_0221124
902 Ga0439449_0000954
903 Ga0466965_0074668
904 Ga0466961_0077841
905 Ga0466960_0002751
906 Ga0466959_0305402
907 Ga0451576_0266571
908 Ga0466967_0286087
909 Ga0495592_0046659
910 Ga0495603_0000667
911 Ga0495603_0055101
912 Ga0495603_0055135
913 Ga0495603_0235026
914 Ga0495591_044894
915 Ga0495629_0000283
916 Ga0495629_0316029
917 Ga0495638_0064033
918 Ga0495638_0070790
919 Ga0495638_0368462
920 Ga0495651_0594109
921 Ga0495653_0042720
922 Ga0495653_0058878
923 Ga0495653_0297548
924 Ga0495580_0002411
925 Ga0495580_0174305
926 Ga0495582_0000555
927 Ga0495605_0029956
928 Ga0495639_0000423
929 Ga0495639_0058072
930 Ga0495662_0009557
931 Ga0495664_0028448
932 Ga0495585_0101363
933 Ga0495585_0325162
934 Ga0495594_0001986
935 Ga0495594_0090781
936 Ga0495607_0143095
937 Ga0495607_0159838
938 Ga0495583_0202148
939 Ga0495606_0158639
940 Ga0495618_0079247
941 Ga0495620_0242831
942 Ga0495628_0028687
943 Ga0495628_0290309
944 Ga0495630_0016818
945 Ga0495631_0013532
946 Ga0495631_0064388
947 Ga0495632_0153804
948 Ga0495648_0110827
949 Ga0495648_0184160
950 Ga0495648_0229014
951 Ga0495666_0269344
952 Ga0495642_0231537
953 Ga0495652_0020504
954 Ga0495665_0001096
955 Ga0495665_0085120
956 Ga0495640_0010928
957 Ga0495586_0052485
958 Ga0495598_0122150
959 Ga0495621_0020103
960 Ga0495622_0003133
961 Ga0495656_0008823
962 Ga0495668_0107562
963 Ga0495668_0223703
964 Ga0495634_0004577
965 Ga0495611_0044250
966 Ga0495625_0044897
967 Ga0495635_0002530
968 Ga0495635_0527166
969 Ga0495659_0045810
970 Ga0495659_0131967
971 Ga0495588_0078413
972 Ga0495588_0130305
973 Ga0495623_0217364
974 Ga0495647_0001720
975 Ga0495647_0051509
976 Ga0495658_0002218
977 Ga0495669_0012048
978 Ga0495669_0022466
979 Ga0495613_0001910
980 Ga0495613_0102715
981 Ga0495624_0001800
982 Ga0495671_0100850
983 Ga0495649_0345900
984 Ga0495581_0000346
985 Ga0495581_0031159
986 Ga0495581_0184121
987 Ga0495674_0018654
988 Ga0495674_0197951
989 Ga0495672_0065171
990 Ga0495676_0012424
991 Ga0495680_0067137
992 Ga0495677_0051098
993 Ga0495685_130392
994 Ga0495684_0022580
995 Ga0495684_0030766
996 Ga0495686_0061651
997 Ga0495593_0001297
998 Ga0495593_0076408
999 Ga0495602_0289316
1000 Ga0496100_0514991
1001 Ga0496102_0052661
1002 Ga0496103_0346102
1003 Ga0496104_0083343
1004 Ga0496104_0212066
1005 Ga0496104_0329004
1006 Ga0496105_0174891
1007 Ga0496106_0213857
1008 Ga0496106_0562863
1009 Ga0496107_0019279
1010 Ga0496108_0049556
1011 Ga0496108_0420981
1012 Ga0496109_0049457
1013 Ga0496109_0116700
1014 Ga0496109_0127317
1015 Ga0496110_0033183
1016 Ga0496110_0526496
1017 Ga0496110_0735885
1018 Ga0496111_0079930
1019 Ga0496112_0084110
1020 Ga0496112_0103978
1021 Ga0496113_0122819
1022 Ga0496114_0186767
1023 Ga0496114_0208530
1024 Ga0496114_0438242
1025 Ga0496115_0032088
1026 Ga0496115_0371379
1027 Ga0496117_0369797
1028 Ga0496118_0289971
1029 Ga0496118_0377964
1030 Ga0496119_0312850
1031 Ga0496121_0049602
1032 Ga0496121_0050081
1033 Ga0496121_0094580
1034 Ga0496124_0334539
1035 Ga0496125_0053776
1036 Ga0496126_0006987
1037 Ga0496126_0060445
1038 Ga0496126_0101333
1039 Ga0501031_0009340
1040 Ga0501031_0023694
1041 Ga0501031_0460455
1042 Ga0501032_0002147
1043 Ga0501032_0173931
1044 Ga0501033_0000060
1045 Ga0501034_0000117
1046 Ga0501036_0000188
1047 Ga0501037_0000402
1048 Ga0501038_0000540
1049 Ga0501039_0000431
1050 Ga0501042_0014849
1051 Ga0501043_0002749
1052 Ga0501043_0757639
1053 Ga0501046_0001915
1054 Ga0501046_0214954
1055 Ga0501047_0000246
1056 Ga0501048_0000878
1057 Ga0501048_0344371
1058 Ga0501067_0000320
1059 Ga0501068_0018821
1060 Ga0501069_0005497
1061 Ga0501070_0000779
1062 Ga0501070_0244396
1063 Ga0501070_0568221
1064 Ga0501071_0172407
1065 Ga0501071_0749900
1066 Ga0501072_0004819
1067 Ga0501073_0000093
1068 Ga0501074_0000127
1069 Ga0501077_0477703
1070 Ga0501235_072286
1071 Ga0501079_0001174
1072 Ga0501080_0004375
1073 Ga0501080_0070794
1074 Ga0501083_0009493
1075 Ga0501083_0450341
1076 Ga0501282_006553
1077 Ga0501044_0005195
1078 Ga0501044_0341636
1079 Ga0501044_0462291
1080 nmdc:mga03683_23171_c1
1081 nmdc:mga03683_389047_c1
1082 nmdc:mga03n38_20957_c1
1083 nmdc:mga03n38_6892_c1
1084 nmdc:mga00v17_149396_c1
1085 nmdc:mga00v17_160199_c1
1086 nmdc:mga00v17_217749_c1
1087 nmdc:mga00v17_61141_c1
1088 nmdc:mga00v17_70683_c1
1089 nmdc:mga0yw44_105286_c1
1090 nmdc:mga0yw44_158075_c1
1091 nmdc:mga0yw44_95714_c1
1092 nmdc:mga0k408_215256_c1
1093 nmdc:mga0k408_366395_c1
1094 nmdc:mga06z11_2511_c1
1095 nmdc:mga06z11_26600_c1
1096 nmdc:mga07m45_2468_c1
1097 nmdc:mga05p37_350912_c1
1098 nmdc:mga05p37_394055_c1
1099 nmdc:mga05p37_97072_c2
1100 nmdc:mga09592_83693_c1
1101 nmdc:mga08y16_19662_c1
1102 nmdc:mga08y16_91218_c1
1103 nmdc:mga0n895_3005_c1
1104 nmdc:mga0n895_59955_c1
1105 nmdc:mga0rr50_470847_c1
1106 nmdc:mga0sz30_195133_c1
1107 nmdc:mga0sz30_55574_c2
1108 Ga0495601_0015350
1109 Ga0495601_0107518
1110 Ga0495655_0032287
1111 Ga0495595_0003385
1112 Ga0500651_0142140
1113 Ga0500555_024354
1114 Ga0500572_001516
1115 Ga0500594_0177657
1116 Ga0500595_003114
1117 Ga0500622_0308841
1118 Ga0500633_0238065
1119 Ga0500638_048928
1120 Ga0500637_0182354
1121 Ga0501084_0028191
1122 Ga0501084_0476951
1123 Ga0501082_0004139
1124 2513655731
1125 2513862781
1126 2513916191
1127 2517890202
1128 2524438240
1129 2723848677
1130 2745077330
1131 2793067822
1132 2867307855
1133 2867315231
1134 2867319772
1135 2873156447
1136 2874631060
1137 2876765956
1138 2879113138
1139 2885414872
1140 2889036751
1141 2896109875
1142 2903755212
1143 2904710480
1144 2906612034
1145 2906634576
1146 2906636262
1147 2906663580
1148 2908758031
1149 2922363758
1150 2922389690
1151 2922427261
1152 2929620210
1153 2929629523
1154 2933582127
1155 2935636295
1156 2935965558
1157 2941512926
1158 2941520772
1159 2941528787
1160 3005476439
1161 3005601352
1162 3005716791
1163 8006973054
1164 8006977825
1165 8006986399
1166 8006999088
1167 8016587994
1168 8019560855
1169 8019570936
1170 8055750037
1171 8056676468
1172 8056695526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

42

235

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.422 4 214
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.3979 4 214
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.3907 36 165
5iib-assembly1.cif.gz_A crystal structure of red abalone egg verl repeat 3 in complex with sperm lysin at 1.64 a resolution (crystal form ii) 0.3676 36 131
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3292 5 218
ID Description Score Start End Superfamily
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.548 3 218 1.20.1250.20
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4866 24 160 1.10.3720.10
af_E9AHK8_70_316_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.4556 8 164 1.20.1740.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4527 24 216 1.10.3720.10
af_L0TEV4_50_262_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4193 24 216 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4R4K4R4-F1-model_v4 LysE family translocator 0.8981 4 161 GO:0005886
GO:0015171
AF-H0HJ33-F1-model_v4 Lysine exporter LysE/YggA 0.8965 1 163 GO:0005886
GO:0042970
AF-A0A1V0LL34-F1-model_v4 deleted 0.8938 4 163
AF-A0A1Q3R009-F1-model_v4 deleted 0.886 2 163
AF-A0A1Q9B2I8-F1-model_v4 Lysine transporter LysE 0.8564 1 163 GO:0005886
GO:0042970

Map