F466541

General Info

Members Datasets Scaffolds Average Seq Length
586 278 581 299

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100011965|Ga0075429_1000119655
Length 355
Sequence MACTPQLRECAPLDDWRERPPTAGPPDDVRDEQPRRVGADVDAGAAHGARQRIRDEGRPQRRFEASWALVNDELAIEVRGLRKRYGDLEAVRGIDFSVRCGEVFGLLGPNGAGKTTTVEILEGYRDRSGGDVSVLGHDPQLRGRALRERVGIVLQSTGIYRHLTVREVLAHFAGLYPAPRGVDEVIELVGLRGKEDARTRALSGGQLRRLDLALALIGDPELIFLDEPTTGFDPAARRGAWDAIRSLKALGKTVVLTTHYLDEAQALADRVAIVKDGRILVEGAPSELGAGEGATRYRVAWRNGSGLLSQRETDDPTTLLHELTTAALERGERLEGLSVTRPTLEDVYLELTADA

Samples

Sample ID Description Type Environment
1 2643221649 Leifsonia sp. Root4 Isolate Unclassified
2 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
3 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
4 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
5 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.17
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 13.82
Rhizosphere 80.2
Stem 0
Stem Tuber 0
Unclassified 4.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10058365 3300003203 Bacteria 1258
2 JGI25404J52841_10006763 3300003659 Bacteria 2405
3 Ga0070658_10140827 3300005327 Bacteria 2015
4 Ga0070683_100000273 3300005329 Bacteria 35417
5 Ga0070683_100037529 3300005329 Bacteria 4435
6 Ga0070683_100085500 3300005329 Bacteria 2957
7 Ga0070683_100146238 3300005329 Bacteria 2240
8 Ga0070680_100055512 3300005336 Bacteria 3237
9 Ga0070682_100087690 3300005337 Bacteria 2029
10 Ga0070682_100198461 3300005337 Bacteria 1414
11 Ga0068868_100087153 3300005338 Bacteria 2510
12 Ga0070660_100067557 3300005339 Bacteria 2785
13 Ga0070660_100160760 3300005339 Bacteria 1810
14 Ga0070689_100101309 3300005340 Bacteria 2279
15 Ga0070691_10002612 3300005341 Bacteria 8040
16 Ga0070687_100147067 3300005343 Bacteria 1379
17 Ga0070661_100217614 3300005344 Bacteria 1464
18 Ga0070668_100080532 3300005347 Bacteria 2551
19 Ga0070669_100001519 3300005353 Bacteria 16785
20 Ga0070675_100408169 3300005354 Bacteria 1213
21 Ga0070671_100309627 3300005355 Bacteria 1345
22 Ga0070673_100236661 3300005364 Bacteria 1586
23 Ga0070659_100000030 3300005366 Bacteria 128662
24 Ga0070659_100148450 3300005366 Bacteria 1911
25 Ga0070709_10006089 3300005434 Bacteria 6563
26 Ga0070714_100000228 3300005435 Bacteria 44348
27 Ga0070714_100014755 3300005435 Bacteria 6279
28 Ga0070714_100020329 3300005435 Bacteria 5420
29 Ga0070714_100029533 3300005435 Bacteria 4558
30 Ga0070714_100029681 3300005435 Bacteria 4547
31 Ga0070714_100043792 3300005435 Bacteria 3788
32 Ga0070714_100320762 3300005435 Bacteria 1449
33 Ga0070713_100000482 3300005436 Bacteria 25372
34 Ga0070713_100043399 3300005436 Bacteria 3676
35 Ga0070713_100103620 3300005436 Bacteria 2469
36 Ga0070713_100444784 3300005436 Bacteria 1216
37 Ga0070710_10000009 3300005437 Bacteria 165863
38 Ga0070710_10006857 3300005437 Bacteria 5496
39 Ga0070710_10014749 3300005437 Bacteria 3938
40 Ga0070711_100284466 3300005439 Bacteria 1309
41 Ga0070705_100001133 3300005440 Bacteria 14726
42 Ga0070700_100018947 3300005441 Bacteria 3965
43 Ga0070700_100099772 3300005441 Bacteria 1911
44 Ga0070700_100151883 3300005441 Bacteria 1585
45 Ga0070708_100261161 3300005445 Bacteria 1628
46 Ga0070663_100109588 3300005455 Bacteria 2073
47 Ga0070663_100148620 3300005455 Bacteria 1795
48 Ga0070663_100401207 3300005455 Bacteria 1121
49 Ga0070678_100002983 3300005456 Bacteria 9378
50 Ga0070662_100085307 3300005457 Bacteria 2360
51 Ga0070681_10023828 3300005458 Bacteria 6161
52 Ga0070681_10172230 3300005458 Bacteria 2087
53 Ga0070685_10089946 3300005466 Bacteria 1856
54 Ga0070685_10113676 3300005466 Bacteria 1672
55 Ga0070706_100082952 3300005467 Bacteria 2969
56 Ga0070707_100011610 3300005468 Bacteria 8220
57 Ga0070707_100014238 3300005468 Bacteria 7455
58 Ga0070707_100025661 3300005468 Bacteria 5595
59 Ga0070707_100055121 3300005468 Bacteria 3811
60 Ga0070698_100143968 3300005471 Bacteria 2333
61 Ga0070699_100079395 3300005518 Bacteria 2858
62 Ga0070679_100050313 3300005530 Bacteria 4151
63 Ga0070684_100001222 3300005535 Bacteria 18444
64 Ga0070684_100001353 3300005535 Bacteria 17564
65 Ga0070697_100001164 3300005536 Bacteria 19928
66 Ga0070697_100031546 3300005536 Bacteria 4263
67 Ga0070695_100106485 3300005545 Bacteria 1896
68 Ga0070693_100003064 3300005547 Bacteria 7755
69 Ga0070665_100002263 3300005548 Bacteria 21391
70 Ga0070704_100098335 3300005549 Bacteria 2198
71 Ga0068857_100002277 3300005577 Bacteria 15604
72 Ga0068854_100103784 3300005578 Bacteria 2135
73 Ga0068856_100010876 3300005614 Bacteria 8836
74 Ga0068856_100028706 3300005614 Bacteria 5435
75 Ga0070702_100023262 3300005615 Bacteria 3290
76 Ga0070702_100060083 3300005615 Bacteria 2209
77 Ga0068852_100024037 3300005616 Bacteria 4918
78 Ga0068852_100078703 3300005616 Bacteria 2917
79 Ga0068859_100040708 3300005617 Bacteria 4666
80 Ga0068859_100532309 3300005617 Bacteria 1270
81 Ga0068864_100140064 3300005618 Bacteria 2181
82 Ga0068866_10026269 3300005718 Bacteria 2747
83 Ga0068861_100116631 3300005719 Bacteria 2147
84 Ga0068861_100183417 3300005719 Bacteria 1744
85 Ga0068861_100204786 3300005719 Bacteria 1658
86 Ga0068858_100261857 3300005842 Bacteria 1644
87 Ga0081455_10000061 3300005937 Bacteria 117154
88 Ga0081455_10012210 3300005937 Bacteria 8576
89 Ga0081455_10014973 3300005937 Bacteria 7555
90 Ga0081538_10004166 3300005981 Bacteria 13421
91 Ga0081538_10027953 3300005981 Bacteria 3893
92 Ga0081540_1001012 3300005983 Bacteria 25230
93 Ga0081539_10008321 3300005985 Bacteria 9075
94 Ga0081539_10025587 3300005985 Bacteria 3795
95 Ga0081539_10030182 3300005985 Bacteria 3371
96 Ga0070717_10000013 3300006028 Bacteria 228046
97 Ga0070717_10009518 3300006028 Bacteria 7308
98 Ga0070717_10125024 3300006028 Bacteria 2207
99 Ga0070717_10256769 3300006028 Bacteria 1545
100 Ga0070717_10261613 3300006028 Bacteria 1531
101 Ga0075364_10009834 3300006051 Bacteria 5753
102 Ga0070716_100062528 3300006173 Bacteria 2159
103 Ga0070712_100000003 3300006175 Bacteria 253696
104 Ga0070712_100042477 3300006175 Bacteria 3126
105 Ga0068871_100239102 3300006358 Bacteria 1578
106 Ga0075428_100474101 3300006844 Bacteria 1340
107 Ga0075429_100011965 3300006880 Bacteria 7524
108 Ga0068865_100129908 3300006881 Bacteria 1886
109 Ga0097620_100040703 3300006931 Bacteria 4666
110 Ga0097620_100532296 3300006931 Bacteria 1270
111 Ga0105240_10023970 3300009093 Bacteria 8061
112 Ga0105240_10073705 3300009093 Bacteria 4215
113 Ga0105245_10205182 3300009098 Bacteria 1894
114 Ga0105245_10505995 3300009098 Bacteria 1225
115 Ga0105247_10038643 3300009101 Bacteria 2914
116 Ga0105243_10027181 3300009148 Bacteria 4382
117 Ga0105243_10045679 3300009148 Bacteria 3443
118 Ga0105243_10116023 3300009148 Bacteria 2249
119 Ga0105243_10184345 3300009148 Bacteria 1818
120 Ga0105243_10458144 3300009148 Bacteria 1198
121 Ga0105241_10123667 3300009174 Bacteria 2086
122 Ga0105241_10234947 3300009174 Bacteria 1547
123 Ga0105242_10257745 3300009176 Bacteria 1574
124 Ga0105242_10516851 3300009176 Bacteria 1138
125 Ga0105249_10038105 3300009553 Bacteria 4361
126 Ga0105249_10149050 3300009553 Bacteria 2250
127 Ga0105249_10197019 3300009553 Bacteria 1969
128 Ga0105249_10337195 3300009553 Bacteria 1523
129 Ga0105239_10124568 3300010375 Bacteria 2863
130 Ga0105239_10256483 3300010375 Bacteria 1965
131 Ga0105246_10063300 3300011119 Bacteria 2579
132 Ga0105246_10099445 3300011119 Bacteria 2114
133 Ga0105246_10114548 3300011119 Bacteria 1987
134 Ga0105246_10163516 3300011119 Bacteria 1698
135 Ga0157371_10205104 3300013102 Bacteria 1414
136 Ga0157370_10154667 3300013104 Bacteria 2134
137 Ga0157369_10017241 3300013105 Bacteria 8117
138 Ga0157369_10454113 3300013105 Bacteria 1327
139 Ga0163162_10257599 3300013306 Bacteria 1876
140 Ga0163162_10377765 3300013306 Bacteria 1550
141 Ga0157372_10492262 3300013307 Bacteria 1430
142 Ga0157375_10012778 3300013308 Bacteria 7455
143 Ga0157380_10522032 3300014326 Bacteria 1158
144 Ga0157377_10111855 3300014745 Bacteria 1642
145 Ga0157376_10116556 3300014969 Bacteria 2360
146 Ga0157376_10153050 3300014969 Bacteria 2082
147 Ga0163161_10079222 3300017792 Bacteria 2415
148 Ga0206354_10937210 3300020081 Bacteria 1655
149 Ga0213876_10051944 3300021384 Bacteria 2166
150 Ga0213876_10096880 3300021384 Bacteria 1563
151 Ga0213876_10099209 3300021384 Bacteria 1544
152 Ga0213875_10004578 3300021388 Bacteria 7550
153 Ga0213875_10005976 3300021388 Bacteria 6453
154 Ga0207692_10000005 3300025898 Bacteria 370169
155 Ga0207688_10012664 3300025901 Bacteria 4590
156 Ga0207688_10033001 3300025901 Bacteria 2862
157 Ga0207647_10047416 3300025904 Bacteria 2672
158 Ga0207699_10089203 3300025906 Bacteria 1932
159 Ga0207699_10190624 3300025906 Bacteria 1383
160 Ga0207699_10242547 3300025906 Bacteria 1239
161 Ga0207684_10066593 3300025910 Bacteria 3059
162 Ga0207684_10491536 3300025910 Bacteria 1052
163 Ga0207693_10000009 3300025915 Bacteria 168990
164 Ga0207693_10034195 3300025915 Bacteria 4010
165 Ga0207693_10094501 3300025915 Bacteria 2343
166 Ga0207663_10068536 3300025916 Bacteria 2279
167 Ga0207660_10041400 3300025917 Bacteria 3228
168 Ga0207662_10095976 3300025918 Bacteria 1831
169 Ga0207657_10037457 3300025919 Bacteria 4330
170 Ga0207657_10060673 3300025919 Bacteria 3245
171 Ga0207657_10139030 3300025919 Bacteria 1985
172 Ga0207649_10025548 3300025920 Bacteria 3444
173 Ga0207652_10110518 3300025921 Bacteria 2437
174 Ga0207646_10010743 3300025922 Bacteria 8907
175 Ga0207646_10019332 3300025922 Bacteria 6332
176 Ga0207646_10065164 3300025922 Bacteria 3252
177 Ga0207681_10003140 3300025923 Bacteria 10381
178 Ga0207681_10099308 3300025923 Bacteria 2096
179 Ga0207659_10105141 3300025926 Bacteria 2136
180 Ga0207687_10016161 3300025927 Bacteria 4900
181 Ga0207687_10095108 3300025927 Bacteria 2182
182 Ga0207700_10002355 3300025928 Bacteria 10850
183 Ga0207700_10002830 3300025928 Bacteria 9981
184 Ga0207700_10007455 3300025928 Bacteria 6685
185 Ga0207700_10040961 3300025928 Bacteria 3385
186 Ga0207700_10318488 3300025928 Bacteria 1347
187 Ga0207664_10000060 3300025929 Bacteria 116764
188 Ga0207664_10002459 3300025929 Bacteria 12263
189 Ga0207664_10004846 3300025929 Bacteria 9151
190 Ga0207664_10021019 3300025929 Bacteria 4844
191 Ga0207644_10133857 3300025931 Bacteria 1901
192 Ga0207644_10302278 3300025931 Bacteria 1290
193 Ga0207690_10000328 3300025932 Bacteria 31713
194 Ga0207690_10055122 3300025932 Bacteria 2676
195 Ga0207706_10060281 3300025933 Bacteria 3341
196 Ga0207706_10243218 3300025933 Bacteria 1573
197 Ga0207686_10241878 3300025934 Bacteria 1314
198 Ga0207709_10010699 3300025935 Bacteria 5053
199 Ga0207709_10092095 3300025935 Bacteria 1984
200 Ga0207669_10056703 3300025937 Bacteria 2381
201 Ga0207669_10169833 3300025937 Bacteria 1551
202 Ga0207704_10046266 3300025938 Bacteria 2592
203 Ga0207704_10107433 3300025938 Bacteria 1877
204 Ga0207665_10002563 3300025939 Bacteria 12203
205 Ga0207689_10033898 3300025942 Bacteria 4241
206 Ga0207661_10001985 3300025944 Bacteria 14083
207 Ga0207661_10002631 3300025944 Bacteria 12355
208 Ga0207661_10130597 3300025944 Bacteria 2151
209 Ga0207679_10002540 3300025945 Bacteria 11248
210 Ga0207679_10017050 3300025945 Bacteria 4834
211 Ga0207679_10151163 3300025945 Bacteria 1890
212 Ga0207712_10048302 3300025961 Bacteria 2960
213 Ga0207712_10131473 3300025961 Bacteria 1908
214 Ga0207640_10044456 3300025981 Bacteria 2846
215 Ga0207640_10161605 3300025981 Bacteria 1658
216 Ga0207658_10142489 3300025986 Bacteria 1942
217 Ga0207677_10072368 3300026023 Bacteria 2437
218 Ga0207703_10711816 3300026035 Bacteria 955
219 Ga0207678_10184061 3300026067 Bacteria 1784
220 Ga0207708_10003021 3300026075 Bacteria 12409
221 Ga0207708_10087204 3300026075 Bacteria 2403
222 Ga0207708_10135339 3300026075 Bacteria 1930
223 Ga0207702_10002389 3300026078 Bacteria 17876
224 Ga0207702_10006607 3300026078 Bacteria 9973
225 Ga0207648_10098033 3300026089 Bacteria 2566
226 Ga0207648_10098670 3300026089 Bacteria 2558
227 Ga0207648_10270112 3300026089 Bacteria 1519
228 Ga0207674_10001810 3300026116 Bacteria 27274
229 Ga0207674_10036967 3300026116 Bacteria 5082
230 Ga0207675_100018890 3300026118 Bacteria 6433
231 Ga0207675_100057571 3300026118 Bacteria 3627
232 Ga0207675_100112750 3300026118 Bacteria 2567
233 Ga0207675_100223791 3300026118 Bacteria 1813
234 Ga0207683_10002893 3300026121 Bacteria 14970
235 Ga0207683_10062078 3300026121 Bacteria 3290
236 Ga0207698_10043212 3300026142 Bacteria 3375
237 Ga0207698_10056150 3300026142 Bacteria 3039
238 Ga0268266_10008844 3300028379 Bacteria 8917
239 Ga0268264_10160690 3300028381 Bacteria 2023
240 Ga0265326_10000024 3300028558 Bacteria 112928
241 Ga0265319_1000116 3300028563 Bacteria 60553
242 Ga0265334_10000151 3300028573 Bacteria 42917
243 Ga0265336_10006718 3300028666 Bacteria 4123
244 Ga0265338_10001994 3300028800 Bacteria 31709
245 Ga0265324_10008959 3300029957 Bacteria 3936
246 Ga0265327_10031394 3300031251 Bacteria 2985
247 Ga0307408_100048614 3300031548 Bacteria 3043
248 Ga0307408_100185731 3300031548 Bacteria 1671
249 Ga0307405_10042222 3300031731 Bacteria 2775
250 Ga0307405_10119470 3300031731 Bacteria 1801
251 Ga0307413_10037024 3300031824 Bacteria 2815
252 Ga0307413_10183290 3300031824 Bacteria 1495
253 Ga0307413_10201985 3300031824 Bacteria 1436
254 Ga0307413_10216807 3300031824 Bacteria 1395
255 Ga0307410_10073994 3300031852 Bacteria 2371
256 Ga0307410_10082688 3300031852 Bacteria 2259
257 Ga0307410_10256255 3300031852 Bacteria 1362
258 Ga0307406_10012775 3300031901 Bacteria 4793
259 Ga0307406_10173302 3300031901 Bacteria 1563
260 Ga0307406_10212811 3300031901 Bacteria 1431
261 Ga0307406_10280898 3300031901 Bacteria 1270
262 Ga0307407_10009600 3300031903 Bacteria 4515
263 Ga0307407_10016601 3300031903 Bacteria 3670
264 Ga0307407_10068501 3300031903 Bacteria 2102
265 Ga0307407_10094006 3300031903 Bacteria 1845
266 Ga0307407_10108736 3300031903 Bacteria 1736
267 Ga0307412_10049095 3300031911 Bacteria 2779
268 Ga0307409_100003756 3300031995 Bacteria 8349
269 Ga0307409_100025701 3300031995 Bacteria 4136
270 Ga0307409_100072101 3300031995 Bacteria 2749
271 Ga0307409_100074615 3300031995 Bacteria 2711
272 Ga0307409_100092499 3300031995 Bacteria 2482
273 Ga0307409_100107783 3300031995 Bacteria 2328
274 Ga0307409_100258019 3300031995 Bacteria 1598
275 Ga0307409_100279231 3300031995 Bacteria 1543
276 Ga0307409_100422066 3300031995 Bacteria 1280
277 Ga0307416_100053336 3300032002 Bacteria 3243
278 Ga0307416_100056864 3300032002 Bacteria 3160
279 Ga0307416_100182629 3300032002 Bacteria 1968
280 Ga0307416_100270451 3300032002 Bacteria 1668
281 Ga0307416_100342664 3300032002 Bacteria 1508
282 Ga0307416_100347051 3300032002 Bacteria 1500
283 Ga0307416_100367108 3300032002 Bacteria 1464
284 Ga0307416_100652331 3300032002 Bacteria 1137
285 Ga0307414_10450940 3300032004 Bacteria 1128
286 Ga0307411_10136864 3300032005 Bacteria 1800
287 Ga0307415_100004089 3300032126 Bacteria 7526
288 Ga0307415_100017461 3300032126 Bacteria 4304
289 Ga0307415_100021281 3300032126 Bacteria 3982
290 Ga0307415_100239678 3300032126 Bacteria 1466
291 Ga0307415_100289327 3300032126 Bacteria 1352
292 Ga0373959_0000036 3300034820 Bacteria 29513
293 Ga0373923_0020647 3300035111 Bacteria 2561
294 Ga0373936_0006445 3300035113 Bacteria 4426
295 Ga0373953_0070870 3300035117 Bacteria 1437
296 Ga0373954_0089328 3300035118 Bacteria 1478
297 Ga0373956_0008238 3300035119 Bacteria 4218
298 Ga0373956_0058640 3300035119 Bacteria 1741
299 Ga0373957_0000714 3300035120 Bacteria 8607
300 Ga0373943_0087361 3300035170 Bacteria 1609
301 Ga0373946_0042948 3300035171 Bacteria 1861
302 Ga0373955_0004537 3300035172 Bacteria 6153
303 Ga0373924_0000429 3300035410 Bacteria 12892
304 Ga0373935_0018471 3300035692 Bacteria 4241
305 Ga0373933_0101262 3300035724 Bacteria 1788
306 Ga0373947_0205173 3300035725 Bacteria 1291
307 Ga0373937_0057955 3300036401 Bacteria 3558
308 Ga0395899_0099440 3300037312 Bacteria 2101
309 Ga0395900_0024961 3300037418 Bacteria 6117
310 Ga0395900_0026768 3300037418 Bacteria 5902
311 Ga0395900_0180330 3300037418 Bacteria 2147
312 Ga0395900_0252665 3300037418 Bacteria 1764
313 Ga0395898_0072226 3300037466 Bacteria 3334
314 Ga0395898_0159101 3300037466 Bacteria 2160
315 Ga0395898_0328792 3300037466 Bacteria 1458
316 Ga0395905_0181580 3300037471 Bacteria 1975
317 Ga0436364_0260207 3300037853 Bacteria 10812
318 Ga0436364_0650330 3300037853 Bacteria 1107
319 Ga0436364_0680087 3300037853 Bacteria 18176
320 Ga0436364_0747883 3300037853 Bacteria 6731
321 Ga0436364_1026511 3300037853 Bacteria 8468
322 Ga0436364_1425865 3300037853 Bacteria 2064
323 Ga0395901_0021587 3300038443 Bacteria 6596
324 Ga0395901_0031082 3300038443 Bacteria 5505
325 Ga0395901_0239235 3300038443 Bacteria 1894
326 Ga0436365_0066499 3300039437 Bacteria 2285
327 Ga0436365_0442366 3300039437 Bacteria 4485
328 Ga0436365_1286349 3300039437 Bacteria 3388
329 Ga0436365_1768242 3300039437 Bacteria 4630
330 Ga0436365_1933925 3300039437 Bacteria 8043
331 Ga0436363_0666383 3300039450 Bacteria 1679
332 Ga0436363_1082191 3300039450 Bacteria 18751
333 Ga0439465_0013322 3300041413 Bacteria 2566
334 Ga0439465_0013641 3300041413 Bacteria 2532
335 Ga0439465_0050632 3300041413 Bacteria 1359
336 Ga0439445_0012291 3300042004 Bacteria 2054
337 Ga0439450_008666 3300042008 Bacteria 1905
338 Ga0439463_001759 3300042016 Bacteria 5631
339 Ga0451577_0085975 3300042876 Bacteria 2806
340 Ga0466969_0029978 3300044656 Bacteria 2774
341 Ga0466965_0110229 3300044683 Bacteria 1414
342 Ga0466965_0143556 3300044683 Bacteria 1245
343 Ga0466966_0074136 3300044684 Bacteria 2128
344 Ga0466966_0166802 3300044684 Bacteria 1339
345 Ga0466966_0232134 3300044684 Bacteria 1113
346 Ga0466966_0246315 3300044684 Bacteria 1077
347 Ga0466961_0035351 3300044693 Bacteria 3209
348 Ga0466961_0063738 3300044693 Bacteria 2342
349 Ga0466963_0045551 3300044694 Bacteria 2889
350 Ga0466963_0055458 3300044694 Bacteria 2636
351 Ga0466963_0067035 3300044694 Bacteria 2408
352 Ga0466963_0071048 3300044694 Bacteria 2342
353 Ga0466963_0226857 3300044694 Bacteria 1309
354 Ga0466963_0291942 3300044694 Bacteria 1146
355 Ga0466971_0007663 3300044719 Bacteria 4709
356 Ga0466971_0027622 3300044719 Bacteria 2542
357 Ga0466968_0030526 3300044735 Bacteria 2233
358 Ga0466970_0035870 3300044765 Bacteria 2626
359 Ga0466970_0044600 3300044765 Bacteria 2361
360 Ga0466970_0255684 3300044765 Bacteria 982
361 Ga0466957_0012198 3300044842 Bacteria 4973
362 Ga0466957_0015199 3300044842 Bacteria 4494
363 Ga0466957_0066468 3300044842 Bacteria 2223
364 Ga0466957_0208819 3300044842 Bacteria 1285
365 Ga0466957_0214908 3300044842 Bacteria 1268
366 Ga0466960_0000237 3300044901 Bacteria 19109
367 Ga0466960_0037284 3300044901 Bacteria 2280
368 Ga0466960_0058071 3300044901 Bacteria 1889
369 Ga0466960_0072951 3300044901 Bacteria 1712
370 Ga0466960_0127815 3300044901 Bacteria 1338
371 Ga0466960_0255806 3300044901 Bacteria 974
372 Ga0466959_0015322 3300045049 Bacteria 5582
373 Ga0466959_0048861 3300045049 Bacteria 3108
374 Ga0466959_0124646 3300045049 Bacteria 1829
375 Ga0466959_0342222 3300045049 Bacteria 1020
376 Ga0466958_0015000 3300045836 Bacteria 4434
377 Ga0466958_0031318 3300045836 Bacteria 3161
378 Ga0466958_0054453 3300045836 Bacteria 2426
379 Ga0466958_0086378 3300045836 Bacteria 1936
380 Ga0466958_0156227 3300045836 Bacteria 1440
381 Ga0466958_0237130 3300045836 Bacteria 1165
382 Ga0466967_0015938 3300045976 Bacteria 5908
383 Ga0466967_0031676 3300045976 Bacteria 4455
384 Ga0466967_0032594 3300045976 Bacteria 4401
385 Ga0466967_0032951 3300045976 Bacteria 4381
386 Ga0466967_0033244 3300045976 Bacteria 4364
387 Ga0466967_0151193 3300045976 Bacteria 2170
388 Ga0466967_0181230 3300045976 Bacteria 1987
389 Ga0466967_0211355 3300045976 Bacteria 1840
390 Ga0466967_0211614 3300045976 Bacteria 1839
391 Ga0466967_0365590 3300045976 Bacteria 1398
392 Ga0466967_0398483 3300045976 Bacteria 1339
393 Ga0466967_0467133 3300045976 Bacteria 1235
394 Ga0466967_0477975 3300045976 Bacteria 1220
395 Ga0466967_0502994 3300045976 Bacteria 1189
396 Ga0495592_0059336 3300046454 Bacteria 2818
397 Ga0495592_0108552 3300046454 Bacteria 1967
398 Ga0495629_0009584 3300046459 Bacteria 7075
399 Ga0495629_0108122 3300046459 Bacteria 1940
400 Ga0495641_0063347 3300046461 Bacteria 1667
401 Ga0495651_0050468 3300046462 Bacteria 3209
402 Ga0495651_0071817 3300046462 Bacteria 2630
403 Ga0495653_0025801 3300046463 Bacteria 4715
404 Ga0495653_0123711 3300046463 Bacteria 1839
405 Ga0495653_0125888 3300046463 Bacteria 1820
406 Ga0495650_0000055 3300046471 Bacteria 308438
407 Ga0495582_0002461 3300046473 Bacteria 10322
408 Ga0495582_0192998 3300046473 Bacteria 1162
409 Ga0495662_0002246 3300046476 Bacteria 9742
410 Ga0495664_0000007 3300046477 Bacteria 386710
411 Ga0495664_0034980 3300046477 Bacteria 2956
412 Ga0495584_0076694 3300046491 Bacteria 1681
413 Ga0495608_0005880 3300046511 Bacteria 8731
414 Ga0495608_0019271 3300046511 Bacteria 4697
415 Ga0495618_0019416 3300046514 Bacteria 4181
416 Ga0495628_0029687 3300046516 Bacteria 4432
417 Ga0495628_0084420 3300046516 Bacteria 2464
418 Ga0495628_0147130 3300046516 Bacteria 1795
419 Ga0495630_0083663 3300046517 Bacteria 2409
420 Ga0495652_0058249 3300046529 Bacteria 3272
421 Ga0495665_0014736 3300046531 Bacteria 4213
422 Ga0495640_0014300 3300046533 Bacteria 6009
423 Ga0495640_0026590 3300046533 Bacteria 4179
424 Ga0495640_0061625 3300046533 Bacteria 2547
425 Ga0495587_0013976 3300046536 Bacteria 5040
426 Ga0495587_0047062 3300046536 Bacteria 2558
427 Ga0495645_0027079 3300046543 Bacteria 4164
428 Ga0495645_0059517 3300046543 Bacteria 2769
429 Ga0495645_0073654 3300046543 Bacteria 2460
430 Ga0495667_0015912 3300046559 Bacteria 5084
431 Ga0495667_0043026 3300046559 Bacteria 2994
432 Ga0495667_0108385 3300046559 Bacteria 1794
433 Ga0495634_0012983 3300046642 Bacteria 6026
434 Ga0495634_0047775 3300046642 Bacteria 2883
435 Ga0495634_0075685 3300046642 Bacteria 2210
436 Ga0495635_0015413 3300046663 Bacteria 5346
437 Ga0495635_0017163 3300046663 Bacteria 5055
438 Ga0495657_0008803 3300046675 Bacteria 7689
439 Ga0495657_0035590 3300046675 Bacteria 3449
440 Ga0495599_0052435 3300046678 Bacteria 2555
441 Ga0495623_0044627 3300046679 Bacteria 2816
442 Ga0495646_0007330 3300046680 Bacteria 7008
443 Ga0495646_0028962 3300046680 Bacteria 3465
444 Ga0495613_0028770 3300046689 Bacteria 4133
445 Ga0495624_0007724 3300046690 Bacteria 7545
446 Ga0495600_0001528 3300046809 Bacteria 12859
447 Ga0495600_0002882 3300046809 Bacteria 10025
448 Ga0495581_0004445 3300047315 Bacteria 8102
449 Ga0495581_0174254 3300047315 Bacteria 1258
450 Ga0495604_0008977 3300047317 Bacteria 7905
451 Ga0495674_0024765 3300047319 Bacteria 5510
452 Ga0495672_0017893 3300047320 Bacteria 4727
453 Ga0495680_0006646 3300047322 Bacteria 10708
454 Ga0495593_0014761 3300047673 Bacteria 4439
455 Ga0495593_0025346 3300047673 Bacteria 3283
456 Ga0495602_0011820 3300048088 Bacteria 9015
457 Ga0495602_0050424 3300048088 Bacteria 3718
458 Ga0496100_0000470 3300048903 Bacteria 19279
459 Ga0496100_0067633 3300048903 Bacteria 2373
460 Ga0496100_0192128 3300048903 Bacteria 1483
461 Ga0496100_0284208 3300048903 Bacteria 1234
462 Ga0496101_0006054 3300048904 Bacteria 7763
463 Ga0496101_0249731 3300048904 Bacteria 1382
464 Ga0496101_0337790 3300048904 Bacteria 1183
465 Ga0496102_0002009 3300048905 Bacteria 17567
466 Ga0496102_0042064 3300048905 Bacteria 4140
467 Ga0496103_0007363 3300048906 Bacteria 6560
468 Ga0496103_0206906 3300048906 Bacteria 1262
469 Ga0496104_0000001 3300048907 Bacteria 711867
470 Ga0496104_0006133 3300048907 Bacteria 10549
471 Ga0496104_0008487 3300048907 Bacteria 9136
472 Ga0496104_0018652 3300048907 Bacteria 6333
473 Ga0496104_0062923 3300048907 Bacteria 3519
474 Ga0496104_0092737 3300048907 Bacteria 2888
475 Ga0496104_0100929 3300048907 Bacteria 2763
476 Ga0496104_0572899 3300048907 Bacteria 1039
477 Ga0496105_0010539 3300048908 Bacteria 7271
478 Ga0496105_0054631 3300048908 Bacteria 3297
479 Ga0496105_0074603 3300048908 Bacteria 2802
480 Ga0496105_0102142 3300048908 Bacteria 2368
481 Ga0496105_0178117 3300048908 Bacteria 1741
482 Ga0496105_0235241 3300048908 Bacteria 1488
483 Ga0496105_0305440 3300048908 Bacteria 1278
484 Ga0496106_0004922 3300048909 Bacteria 9886
485 Ga0496106_0014586 3300048909 Bacteria 5807
486 Ga0496106_0029806 3300048909 Bacteria 4068
487 Ga0496106_0035052 3300048909 Bacteria 3750
488 Ga0496106_0208539 3300048909 Bacteria 1556
489 Ga0496107_0002555 3300048910 Bacteria 11866
490 Ga0496107_0004823 3300048910 Bacteria 9154
491 Ga0496107_0090571 3300048910 Bacteria 2234
492 Ga0496107_0256369 3300048910 Bacteria 1302
493 Ga0496107_0381366 3300048910 Bacteria 1049
494 Ga0496108_0002444 3300048911 Bacteria 14848
495 Ga0496109_0000635 3300048912 Bacteria 29263
496 Ga0496109_0032485 3300048912 Bacteria 4692
497 Ga0496109_0032943 3300048912 Bacteria 4661
498 Ga0496109_0041794 3300048912 Bacteria 4152
499 Ga0496109_0049207 3300048912 Bacteria 3837
500 Ga0496109_0151555 3300048912 Bacteria 2171
501 Ga0496109_0316464 3300048912 Bacteria 1473
502 Ga0496109_0500272 3300048912 Bacteria 1147
503 Ga0496109_0616855 3300048912 Bacteria 1021
504 Ga0496110_0000362 3300048913 Bacteria 30414
505 Ga0496110_0056299 3300048913 Bacteria 3460
506 Ga0496110_0056662 3300048913 Bacteria 3449
507 Ga0496110_0151702 3300048913 Bacteria 2098
508 Ga0496110_0162609 3300048913 Bacteria 2024
509 Ga0496110_0505657 3300048913 Bacteria 1100
510 Ga0496111_0004903 3300048914 Bacteria 8502
511 Ga0496111_0006736 3300048914 Bacteria 7481
512 Ga0496111_0041907 3300048914 Bacteria 3287
513 Ga0496111_0067181 3300048914 Bacteria 2604
514 Ga0496111_0083693 3300048914 Bacteria 2331
515 Ga0496111_0091325 3300048914 Bacteria 2231
516 Ga0496111_0183593 3300048914 Bacteria 1555
517 Ga0496112_0002049 3300048915 Bacteria 15972
518 Ga0496112_0029098 3300048915 Bacteria 5340
519 Ga0496112_0032894 3300048915 Bacteria 5036
520 Ga0496112_0118688 3300048915 Bacteria 2615
521 Ga0496112_0127213 3300048915 Bacteria 2518
522 Ga0496112_0191124 3300048915 Bacteria 2009
523 Ga0496112_0281279 3300048915 Bacteria 1611
524 Ga0496112_0316249 3300048915 Bacteria 1506
525 Ga0496112_0531990 3300048915 Bacteria 1110
526 Ga0496113_0008875 3300048916 Bacteria 6574
527 Ga0496113_0040688 3300048916 Bacteria 3426
528 Ga0496113_0043152 3300048916 Bacteria 3336
529 Ga0496113_0077657 3300048916 Bacteria 2539
530 Ga0496113_0134710 3300048916 Bacteria 1940
531 Ga0496113_0400016 3300048916 Bacteria 1103
532 Ga0496114_0000566 3300048917 Bacteria 27443
533 Ga0496114_0047621 3300048917 Bacteria 3566
534 Ga0496114_0102606 3300048917 Bacteria 2444
535 Ga0496115_0058979 3300048918 Bacteria 3090
536 Ga0496115_0080302 3300048918 Bacteria 2655
537 Ga0496115_0350726 3300048918 Bacteria 1204
538 Ga0496115_0404011 3300048918 Bacteria 1108
539 Ga0496121_0028323 3300048924 Bacteria 5218
540 Ga0496122_0034168 3300048925 Bacteria 4167
541 Ga0496123_0015211 3300048926 Bacteria 6327
542 Ga0496124_0071138 3300048927 Bacteria 2885
543 Ga0501034_0064304 3300049571 Bacteria 3683
544 Ga0501039_0181166 3300049575 Bacteria 1657
545 Ga0501067_0067500 3300049583 Bacteria 1980
546 Ga0501069_0003742 3300049585 Bacteria 7817
547 Ga0501070_0165021 3300049586 Bacteria 1825
548 Ga0501071_0013001 3300049587 Bacteria 5663
549 Ga0501071_0107687 3300049587 Bacteria 2058
550 Ga0501071_0225616 3300049587 Bacteria 1411
551 Ga0501072_0017135 3300049588 Bacteria 5567
552 Ga0501072_0260338 3300049588 Bacteria 1381
553 Ga0501075_0269676 3300049591 Bacteria 1297
554 Ga0501076_0288312 3300049592 Bacteria 1345
555 Ga0501077_0096301 3300049593 Bacteria 1876
556 Ga0501079_0030481 3300049741 Bacteria 4144
557 Ga0501079_0480102 3300049741 Bacteria 977
558 Ga0501080_0020957 3300049742 Bacteria 6049
559 nmdc:mga03n38_93966_c1 3300050490 Bacteria 1433
560 nmdc:mga00v17_130299_c1 3300050491 Bacteria 1607
561 nmdc:mga00v17_1601_c1 3300050491 Bacteria 11824
562 nmdc:mga00v17_22822_c1 3300050491 Bacteria 3615
563 nmdc:mga09592_10451_c1 3300050508 Bacteria 7552
564 nmdc:mga08y16_171869_c1 3300050511 Bacteria 2251
565 nmdc:mga08y16_333107_c1 3300050511 Bacteria 1561
566 nmdc:mga0a205_412617_c1 3300050515 Bacteria 1213
567 nmdc:mga0a205_62431_c1 3300050515 Bacteria 3599
568 Ga0495601_0025416 3300053077 Bacteria 3651
569 Ga0495601_0283457 3300053077 Bacteria 1080
570 Ga0495612_0006531 3300053078 Bacteria 4791
571 Ga0495595_0009349 3300053084 Bacteria 4053
572 Ga0495619_0035656 3300053085 Bacteria 3236
573 Ga0495619_0067645 3300053085 Bacteria 2385
574 Ga0495619_0081455 3300053085 Bacteria 2179
575 Ga0500554_009284 3300053102 Bacteria 2349
576 Ga0500616_0001555 3300053153 Bacteria 21520
577 Ga0500616_0045578 3300053153 Bacteria 2335
578 Ga0501082_0027429 3300060353 Bacteria 4903
579 Ga0466962_0017629 3300061719 Bacteria 3438
580 Ga0466962_0028461 3300061719 Bacteria 2677
581 Ga0530510_0033367 3300061734 Bacteria 3707

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100082952 Ga0070706_1000829524 233
2 3300005471 Ga0070698_100143968 Ga0070698_1001439682 233
3 3300005518 Ga0070699_100079395 Ga0070699_1000793953 233
4 3300006028 Ga0070717_10009518 Ga0070717_100095187 233
5 3300025910 Ga0207684_10491536 Ga0207684_104915361 233
6 3300025922 Ga0207646_10065164 Ga0207646_100651641 233
7 3300005536 Ga0070697_100001164 Ga0070697_10000116410 234
8 3300048925 Ga0496122_0034168 Ga0496122_0034168_116_1075 258
9 3300041413 Ga0439465_0013322 Ga0439465_0013322_595_1521 260
10 3300042004 Ga0439445_0012291 Ga0439445_0012291_995_1915 260
11 3300048088 Ga0495602_0050424 Ga0495602_0050424_39_881 264
12 3300046491 Ga0495584_0076694 Ga0495584_0076694_201_1124 265
13 3300048926 Ga0496123_0015211 Ga0496123_0015211_5493_6308 266
14 iso_pu_bacteria 2643221961 2645719520 266
15 3300041413 Ga0439465_0050632 Ga0439465_0050632_371_1291 267
16 3300044684 Ga0466966_0166802 Ga0466966_0166802_29_841 268
17 3300035171 Ga0373946_0042948 Ga0373946_0042948_783_1706 269
18 3300046473 Ga0495582_0192998 Ga0495582_0192998_176_1099 269
19 3300005937 Ga0081455_10000061 Ga0081455_1000006199 270
20 3300048910 Ga0496107_0381366 Ga0496107_0381366_130_1023 270
21 3300048927 Ga0496124_0071138 Ga0496124_0071138_1474_2358 270
22 3300045976 Ga0466967_0032951 Ga0466967_0032951_480_1304 272
23 3300031731 Ga0307405_10042222 Ga0307405_100422223 273
24 3300031824 Ga0307413_10216807 Ga0307413_102168072 273
25 3300031995 Ga0307409_100279231 Ga0307409_1002792312 273
26 3300005435 Ga0070714_100320762 Ga0070714_1003207622 274
27 3300045976 Ga0466967_0151193 Ga0466967_0151193_783_1706 274
28 3300021388 Ga0213875_10005976 Ga0213875_100059764 276
29 3300031548 Ga0307408_100185731 Ga0307408_1001857312 276
30 3300031852 Ga0307410_10073994 Ga0307410_100739943 276
31 3300031903 Ga0307407_10108736 Ga0307407_101087362 276
32 3300032002 Ga0307416_100182629 Ga0307416_1001826293 276
33 3300037853 Ga0436364_0680087 Ga0436364_0680087_1200_2081 276
34 3300044765 Ga0466970_0255684 Ga0466970_0255684_37_909 276
35 3300045836 Ga0466958_0086378 Ga0466958_0086378_67_915 276
36 3300045976 Ga0466967_0015938 Ga0466967_0015938_3157_4035 276
37 3300045976 Ga0466967_0502994 Ga0466967_0502994_73_942 276
38 3300047315 Ga0495581_0174254 Ga0495581_0174254_359_1207 276
39 3300005329 Ga0070683_100000273 Ga0070683_10000027334 277
40 3300005341 Ga0070691_10002612 Ga0070691_100026124 277
41 3300005435 Ga0070714_100020329 Ga0070714_1000203294 277
42 3300005436 Ga0070713_100000482 Ga0070713_10000048214 277
43 3300005535 Ga0070684_100001353 Ga0070684_1000013535 277
44 3300005577 Ga0068857_100002277 Ga0068857_10000227712 277
45 3300005614 Ga0068856_100028706 Ga0068856_1000287062 277
46 3300006028 Ga0070717_10261613 Ga0070717_102616131 277
47 3300013105 Ga0157369_10017241 Ga0157369_100172412 277
48 3300025928 Ga0207700_10002830 Ga0207700_100028304 277
49 3300025929 Ga0207664_10021019 Ga0207664_100210193 277
50 3300025944 Ga0207661_10001985 Ga0207661_100019852 277
51 3300025945 Ga0207679_10002540 Ga0207679_100025403 277
52 3300026078 Ga0207702_10002389 Ga0207702_100023894 277
53 3300026116 Ga0207674_10001810 Ga0207674_1000181012 277
54 3300044684 Ga0466966_0246315 Ga0466966_0246315_174_1031 277
55 3300044842 Ga0466957_0208819 Ga0466957_0208819_88_945 277
56 3300048908 Ga0496105_0235241 Ga0496105_0235241_174_1160 277
57 3300048912 Ga0496109_0151555 Ga0496109_0151555_421_1407 277
58 3300050511 nmdc:mga08y16_333107_c1 nmdc:mga08y16_333107_c1_34_921 277
59 3300003659 JGI25404J52841_10006763 JGI25404J52841_100067633 278
60 3300025928 Ga0207700_10318488 Ga0207700_103184882 278
61 3300042876 Ga0451577_0085975 Ga0451577_0085975_107_976 278
62 3300044694 Ga0466963_0291942 Ga0466963_0291942_238_1116 278
63 3300048907 Ga0496104_0092737 Ga0496104_0092737_743_1621 278
64 3300050491 nmdc:mga00v17_130299_c1 nmdc:mga00v17_130299_c1_468_1406 278
65 iso_pu_bacteria 2643221962 2645726427 278
66 3300005329 Ga0070683_100085500 Ga0070683_1000855003 279
67 3300005336 Ga0070680_100055512 Ga0070680_1000555124 279
68 3300005337 Ga0070682_100087690 Ga0070682_1000876902 279
69 3300005339 Ga0070660_100160760 Ga0070660_1001607601 279
70 3300005344 Ga0070661_100217614 Ga0070661_1002176142 279
71 3300005364 Ga0070673_100236661 Ga0070673_1002366612 279
72 3300005441 Ga0070700_100151883 Ga0070700_1001518832 279
73 3300005455 Ga0070663_100109588 Ga0070663_1001095882 279
74 3300005456 Ga0070678_100002983 Ga0070678_10000298312 279
75 3300005458 Ga0070681_10023828 Ga0070681_100238285 279
76 3300005530 Ga0070679_100050313 Ga0070679_1000503134 279
77 3300005535 Ga0070684_100001222 Ga0070684_10000122218 279
78 3300005547 Ga0070693_100003064 Ga0070693_1000030646 279
79 3300005614 Ga0068856_100010876 Ga0068856_1000108769 279
80 3300005615 Ga0070702_100060083 Ga0070702_1000600833 279
81 3300006358 Ga0068871_100239102 Ga0068871_1002391022 279
82 3300009148 Ga0105243_10027181 Ga0105243_100271813 279
83 3300009174 Ga0105241_10123667 Ga0105241_101236672 279
84 3300009553 Ga0105249_10337195 Ga0105249_103371952 279
85 3300011119 Ga0105246_10163516 Ga0105246_101635162 279
86 3300013308 Ga0157375_10012778 Ga0157375_100127786 279
87 3300014969 Ga0157376_10116556 Ga0157376_101165562 279
88 3300025917 Ga0207660_10041400 Ga0207660_100414004 279
89 3300025919 Ga0207657_10139030 Ga0207657_101390302 279
90 3300025920 Ga0207649_10025548 Ga0207649_100255483 279
91 3300025921 Ga0207652_10110518 Ga0207652_101105184 279
92 3300025935 Ga0207709_10010699 Ga0207709_100106993 279
93 3300025944 Ga0207661_10002631 Ga0207661_1000263110 279
94 3300025945 Ga0207679_10017050 Ga0207679_100170504 279
95 3300026067 Ga0207678_10184061 Ga0207678_101840612 279
96 3300026078 Ga0207702_10006607 Ga0207702_100066073 279
97 3300026121 Ga0207683_10002893 Ga0207683_100028939 279
98 3300031903 Ga0307407_10094006 Ga0307407_100940062 279
99 3300031995 Ga0307409_100258019 Ga0307409_1002580192 279
100 3300032002 Ga0307416_100342664 Ga0307416_1003426641 279
101 3300044694 Ga0466963_0226857 Ga0466963_0226857_236_1096 279
102 3300048903 Ga0496100_0284208 Ga0496100_0284208_110_982 279
103 3300048905 Ga0496102_0002009 Ga0496102_0002009_670_1542 279
104 3300048906 Ga0496103_0007363 Ga0496103_0007363_5040_5912 279
105 3300048907 Ga0496104_0018652 Ga0496104_0018652_2400_3272 279
106 3300048908 Ga0496105_0010539 Ga0496105_0010539_2461_3333 279
107 3300048917 Ga0496114_0000566 Ga0496114_0000566_20922_21794 279
108 3300049587 Ga0501071_0225616 Ga0501071_0225616_351_1271 279
109 3300049591 Ga0501075_0269676 Ga0501075_0269676_225_1145 279
110 3300005327 Ga0070658_10140827 Ga0070658_101408272 280
111 3300005329 Ga0070683_100146238 Ga0070683_1001462382 280
112 3300005455 Ga0070663_100148620 Ga0070663_1001486202 280
113 3300005457 Ga0070662_100085307 Ga0070662_1000853073 280
114 3300009148 Ga0105243_10458144 Ga0105243_104581442 280
115 3300013105 Ga0157369_10454113 Ga0157369_104541132 280
116 3300013306 Ga0163162_10377765 Ga0163162_103777652 280
117 3300014326 Ga0157380_10522032 Ga0157380_105220321 280
118 3300014745 Ga0157377_10111855 Ga0157377_101118552 280
119 3300020081 Ga0206354_10937210 Ga0206354_109372101 280
120 3300021384 Ga0213876_10051944 Ga0213876_100519444 280
121 3300025933 Ga0207706_10060281 Ga0207706_100602813 280
122 3300025937 Ga0207669_10056703 Ga0207669_100567032 280
123 3300025944 Ga0207661_10130597 Ga0207661_101305972 280
124 3300025945 Ga0207679_10151163 Ga0207679_101511632 280
125 3300025981 Ga0207640_10044456 Ga0207640_100444563 280
126 3300026023 Ga0207677_10072368 Ga0207677_100723684 280
127 3300026075 Ga0207708_10087204 Ga0207708_100872043 280
128 3300031548 Ga0307408_100048614 Ga0307408_1000486142 280
129 3300031731 Ga0307405_10119470 Ga0307405_101194702 280
130 3300031824 Ga0307413_10183290 Ga0307413_101832902 280
131 3300031824 Ga0307413_10201985 Ga0307413_102019852 280
132 3300031852 Ga0307410_10256255 Ga0307410_102562552 280
133 3300031901 Ga0307406_10012775 Ga0307406_100127752 280
134 3300031901 Ga0307406_10173302 Ga0307406_101733022 280
135 3300031901 Ga0307406_10280898 Ga0307406_102808981 280
136 3300031903 Ga0307407_10009600 Ga0307407_100096004 280
137 3300031903 Ga0307407_10016601 Ga0307407_100166013 280
138 3300031911 Ga0307412_10049095 Ga0307412_100490952 280
139 3300031995 Ga0307409_100025701 Ga0307409_1000257012 280
140 3300031995 Ga0307409_100072101 Ga0307409_1000721011 280
141 3300031995 Ga0307409_100074615 Ga0307409_1000746153 280
142 3300031995 Ga0307409_100422066 Ga0307409_1004220662 280
143 3300032002 Ga0307416_100056864 Ga0307416_1000568644 280
144 3300032002 Ga0307416_100270451 Ga0307416_1002704512 280
145 3300032002 Ga0307416_100347051 Ga0307416_1003470512 280
146 3300032004 Ga0307414_10450940 Ga0307414_104509401 280
147 3300032126 Ga0307415_100017461 Ga0307415_1000174614 280
148 3300032126 Ga0307415_100239678 Ga0307415_1002396782 280
149 3300032126 Ga0307415_100289327 Ga0307415_1002893271 280
150 3300035725 Ga0373947_0205173 Ga0373947_0205173_243_1109 280
151 3300037418 Ga0395900_0026768 Ga0395900_0026768_4340_5245 280
152 3300037466 Ga0395898_0072226 Ga0395898_0072226_1381_2286 280
153 3300037466 Ga0395898_0159101 Ga0395898_0159101_506_1411 280
154 3300039437 Ga0436365_1286349 Ga0436365_1286349_1344_2231 280
155 3300041413 Ga0439465_0013641 Ga0439465_0013641_401_1285 280
156 3300044684 Ga0466966_0232134 Ga0466966_0232134_173_1078 280
157 3300044693 Ga0466961_0063738 Ga0466961_0063738_904_1821 280
158 3300044694 Ga0466963_0045551 Ga0466963_0045551_481_1392 280
159 3300044765 Ga0466970_0035870 Ga0466970_0035870_660_1577 280
160 3300044842 Ga0466957_0214908 Ga0466957_0214908_126_1100 280
161 3300044901 Ga0466960_0037284 Ga0466960_0037284_831_1736 280
162 3300044901 Ga0466960_0072951 Ga0466960_0072951_697_1563 280
163 3300044901 Ga0466960_0127815 Ga0466960_0127815_76_981 280
164 3300044901 Ga0466960_0255806 Ga0466960_0255806_25_918 280
165 3300045836 Ga0466958_0156227 Ga0466958_0156227_437_1348 280
166 3300045976 Ga0466967_0031676 Ga0466967_0031676_2879_3784 280
167 3300045976 Ga0466967_0033244 Ga0466967_0033244_2116_3021 280
168 3300045976 Ga0466967_0398483 Ga0466967_0398483_15_992 280
169 3300048915 Ga0496112_0531990 Ga0496112_0531990_79_963 280
170 3300049587 Ga0501071_0107687 Ga0501071_0107687_864_1751 280
171 3300049588 Ga0501072_0017135 Ga0501072_0017135_143_1030 280
172 iso_pu_bacteria 2643221649 2644279834 280
173 3300005436 Ga0070713_100444784 Ga0070713_1004447842 281
174 3300005468 Ga0070707_100014238 Ga0070707_1000142383 281
175 3300006051 Ga0075364_10009834 Ga0075364_100098343 281
176 3300009148 Ga0105243_10116023 Ga0105243_101160232 281
177 3300025906 Ga0207699_10242547 Ga0207699_102425472 281
178 3300025935 Ga0207709_10092095 Ga0207709_100920952 281
179 3300034820 Ga0373959_0000036 Ga0373959_0000036_3005_3934 281
180 3300035111 Ga0373923_0020647 Ga0373923_0020647_1346_2251 281
181 3300035113 Ga0373936_0006445 Ga0373936_0006445_3403_4308 281
182 3300035117 Ga0373953_0070870 Ga0373953_0070870_145_1050 281
183 3300035118 Ga0373954_0089328 Ga0373954_0089328_260_1165 281
184 3300035119 Ga0373956_0008238 Ga0373956_0008238_2838_3743 281
185 3300035120 Ga0373957_0000714 Ga0373957_0000714_7539_8444 281
186 3300035170 Ga0373943_0087361 Ga0373943_0087361_587_1492 281
187 3300035172 Ga0373955_0004537 Ga0373955_0004537_1585_2490 281
188 3300035410 Ga0373924_0000429 Ga0373924_0000429_4358_5263 281
189 3300035692 Ga0373935_0018471 Ga0373935_0018471_2145_3050 281
190 3300037312 Ga0395899_0099440 Ga0395899_0099440_1154_2083 281
191 3300037471 Ga0395905_0181580 Ga0395905_0181580_1028_1957 281
192 3300037853 Ga0436364_0650330 Ga0436364_0650330_94_1011 281
193 3300038443 Ga0395901_0021587 Ga0395901_0021587_2638_3567 281
194 3300039450 Ga0436363_0666383 Ga0436363_0666383_260_1129 281
195 3300045976 Ga0466967_0365590 Ga0466967_0365590_53_922 281
196 3300045976 Ga0466967_0467133 Ga0466967_0467133_116_985 281
197 3300046459 Ga0495629_0009584 Ga0495629_0009584_3325_4230 281
198 3300046462 Ga0495651_0071817 Ga0495651_0071817_394_1299 281
199 3300046463 Ga0495653_0123711 Ga0495653_0123711_873_1778 281
200 3300046473 Ga0495582_0002461 Ga0495582_0002461_9202_10107 281
201 3300046476 Ga0495662_0002246 Ga0495662_0002246_297_1202 281
202 3300046477 Ga0495664_0034980 Ga0495664_0034980_252_1157 281
203 3300046511 Ga0495608_0019271 Ga0495608_0019271_595_1500 281
204 3300046516 Ga0495628_0147130 Ga0495628_0147130_476_1381 281
205 3300046531 Ga0495665_0014736 Ga0495665_0014736_3050_3955 281
206 3300046533 Ga0495640_0014300 Ga0495640_0014300_4717_5622 281
207 3300046536 Ga0495587_0013976 Ga0495587_0013976_3574_4479 281
208 3300046543 Ga0495645_0059517 Ga0495645_0059517_193_1098 281
209 3300046543 Ga0495645_0073654 Ga0495645_0073654_151_1056 281
210 3300046559 Ga0495667_0108385 Ga0495667_0108385_522_1427 281
211 3300046642 Ga0495634_0012983 Ga0495634_0012983_476_1381 281
212 3300046663 Ga0495635_0015413 Ga0495635_0015413_3966_4871 281
213 3300046675 Ga0495657_0035590 Ga0495657_0035590_873_1778 281
214 3300046678 Ga0495599_0052435 Ga0495599_0052435_873_1778 281
215 3300046680 Ga0495646_0028962 Ga0495646_0028962_2146_3051 281
216 3300046689 Ga0495613_0028770 Ga0495613_0028770_161_1066 281
217 3300046690 Ga0495624_0007724 Ga0495624_0007724_155_1060 281
218 3300046809 Ga0495600_0001528 Ga0495600_0001528_8459_9364 281
219 3300047315 Ga0495581_0004445 Ga0495581_0004445_7079_7984 281
220 3300047673 Ga0495593_0014761 Ga0495593_0014761_3338_4243 281
221 3300049575 Ga0501039_0181166 Ga0501039_0181166_698_1591 281
222 3300049583 Ga0501067_0067500 Ga0501067_0067500_1030_1920 281
223 3300049741 Ga0501079_0480102 Ga0501079_0480102_52_966 281
224 3300050491 nmdc:mga00v17_1601_c1 nmdc:mga00v17_1601_c1_6217_7146 281
225 3300053078 Ga0495612_0006531 Ga0495612_0006531_2790_3695 281
226 3300053085 Ga0495619_0081455 Ga0495619_0081455_625_1530 281
227 3300053102 Ga0500554_009284 Ga0500554_009284_814_1716 281
228 3300005434 Ga0070709_10006089 Ga0070709_100060893 282
229 3300005435 Ga0070714_100029533 Ga0070714_1000295334 282
230 3300005435 Ga0070714_100029681 Ga0070714_1000296814 282
231 3300005436 Ga0070713_100043399 Ga0070713_1000433992 282
232 3300005437 Ga0070710_10014749 Ga0070710_100147492 282
233 3300005439 Ga0070711_100284466 Ga0070711_1002844661 282
234 3300006028 Ga0070717_10256769 Ga0070717_102567692 282
235 3300006173 Ga0070716_100062528 Ga0070716_1000625282 282
236 3300006175 Ga0070712_100042477 Ga0070712_1000424772 282
237 3300025906 Ga0207699_10089203 Ga0207699_100892032 282
238 3300025915 Ga0207693_10034195 Ga0207693_100341952 282
239 3300025928 Ga0207700_10002355 Ga0207700_100023552 282
240 3300025928 Ga0207700_10007455 Ga0207700_100074552 282
241 3300025929 Ga0207664_10004846 Ga0207664_100048467 282
242 3300025939 Ga0207665_10002563 Ga0207665_1000256311 282
243 3300044683 Ga0466965_0143556 Ga0466965_0143556_163_1080 282
244 3300049593 Ga0501077_0096301 Ga0501077_0096301_812_1735 282
245 iso_pu_bacteria 2643221681 2644457272 282
246 3300005354 Ga0070675_100408169 Ga0070675_1004081691 283
247 3300005366 Ga0070659_100000030 Ga0070659_100000030107 283
248 3300005435 Ga0070714_100000228 Ga0070714_10000022841 283
249 3300005435 Ga0070714_100014755 Ga0070714_1000147552 283
250 3300005437 Ga0070710_10000009 Ga0070710_10000009148 283
251 3300005440 Ga0070705_100001133 Ga0070705_1000011334 283
252 3300005441 Ga0070700_100099772 Ga0070700_1000997723 283
253 3300006028 Ga0070717_10000013 Ga0070717_1000001321 283
254 3300006175 Ga0070712_100000003 Ga0070712_100000003107 283
255 3300009093 Ga0105240_10073705 Ga0105240_100737056 283
256 3300009176 Ga0105242_10516851 Ga0105242_105168512 283
257 3300010375 Ga0105239_10124568 Ga0105239_101245683 283
258 3300011119 Ga0105246_10063300 Ga0105246_100633002 283
259 3300025898 Ga0207692_10000005 Ga0207692_10000005179 283
260 3300025915 Ga0207693_10000009 Ga0207693_1000000917 283
261 3300025929 Ga0207664_10000060 Ga0207664_1000006040 283
262 3300025929 Ga0207664_10002459 Ga0207664_1000245911 283
263 3300025932 Ga0207690_10000328 Ga0207690_1000032810 283
264 3300026075 Ga0207708_10135339 Ga0207708_101353393 283
265 3300028558 Ga0265326_10000024 Ga0265326_1000002472 283
266 3300028563 Ga0265319_1000116 Ga0265319_100011646 283
267 3300028573 Ga0265334_10000151 Ga0265334_100001514 283
268 3300028666 Ga0265336_10006718 Ga0265336_100067181 283
269 3300028800 Ga0265338_10001994 Ga0265338_1000199424 283
270 3300029957 Ga0265324_10008959 Ga0265324_100089592 283
271 3300031251 Ga0265327_10031394 Ga0265327_100313943 283
272 3300031903 Ga0307407_10068501 Ga0307407_100685012 283
273 3300031995 Ga0307409_100092499 Ga0307409_1000924992 283
274 3300044694 Ga0466963_0071048 Ga0466963_0071048_533_1459 283
275 3300044719 Ga0466971_0027622 Ga0466971_0027622_943_1869 283
276 3300044842 Ga0466957_0015199 Ga0466957_0015199_1621_2547 283
277 3300044901 Ga0466960_0058071 Ga0466960_0058071_633_1562 283
278 3300047320 Ga0495672_0017893 Ga0495672_0017893_3143_4000 283
279 3300048903 Ga0496100_0000470 Ga0496100_0000470_7074_7934 283
280 3300048904 Ga0496101_0006054 Ga0496101_0006054_370_1230 283
281 3300048912 Ga0496109_0032485 Ga0496109_0032485_1293_2153 283
282 3300049585 Ga0501069_0003742 Ga0501069_0003742_1801_2658 283
283 3300049741 Ga0501079_0030481 Ga0501079_0030481_229_1086 283
284 3300049742 Ga0501080_0020957 Ga0501080_0020957_83_940 283
285 3300050508 nmdc:mga09592_10451_c1 nmdc:mga09592_10451_c1_1231_2091 283
286 3300050515 nmdc:mga0a205_412617_c1 nmdc:mga0a205_412617_c1_325_1185 283
287 3300061719 Ga0466962_0017629 Ga0466962_0017629_2226_3152 283
288 3300005329 Ga0070683_100037529 Ga0070683_1000375292 284
289 3300005353 Ga0070669_100001519 Ga0070669_10000151914 284
290 3300005937 Ga0081455_10014973 Ga0081455_100149733 284
291 3300006880 Ga0075429_100011965 Ga0075429_1000119655 284
292 3300025906 Ga0207699_10190624 Ga0207699_101906242 284
293 3300025923 Ga0207681_10003140 Ga0207681_100031408 284
294 3300026089 Ga0207648_10098033 Ga0207648_100980333 284
295 3300035724 Ga0373933_0101262 Ga0373933_0101262_68_997 284
296 3300039437 Ga0436365_0066499 Ga0436365_0066499_194_1135 284
297 3300045049 Ga0466959_0124646 Ga0466959_0124646_292_1218 284
298 3300045836 Ga0466958_0054453 Ga0466958_0054453_1403_2329 284
299 3300045976 Ga0466967_0181230 Ga0466967_0181230_320_1234 284
300 3300046454 Ga0495592_0108552 Ga0495592_0108552_818_1747 284
301 3300046463 Ga0495653_0125888 Ga0495653_0125888_519_1448 284
302 3300046477 Ga0495664_0000007 Ga0495664_0000007_324412_325290 284
303 3300046516 Ga0495628_0084420 Ga0495628_0084420_99_1028 284
304 3300046529 Ga0495652_0058249 Ga0495652_0058249_118_1047 284
305 3300046533 Ga0495640_0026590 Ga0495640_0026590_1246_2175 284
306 3300046543 Ga0495645_0027079 Ga0495645_0027079_1483_2412 284
307 3300046559 Ga0495667_0043026 Ga0495667_0043026_1466_2395 284
308 3300046642 Ga0495634_0075685 Ga0495634_0075685_1254_2183 284
309 3300048915 Ga0496112_0002049 Ga0496112_0002049_4877_5755 284
310 3300048916 Ga0496113_0077657 Ga0496113_0077657_663_1532 284
311 3300053077 Ga0495601_0025416 Ga0495601_0025416_1659_2588 284
312 3300053085 Ga0495619_0067645 Ga0495619_0067645_126_1055 284
313 3300005458 Ga0070681_10172230 Ga0070681_101722302 285
314 3300005937 Ga0081455_10012210 Ga0081455_100122108 285
315 3300005981 Ga0081538_10004166 Ga0081538_100041664 285
316 3300005985 Ga0081539_10030182 Ga0081539_100301823 285
317 3300031995 Ga0307409_100003756 Ga0307409_1000037563 285
318 3300031995 Ga0307409_100107783 Ga0307409_1001077831 285
319 3300032002 Ga0307416_100053336 Ga0307416_1000533363 285
320 3300032005 Ga0307411_10136864 Ga0307411_101368641 285
321 3300032126 Ga0307415_100004089 Ga0307415_1000040893 285
322 3300037418 Ga0395900_0252665 Ga0395900_0252665_39_908 285
323 3300038443 Ga0395901_0239235 Ga0395901_0239235_599_1468 285
324 3300045976 Ga0466967_0211614 Ga0466967_0211614_288_1154 285
325 3300048908 Ga0496105_0074603 Ga0496105_0074603_1640_2629 285
326 3300048912 Ga0496109_0000635 Ga0496109_0000635_2193_3128 285
327 3300005338 Ga0068868_100087153 Ga0068868_1000871532 286
328 3300005355 Ga0070671_100309627 Ga0070671_1003096272 286
329 3300005435 Ga0070714_100043792 Ga0070714_1000437924 286
330 3300005466 Ga0070685_10113676 Ga0070685_101136762 286
331 3300005578 Ga0068854_100103784 Ga0068854_1001037842 286
332 3300005617 Ga0068859_100532309 Ga0068859_1005323091 286
333 3300005719 Ga0068861_100183417 Ga0068861_1001834172 286
334 3300005842 Ga0068858_100261857 Ga0068858_1002618572 286
335 3300005981 Ga0081538_10027953 Ga0081538_100279533 286
336 3300006881 Ga0068865_100129908 Ga0068865_1001299082 286
337 3300006931 Ga0097620_100532296 Ga0097620_1005322961 286
338 3300009148 Ga0105243_10184345 Ga0105243_101843452 286
339 3300009553 Ga0105249_10149050 Ga0105249_101490503 286
340 3300011119 Ga0105246_10114548 Ga0105246_101145482 286
341 3300013104 Ga0157370_10154667 Ga0157370_101546672 286
342 3300025901 Ga0207688_10033001 Ga0207688_100330013 286
343 3300025931 Ga0207644_10302278 Ga0207644_103022781 286
344 3300025933 Ga0207706_10243218 Ga0207706_102432182 286
345 3300025938 Ga0207704_10046266 Ga0207704_100462662 286
346 3300025961 Ga0207712_10131473 Ga0207712_101314732 286
347 3300026035 Ga0207703_10711816 Ga0207703_107118161 286
348 3300031824 Ga0307413_10037024 Ga0307413_100370243 286
349 3300032002 Ga0307416_100367108 Ga0307416_1003671082 286
350 3300032002 Ga0307416_100652331 Ga0307416_1006523312 286
351 3300032126 Ga0307415_100021281 Ga0307415_1000212813 286
352 3300037418 Ga0395900_0024961 Ga0395900_0024961_3084_4076 286
353 3300037418 Ga0395900_0180330 Ga0395900_0180330_1134_1997 286
354 3300042016 Ga0439463_001759 Ga0439463_001759_1753_2709 286
355 3300044656 Ga0466969_0029978 Ga0466969_0029978_1875_2741 286
356 3300044684 Ga0466966_0074136 Ga0466966_0074136_329_1195 286
357 3300044694 Ga0466963_0067035 Ga0466963_0067035_1001_1867 286
358 3300044735 Ga0466968_0030526 Ga0466968_0030526_198_1064 286
359 3300045049 Ga0466959_0048861 Ga0466959_0048861_1472_2338 286
360 3300045836 Ga0466958_0031318 Ga0466958_0031318_1898_2764 286
361 3300045976 Ga0466967_0211355 Ga0466967_0211355_430_1296 286
362 3300045976 Ga0466967_0477975 Ga0466967_0477975_16_987 286
363 3300048903 Ga0496100_0067633 Ga0496100_0067633_875_1807 286
364 3300048907 Ga0496104_0000001 Ga0496104_0000001_624140_625069 286
365 3300048909 Ga0496106_0004922 Ga0496106_0004922_8503_9435 286
366 3300048909 Ga0496106_0029806 Ga0496106_0029806_120_989 286
367 3300048909 Ga0496106_0208539 Ga0496106_0208539_68_991 286
368 3300048910 Ga0496107_0002555 Ga0496107_0002555_8999_9931 286
369 3300048910 Ga0496107_0256369 Ga0496107_0256369_264_1133 286
370 3300048912 Ga0496109_0032943 Ga0496109_0032943_2033_2956 286
371 3300048912 Ga0496109_0316464 Ga0496109_0316464_360_1229 286
372 3300048913 Ga0496110_0151702 Ga0496110_0151702_24_947 286
373 3300048914 Ga0496111_0004903 Ga0496111_0004903_1647_2570 286
374 3300048914 Ga0496111_0183593 Ga0496111_0183593_486_1355 286
375 3300048915 Ga0496112_0118688 Ga0496112_0118688_306_1229 286
376 3300048916 Ga0496113_0040688 Ga0496113_0040688_367_1290 286
377 3300049588 Ga0501072_0260338 Ga0501072_0260338_68_985 286
378 3300050490 nmdc:mga03n38_93966_c1 nmdc:mga03n38_93966_c1_328_1248 286
379 3300050491 nmdc:mga00v17_22822_c1 nmdc:mga00v17_22822_c1_975_1895 286
380 3300013306 Ga0163162_10257599 Ga0163162_102575992 287
381 3300026118 Ga0207675_100112750 Ga0207675_1001127503 287
382 3300044694 Ga0466963_0055458 Ga0466963_0055458_95_1057 287
383 3300044719 Ga0466971_0007663 Ga0466971_0007663_1783_2745 287
384 3300044842 Ga0466957_0012198 Ga0466957_0012198_1129_2091 287
385 3300053153 Ga0500616_0001555 Ga0500616_0001555_7966_8892 287
386 3300061719 Ga0466962_0028461 Ga0466962_0028461_579_1541 287
387 iso_pu_bacteria 2855386786 2855388172 287
388 3300005441 Ga0070700_100018947 Ga0070700_1000189471 288
389 3300005445 Ga0070708_100261161 Ga0070708_1002611612 288
390 3300005455 Ga0070663_100401207 Ga0070663_1004012072 288
391 3300005468 Ga0070707_100011610 Ga0070707_1000116107 288
392 3300005468 Ga0070707_100025661 Ga0070707_1000256616 288
393 3300005468 Ga0070707_100055121 Ga0070707_1000551214 288
394 3300005536 Ga0070697_100031546 Ga0070697_1000315463 288
395 3300005545 Ga0070695_100106485 Ga0070695_1001064852 288
396 3300005719 Ga0068861_100116631 Ga0068861_1001166312 288
397 3300006844 Ga0075428_100474101 Ga0075428_1004741012 288
398 3300009098 Ga0105245_10205182 Ga0105245_102051822 288
399 3300009148 Ga0105243_10045679 Ga0105243_100456792 288
400 3300021384 Ga0213876_10096880 Ga0213876_100968802 288
401 3300021384 Ga0213876_10099209 Ga0213876_100992092 288
402 3300021388 Ga0213875_10004578 Ga0213875_100045785 288
403 3300025910 Ga0207684_10066593 Ga0207684_100665933 288
404 3300025922 Ga0207646_10010743 Ga0207646_100107436 288
405 3300025922 Ga0207646_10019332 Ga0207646_100193325 288
406 3300025937 Ga0207669_10169833 Ga0207669_101698332 288
407 3300025938 Ga0207704_10107433 Ga0207704_101074332 288
408 3300026075 Ga0207708_10003021 Ga0207708_1000302116 288
409 3300026089 Ga0207648_10098670 Ga0207648_100986702 288
410 3300026118 Ga0207675_100018890 Ga0207675_1000188904 288
411 3300031852 Ga0307410_10082688 Ga0307410_100826882 288
412 3300037853 Ga0436364_0260207 Ga0436364_0260207_4130_5008 288
413 3300039437 Ga0436365_0442366 Ga0436365_0442366_1864_2805 288
414 3300042008 Ga0439450_008666 Ga0439450_008666_222_1097 288
415 3300044683 Ga0466965_0110229 Ga0466965_0110229_129_1004 288
416 3300048907 Ga0496104_0006133 Ga0496104_0006133_7531_8496 288
417 3300048908 Ga0496105_0102142 Ga0496105_0102142_837_1802 288
418 3300048912 Ga0496109_0500272 Ga0496109_0500272_28_993 288
419 3300048915 Ga0496112_0191124 Ga0496112_0191124_589_1554 288
420 3300049571 Ga0501034_0064304 Ga0501034_0064304_1940_2848 288
421 3300005339 Ga0070660_100067557 Ga0070660_1000675573 289
422 3300009093 Ga0105240_10023970 Ga0105240_100239704 289
423 3300011119 Ga0105246_10099445 Ga0105246_100994453 289
424 3300013307 Ga0157372_10492262 Ga0157372_104922622 289
425 3300025919 Ga0207657_10037457 Ga0207657_100374574 289
426 3300045836 Ga0466958_0237130 Ga0466958_0237130_101_1021 289
427 3300049586 Ga0501070_0165021 Ga0501070_0165021_30_989 289
428 3300049587 Ga0501071_0013001 Ga0501071_0013001_3148_4107 289
429 3300049592 Ga0501076_0288312 Ga0501076_0288312_92_1051 289
430 3300060353 Ga0501082_0027429 Ga0501082_0027429_1783_2742 289
431 3300061734 Ga0530510_0033367 Ga0530510_0033367_2041_3000 289
432 3300005436 Ga0070713_100103620 Ga0070713_1001036202 290
433 3300005437 Ga0070710_10006857 Ga0070710_100068574 290
434 3300005985 Ga0081539_10025587 Ga0081539_100255871 290
435 3300006028 Ga0070717_10125024 Ga0070717_101250242 290
436 3300025915 Ga0207693_10094501 Ga0207693_100945012 290
437 3300025928 Ga0207700_10040961 Ga0207700_100409612 290
438 3300031901 Ga0307406_10212811 Ga0307406_102128112 290
439 3300035119 Ga0373956_0058640 Ga0373956_0058640_117_998 290
440 3300036401 Ga0373937_0057955 Ga0373937_0057955_1612_2493 290
441 3300037466 Ga0395898_0328792 Ga0395898_0328792_347_1234 290
442 3300037853 Ga0436364_0747883 Ga0436364_0747883_5522_6403 290
443 3300038443 Ga0395901_0031082 Ga0395901_0031082_948_1847 290
444 3300039437 Ga0436365_1768242 Ga0436365_1768242_546_1427 290
445 3300044693 Ga0466961_0035351 Ga0466961_0035351_361_1308 290
446 3300044765 Ga0466970_0044600 Ga0466970_0044600_1322_2251 290
447 3300044901 Ga0466960_0000237 Ga0466960_0000237_4866_5768 290
448 3300045049 Ga0466959_0015322 Ga0466959_0015322_1253_2200 290
449 3300045976 Ga0466967_0032594 Ga0466967_0032594_1614_2510 290
450 3300046454 Ga0495592_0059336 Ga0495592_0059336_658_1539 290
451 3300046459 Ga0495629_0108122 Ga0495629_0108122_97_978 290
452 3300046462 Ga0495651_0050468 Ga0495651_0050468_1222_2103 290
453 3300046463 Ga0495653_0025801 Ga0495653_0025801_1875_2756 290
454 3300046471 Ga0495650_0000055 Ga0495650_0000055_104235_105143 290
455 3300046511 Ga0495608_0005880 Ga0495608_0005880_1063_1944 290
456 3300046514 Ga0495618_0019416 Ga0495618_0019416_2842_3723 290
457 3300046516 Ga0495628_0029687 Ga0495628_0029687_1353_2234 290
458 3300046517 Ga0495630_0083663 Ga0495630_0083663_503_1384 290
459 3300046533 Ga0495640_0061625 Ga0495640_0061625_849_1730 290
460 3300046536 Ga0495587_0047062 Ga0495587_0047062_861_1742 290
461 3300046559 Ga0495667_0015912 Ga0495667_0015912_3642_4523 290
462 3300046642 Ga0495634_0047775 Ga0495634_0047775_502_1383 290
463 3300046663 Ga0495635_0017163 Ga0495635_0017163_128_1009 290
464 3300046675 Ga0495657_0008803 Ga0495657_0008803_764_1645 290
465 3300046679 Ga0495623_0044627 Ga0495623_0044627_877_1758 290
466 3300046680 Ga0495646_0007330 Ga0495646_0007330_4331_5212 290
467 3300046809 Ga0495600_0002882 Ga0495600_0002882_3525_4406 290
468 3300047317 Ga0495604_0008977 Ga0495604_0008977_4660_5541 290
469 3300047319 Ga0495674_0024765 Ga0495674_0024765_1001_1882 290
470 3300047322 Ga0495680_0006646 Ga0495680_0006646_3067_3948 290
471 3300047673 Ga0495593_0025346 Ga0495593_0025346_1612_2493 290
472 3300048088 Ga0495602_0011820 Ga0495602_0011820_3647_4528 290
473 3300048903 Ga0496100_0192128 Ga0496100_0192128_109_1098 290
474 3300048907 Ga0496104_0062923 Ga0496104_0062923_1265_2146 290
475 3300048908 Ga0496105_0305440 Ga0496105_0305440_132_1013 290
476 3300048912 Ga0496109_0616855 Ga0496109_0616855_77_958 290
477 3300048913 Ga0496110_0056662 Ga0496110_0056662_1110_1991 290
478 3300048913 Ga0496110_0505657 Ga0496110_0505657_54_935 290
479 3300048914 Ga0496111_0041907 Ga0496111_0041907_761_1642 290
480 3300048914 Ga0496111_0067181 Ga0496111_0067181_1393_2382 290
481 3300048915 Ga0496112_0029098 Ga0496112_0029098_3434_4315 290
482 3300048915 Ga0496112_0127213 Ga0496112_0127213_1366_2247 290
483 3300048915 Ga0496112_0281279 Ga0496112_0281279_408_1289 290
484 3300048915 Ga0496112_0316249 Ga0496112_0316249_350_1339 290
485 3300048916 Ga0496113_0043152 Ga0496113_0043152_1709_2698 290
486 3300048916 Ga0496113_0134710 Ga0496113_0134710_287_1168 290
487 3300048916 Ga0496113_0400016 Ga0496113_0400016_133_1014 290
488 3300048918 Ga0496115_0404011 Ga0496115_0404011_129_1010 290
489 3300048924 Ga0496121_0028323 Ga0496121_0028323_410_1321 290
490 3300053077 Ga0495601_0283457 Ga0495601_0283457_16_897 290
491 3300053084 Ga0495595_0009349 Ga0495595_0009349_1234_2115 290
492 3300053085 Ga0495619_0035656 Ga0495619_0035656_1629_2510 290
493 3300053153 Ga0500616_0045578 Ga0500616_0045578_1072_1953 290
494 3300005337 Ga0070682_100198461 Ga0070682_1001984611 291
495 3300005340 Ga0070689_100101309 Ga0070689_1001013092 291
496 3300005343 Ga0070687_100147067 Ga0070687_1001470671 291
497 3300005347 Ga0070668_100080532 Ga0070668_1000805322 291
498 3300005366 Ga0070659_100148450 Ga0070659_1001484502 291
499 3300005466 Ga0070685_10089946 Ga0070685_100899462 291
500 3300005549 Ga0070704_100098335 Ga0070704_1000983352 291
501 3300005615 Ga0070702_100023262 Ga0070702_1000232622 291
502 3300005616 Ga0068852_100024037 Ga0068852_1000240373 291
503 3300005616 Ga0068852_100078703 Ga0068852_1000787032 291
504 3300005617 Ga0068859_100040708 Ga0068859_1000407084 291
505 3300005618 Ga0068864_100140064 Ga0068864_1001400642 291
506 3300005718 Ga0068866_10026269 Ga0068866_100262693 291
507 3300005719 Ga0068861_100204786 Ga0068861_1002047862 291
508 3300005983 Ga0081540_1001012 Ga0081540_10010123 291
509 3300006931 Ga0097620_100040703 Ga0097620_1000407034 291
510 3300009098 Ga0105245_10505995 Ga0105245_105059951 291
511 3300009101 Ga0105247_10038643 Ga0105247_100386434 291
512 3300009174 Ga0105241_10234947 Ga0105241_102349472 291
513 3300009176 Ga0105242_10257745 Ga0105242_102577452 291
514 3300009553 Ga0105249_10038105 Ga0105249_100381053 291
515 3300009553 Ga0105249_10197019 Ga0105249_101970192 291
516 3300010375 Ga0105239_10256483 Ga0105239_102564832 291
517 3300013102 Ga0157371_10205104 Ga0157371_102051042 291
518 3300014969 Ga0157376_10153050 Ga0157376_101530502 291
519 3300017792 Ga0163161_10079222 Ga0163161_100792223 291
520 3300025901 Ga0207688_10012664 Ga0207688_100126642 291
521 3300025904 Ga0207647_10047416 Ga0207647_100474162 291
522 3300025916 Ga0207663_10068536 Ga0207663_100685362 291
523 3300025918 Ga0207662_10095976 Ga0207662_100959762 291
524 3300025919 Ga0207657_10060673 Ga0207657_100606732 291
525 3300025923 Ga0207681_10099308 Ga0207681_100993082 291
526 3300025926 Ga0207659_10105141 Ga0207659_101051412 291
527 3300025927 Ga0207687_10016161 Ga0207687_100161612 291
528 3300025927 Ga0207687_10095108 Ga0207687_100951082 291
529 3300025931 Ga0207644_10133857 Ga0207644_101338572 291
530 3300025932 Ga0207690_10055122 Ga0207690_100551222 291
531 3300025934 Ga0207686_10241878 Ga0207686_102418782 291
532 3300025942 Ga0207689_10033898 Ga0207689_100338982 291
533 3300025961 Ga0207712_10048302 Ga0207712_100483023 291
534 3300025981 Ga0207640_10161605 Ga0207640_101616052 291
535 3300025986 Ga0207658_10142489 Ga0207658_101424892 291
536 3300026089 Ga0207648_10270112 Ga0207648_102701122 291
537 3300026116 Ga0207674_10036967 Ga0207674_100369674 291
538 3300026118 Ga0207675_100057571 Ga0207675_1000575712 291
539 3300026118 Ga0207675_100223791 Ga0207675_1002237912 291
540 3300026121 Ga0207683_10062078 Ga0207683_100620783 291
541 3300026142 Ga0207698_10043212 Ga0207698_100432122 291
542 3300026142 Ga0207698_10056150 Ga0207698_100561503 291
543 3300028381 Ga0268264_10160690 Ga0268264_101606902 291
544 3300039437 Ga0436365_1933925 Ga0436365_1933925_673_1575 291
545 3300039450 Ga0436363_1082191 Ga0436363_1082191_12430_13332 291
546 3300045049 Ga0466959_0342222 Ga0466959_0342222_42_1007 291
547 3300046461 Ga0495641_0063347 Ga0495641_0063347_613_1536 291
548 3300048904 Ga0496101_0249731 Ga0496101_0249731_153_1031 291
549 3300048904 Ga0496101_0337790 Ga0496101_0337790_259_1170 291
550 3300048905 Ga0496102_0042064 Ga0496102_0042064_655_1566 291
551 3300048906 Ga0496103_0206906 Ga0496103_0206906_236_1126 291
552 3300048907 Ga0496104_0008487 Ga0496104_0008487_7621_8544 291
553 3300048907 Ga0496104_0100929 Ga0496104_0100929_39_1025 291
554 3300048907 Ga0496104_0572899 Ga0496104_0572899_119_997 291
555 3300048908 Ga0496105_0054631 Ga0496105_0054631_475_1398 291
556 3300048908 Ga0496105_0178117 Ga0496105_0178117_62_973 291
557 3300048909 Ga0496106_0014586 Ga0496106_0014586_2429_3352 291
558 3300048909 Ga0496106_0035052 Ga0496106_0035052_2003_2893 291
559 3300048910 Ga0496107_0004823 Ga0496107_0004823_3591_4481 291
560 3300048910 Ga0496107_0090571 Ga0496107_0090571_1231_2142 291
561 3300048911 Ga0496108_0002444 Ga0496108_0002444_9547_10470 291
562 3300048912 Ga0496109_0041794 Ga0496109_0041794_3112_4035 291
563 3300048912 Ga0496109_0049207 Ga0496109_0049207_2440_3351 291
564 3300048913 Ga0496110_0000362 Ga0496110_0000362_25385_26308 291
565 3300048913 Ga0496110_0056299 Ga0496110_0056299_476_1354 291
566 3300048913 Ga0496110_0162609 Ga0496110_0162609_269_1225 291
567 3300048914 Ga0496111_0006736 Ga0496111_0006736_4488_5411 291
568 3300048914 Ga0496111_0083693 Ga0496111_0083693_153_1064 291
569 3300048914 Ga0496111_0091325 Ga0496111_0091325_163_1041 291
570 3300048915 Ga0496112_0032894 Ga0496112_0032894_472_1395 291
571 3300048916 Ga0496113_0008875 Ga0496113_0008875_2909_3832 291
572 3300048917 Ga0496114_0047621 Ga0496114_0047621_141_1019 291
573 3300048917 Ga0496114_0102606 Ga0496114_0102606_300_1190 291
574 3300048918 Ga0496115_0058979 Ga0496115_0058979_394_1284 291
575 3300048918 Ga0496115_0080302 Ga0496115_0080302_205_1116 291
576 3300048918 Ga0496115_0350726 Ga0496115_0350726_128_1006 291
577 3300050511 nmdc:mga08y16_171869_c1 nmdc:mga08y16_171869_c1_1083_1994 291
578 3300050515 nmdc:mga0a205_62431_c1 nmdc:mga0a205_62431_c1_705_1616 291
579 3300003203 JGI25406J46586_10058365 JGI25406J46586_100583651 292
580 3300005548 Ga0070665_100002263 Ga0070665_10000226311 292
581 3300005985 Ga0081539_10008321 Ga0081539_100083213 292
582 3300028379 Ga0268266_10008844 Ga0268266_100088448 292
583 3300037853 Ga0436364_1026511 Ga0436364_1026511_3342_4298 292
584 3300037853 Ga0436364_1425865 Ga0436364_1425865_566_1483 292
585 3300044842 Ga0466957_0066468 Ga0466957_0066468_254_1204 292
586 3300045836 Ga0466958_0015000 Ga0466958_0015000_2272_3222 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

91

230

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9252 6 218
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.917 5 218
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.908 2 218
6xgz-assembly2.cif.gz_C crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9068 2 217
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9051 5 221
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9474 1 218 3.40.50.300
af_Q555Z5_479_734_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9368 2 215 3.40.50.300
af_Q4DWA3_1535_1779_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9351 5 218 3.40.50.300
af_E9PWJ7_506_745_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9321 4 217 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9314 5 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D5DMZ3-F1-model_v4 ABC transporter 0.9674 1 200 GO:0005524
GO:0016887
GO:0046677
AF-A0A7V9B0A6-F1-model_v4 ABC transporter ATP-binding protein 0.9641 86 218 GO:0005524
GO:0016887
AF-A0A3D5DMZ3-F1-model_v4 ABC transporter 0.9534 1 200 GO:0005524
GO:0016887
GO:0046677
AF-A0A6I6A3C4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9521 1 218 GO:0005524
GO:0016887
GO:0046677
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9519 4 218 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.06 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map