F466541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 278 | 581 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300006880|Ga0075429_100011965|Ga0075429_1000119655 |
| Length | 355 |
| Sequence | MACTPQLRECAPLDDWRERPPTAGPPDDVRDEQPRRVGADVDAGAAHGARQRIRDEGRPQRRFEASWALVNDELAIEVRGLRKRYGDLEAVRGIDFSVRCGEVFGLLGPNGAGKTTTVEILEGYRDRSGGDVSVLGHDPQLRGRALRERVGIVLQSTGIYRHLTVREVLAHFAGLYPAPRGVDEVIELVGLRGKEDARTRALSGGQLRRLDLALALIGDPELIFLDEPTTGFDPAARRGAWDAIRSLKALGKTVVLTTHYLDEAQALADRVAIVKDGRILVEGAPSELGAGEGATRYRVAWRNGSGLLSQRETDDPTTLLHELTTAALERGERLEGLSVTRPTLEDVYLELTADA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 2 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 3 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 4 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 5 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 181 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 182 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 275 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 13.82 |
| Rhizosphere | 80.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10058365 | 3300003203 | Bacteria | 1258 |
| 2 | JGI25404J52841_10006763 | 3300003659 | Bacteria | 2405 |
| 3 | Ga0070658_10140827 | 3300005327 | Bacteria | 2015 |
| 4 | Ga0070683_100000273 | 3300005329 | Bacteria | 35417 |
| 5 | Ga0070683_100037529 | 3300005329 | Bacteria | 4435 |
| 6 | Ga0070683_100085500 | 3300005329 | Bacteria | 2957 |
| 7 | Ga0070683_100146238 | 3300005329 | Bacteria | 2240 |
| 8 | Ga0070680_100055512 | 3300005336 | Bacteria | 3237 |
| 9 | Ga0070682_100087690 | 3300005337 | Bacteria | 2029 |
| 10 | Ga0070682_100198461 | 3300005337 | Bacteria | 1414 |
| 11 | Ga0068868_100087153 | 3300005338 | Bacteria | 2510 |
| 12 | Ga0070660_100067557 | 3300005339 | Bacteria | 2785 |
| 13 | Ga0070660_100160760 | 3300005339 | Bacteria | 1810 |
| 14 | Ga0070689_100101309 | 3300005340 | Bacteria | 2279 |
| 15 | Ga0070691_10002612 | 3300005341 | Bacteria | 8040 |
| 16 | Ga0070687_100147067 | 3300005343 | Bacteria | 1379 |
| 17 | Ga0070661_100217614 | 3300005344 | Bacteria | 1464 |
| 18 | Ga0070668_100080532 | 3300005347 | Bacteria | 2551 |
| 19 | Ga0070669_100001519 | 3300005353 | Bacteria | 16785 |
| 20 | Ga0070675_100408169 | 3300005354 | Bacteria | 1213 |
| 21 | Ga0070671_100309627 | 3300005355 | Bacteria | 1345 |
| 22 | Ga0070673_100236661 | 3300005364 | Bacteria | 1586 |
| 23 | Ga0070659_100000030 | 3300005366 | Bacteria | 128662 |
| 24 | Ga0070659_100148450 | 3300005366 | Bacteria | 1911 |
| 25 | Ga0070709_10006089 | 3300005434 | Bacteria | 6563 |
| 26 | Ga0070714_100000228 | 3300005435 | Bacteria | 44348 |
| 27 | Ga0070714_100014755 | 3300005435 | Bacteria | 6279 |
| 28 | Ga0070714_100020329 | 3300005435 | Bacteria | 5420 |
| 29 | Ga0070714_100029533 | 3300005435 | Bacteria | 4558 |
| 30 | Ga0070714_100029681 | 3300005435 | Bacteria | 4547 |
| 31 | Ga0070714_100043792 | 3300005435 | Bacteria | 3788 |
| 32 | Ga0070714_100320762 | 3300005435 | Bacteria | 1449 |
| 33 | Ga0070713_100000482 | 3300005436 | Bacteria | 25372 |
| 34 | Ga0070713_100043399 | 3300005436 | Bacteria | 3676 |
| 35 | Ga0070713_100103620 | 3300005436 | Bacteria | 2469 |
| 36 | Ga0070713_100444784 | 3300005436 | Bacteria | 1216 |
| 37 | Ga0070710_10000009 | 3300005437 | Bacteria | 165863 |
| 38 | Ga0070710_10006857 | 3300005437 | Bacteria | 5496 |
| 39 | Ga0070710_10014749 | 3300005437 | Bacteria | 3938 |
| 40 | Ga0070711_100284466 | 3300005439 | Bacteria | 1309 |
| 41 | Ga0070705_100001133 | 3300005440 | Bacteria | 14726 |
| 42 | Ga0070700_100018947 | 3300005441 | Bacteria | 3965 |
| 43 | Ga0070700_100099772 | 3300005441 | Bacteria | 1911 |
| 44 | Ga0070700_100151883 | 3300005441 | Bacteria | 1585 |
| 45 | Ga0070708_100261161 | 3300005445 | Bacteria | 1628 |
| 46 | Ga0070663_100109588 | 3300005455 | Bacteria | 2073 |
| 47 | Ga0070663_100148620 | 3300005455 | Bacteria | 1795 |
| 48 | Ga0070663_100401207 | 3300005455 | Bacteria | 1121 |
| 49 | Ga0070678_100002983 | 3300005456 | Bacteria | 9378 |
| 50 | Ga0070662_100085307 | 3300005457 | Bacteria | 2360 |
| 51 | Ga0070681_10023828 | 3300005458 | Bacteria | 6161 |
| 52 | Ga0070681_10172230 | 3300005458 | Bacteria | 2087 |
| 53 | Ga0070685_10089946 | 3300005466 | Bacteria | 1856 |
| 54 | Ga0070685_10113676 | 3300005466 | Bacteria | 1672 |
| 55 | Ga0070706_100082952 | 3300005467 | Bacteria | 2969 |
| 56 | Ga0070707_100011610 | 3300005468 | Bacteria | 8220 |
| 57 | Ga0070707_100014238 | 3300005468 | Bacteria | 7455 |
| 58 | Ga0070707_100025661 | 3300005468 | Bacteria | 5595 |
| 59 | Ga0070707_100055121 | 3300005468 | Bacteria | 3811 |
| 60 | Ga0070698_100143968 | 3300005471 | Bacteria | 2333 |
| 61 | Ga0070699_100079395 | 3300005518 | Bacteria | 2858 |
| 62 | Ga0070679_100050313 | 3300005530 | Bacteria | 4151 |
| 63 | Ga0070684_100001222 | 3300005535 | Bacteria | 18444 |
| 64 | Ga0070684_100001353 | 3300005535 | Bacteria | 17564 |
| 65 | Ga0070697_100001164 | 3300005536 | Bacteria | 19928 |
| 66 | Ga0070697_100031546 | 3300005536 | Bacteria | 4263 |
| 67 | Ga0070695_100106485 | 3300005545 | Bacteria | 1896 |
| 68 | Ga0070693_100003064 | 3300005547 | Bacteria | 7755 |
| 69 | Ga0070665_100002263 | 3300005548 | Bacteria | 21391 |
| 70 | Ga0070704_100098335 | 3300005549 | Bacteria | 2198 |
| 71 | Ga0068857_100002277 | 3300005577 | Bacteria | 15604 |
| 72 | Ga0068854_100103784 | 3300005578 | Bacteria | 2135 |
| 73 | Ga0068856_100010876 | 3300005614 | Bacteria | 8836 |
| 74 | Ga0068856_100028706 | 3300005614 | Bacteria | 5435 |
| 75 | Ga0070702_100023262 | 3300005615 | Bacteria | 3290 |
| 76 | Ga0070702_100060083 | 3300005615 | Bacteria | 2209 |
| 77 | Ga0068852_100024037 | 3300005616 | Bacteria | 4918 |
| 78 | Ga0068852_100078703 | 3300005616 | Bacteria | 2917 |
| 79 | Ga0068859_100040708 | 3300005617 | Bacteria | 4666 |
| 80 | Ga0068859_100532309 | 3300005617 | Bacteria | 1270 |
| 81 | Ga0068864_100140064 | 3300005618 | Bacteria | 2181 |
| 82 | Ga0068866_10026269 | 3300005718 | Bacteria | 2747 |
| 83 | Ga0068861_100116631 | 3300005719 | Bacteria | 2147 |
| 84 | Ga0068861_100183417 | 3300005719 | Bacteria | 1744 |
| 85 | Ga0068861_100204786 | 3300005719 | Bacteria | 1658 |
| 86 | Ga0068858_100261857 | 3300005842 | Bacteria | 1644 |
| 87 | Ga0081455_10000061 | 3300005937 | Bacteria | 117154 |
| 88 | Ga0081455_10012210 | 3300005937 | Bacteria | 8576 |
| 89 | Ga0081455_10014973 | 3300005937 | Bacteria | 7555 |
| 90 | Ga0081538_10004166 | 3300005981 | Bacteria | 13421 |
| 91 | Ga0081538_10027953 | 3300005981 | Bacteria | 3893 |
| 92 | Ga0081540_1001012 | 3300005983 | Bacteria | 25230 |
| 93 | Ga0081539_10008321 | 3300005985 | Bacteria | 9075 |
| 94 | Ga0081539_10025587 | 3300005985 | Bacteria | 3795 |
| 95 | Ga0081539_10030182 | 3300005985 | Bacteria | 3371 |
| 96 | Ga0070717_10000013 | 3300006028 | Bacteria | 228046 |
| 97 | Ga0070717_10009518 | 3300006028 | Bacteria | 7308 |
| 98 | Ga0070717_10125024 | 3300006028 | Bacteria | 2207 |
| 99 | Ga0070717_10256769 | 3300006028 | Bacteria | 1545 |
| 100 | Ga0070717_10261613 | 3300006028 | Bacteria | 1531 |
| 101 | Ga0075364_10009834 | 3300006051 | Bacteria | 5753 |
| 102 | Ga0070716_100062528 | 3300006173 | Bacteria | 2159 |
| 103 | Ga0070712_100000003 | 3300006175 | Bacteria | 253696 |
| 104 | Ga0070712_100042477 | 3300006175 | Bacteria | 3126 |
| 105 | Ga0068871_100239102 | 3300006358 | Bacteria | 1578 |
| 106 | Ga0075428_100474101 | 3300006844 | Bacteria | 1340 |
| 107 | Ga0075429_100011965 | 3300006880 | Bacteria | 7524 |
| 108 | Ga0068865_100129908 | 3300006881 | Bacteria | 1886 |
| 109 | Ga0097620_100040703 | 3300006931 | Bacteria | 4666 |
| 110 | Ga0097620_100532296 | 3300006931 | Bacteria | 1270 |
| 111 | Ga0105240_10023970 | 3300009093 | Bacteria | 8061 |
| 112 | Ga0105240_10073705 | 3300009093 | Bacteria | 4215 |
| 113 | Ga0105245_10205182 | 3300009098 | Bacteria | 1894 |
| 114 | Ga0105245_10505995 | 3300009098 | Bacteria | 1225 |
| 115 | Ga0105247_10038643 | 3300009101 | Bacteria | 2914 |
| 116 | Ga0105243_10027181 | 3300009148 | Bacteria | 4382 |
| 117 | Ga0105243_10045679 | 3300009148 | Bacteria | 3443 |
| 118 | Ga0105243_10116023 | 3300009148 | Bacteria | 2249 |
| 119 | Ga0105243_10184345 | 3300009148 | Bacteria | 1818 |
| 120 | Ga0105243_10458144 | 3300009148 | Bacteria | 1198 |
| 121 | Ga0105241_10123667 | 3300009174 | Bacteria | 2086 |
| 122 | Ga0105241_10234947 | 3300009174 | Bacteria | 1547 |
| 123 | Ga0105242_10257745 | 3300009176 | Bacteria | 1574 |
| 124 | Ga0105242_10516851 | 3300009176 | Bacteria | 1138 |
| 125 | Ga0105249_10038105 | 3300009553 | Bacteria | 4361 |
| 126 | Ga0105249_10149050 | 3300009553 | Bacteria | 2250 |
| 127 | Ga0105249_10197019 | 3300009553 | Bacteria | 1969 |
| 128 | Ga0105249_10337195 | 3300009553 | Bacteria | 1523 |
| 129 | Ga0105239_10124568 | 3300010375 | Bacteria | 2863 |
| 130 | Ga0105239_10256483 | 3300010375 | Bacteria | 1965 |
| 131 | Ga0105246_10063300 | 3300011119 | Bacteria | 2579 |
| 132 | Ga0105246_10099445 | 3300011119 | Bacteria | 2114 |
| 133 | Ga0105246_10114548 | 3300011119 | Bacteria | 1987 |
| 134 | Ga0105246_10163516 | 3300011119 | Bacteria | 1698 |
| 135 | Ga0157371_10205104 | 3300013102 | Bacteria | 1414 |
| 136 | Ga0157370_10154667 | 3300013104 | Bacteria | 2134 |
| 137 | Ga0157369_10017241 | 3300013105 | Bacteria | 8117 |
| 138 | Ga0157369_10454113 | 3300013105 | Bacteria | 1327 |
| 139 | Ga0163162_10257599 | 3300013306 | Bacteria | 1876 |
| 140 | Ga0163162_10377765 | 3300013306 | Bacteria | 1550 |
| 141 | Ga0157372_10492262 | 3300013307 | Bacteria | 1430 |
| 142 | Ga0157375_10012778 | 3300013308 | Bacteria | 7455 |
| 143 | Ga0157380_10522032 | 3300014326 | Bacteria | 1158 |
| 144 | Ga0157377_10111855 | 3300014745 | Bacteria | 1642 |
| 145 | Ga0157376_10116556 | 3300014969 | Bacteria | 2360 |
| 146 | Ga0157376_10153050 | 3300014969 | Bacteria | 2082 |
| 147 | Ga0163161_10079222 | 3300017792 | Bacteria | 2415 |
| 148 | Ga0206354_10937210 | 3300020081 | Bacteria | 1655 |
| 149 | Ga0213876_10051944 | 3300021384 | Bacteria | 2166 |
| 150 | Ga0213876_10096880 | 3300021384 | Bacteria | 1563 |
| 151 | Ga0213876_10099209 | 3300021384 | Bacteria | 1544 |
| 152 | Ga0213875_10004578 | 3300021388 | Bacteria | 7550 |
| 153 | Ga0213875_10005976 | 3300021388 | Bacteria | 6453 |
| 154 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 155 | Ga0207688_10012664 | 3300025901 | Bacteria | 4590 |
| 156 | Ga0207688_10033001 | 3300025901 | Bacteria | 2862 |
| 157 | Ga0207647_10047416 | 3300025904 | Bacteria | 2672 |
| 158 | Ga0207699_10089203 | 3300025906 | Bacteria | 1932 |
| 159 | Ga0207699_10190624 | 3300025906 | Bacteria | 1383 |
| 160 | Ga0207699_10242547 | 3300025906 | Bacteria | 1239 |
| 161 | Ga0207684_10066593 | 3300025910 | Bacteria | 3059 |
| 162 | Ga0207684_10491536 | 3300025910 | Bacteria | 1052 |
| 163 | Ga0207693_10000009 | 3300025915 | Bacteria | 168990 |
| 164 | Ga0207693_10034195 | 3300025915 | Bacteria | 4010 |
| 165 | Ga0207693_10094501 | 3300025915 | Bacteria | 2343 |
| 166 | Ga0207663_10068536 | 3300025916 | Bacteria | 2279 |
| 167 | Ga0207660_10041400 | 3300025917 | Bacteria | 3228 |
| 168 | Ga0207662_10095976 | 3300025918 | Bacteria | 1831 |
| 169 | Ga0207657_10037457 | 3300025919 | Bacteria | 4330 |
| 170 | Ga0207657_10060673 | 3300025919 | Bacteria | 3245 |
| 171 | Ga0207657_10139030 | 3300025919 | Bacteria | 1985 |
| 172 | Ga0207649_10025548 | 3300025920 | Bacteria | 3444 |
| 173 | Ga0207652_10110518 | 3300025921 | Bacteria | 2437 |
| 174 | Ga0207646_10010743 | 3300025922 | Bacteria | 8907 |
| 175 | Ga0207646_10019332 | 3300025922 | Bacteria | 6332 |
| 176 | Ga0207646_10065164 | 3300025922 | Bacteria | 3252 |
| 177 | Ga0207681_10003140 | 3300025923 | Bacteria | 10381 |
| 178 | Ga0207681_10099308 | 3300025923 | Bacteria | 2096 |
| 179 | Ga0207659_10105141 | 3300025926 | Bacteria | 2136 |
| 180 | Ga0207687_10016161 | 3300025927 | Bacteria | 4900 |
| 181 | Ga0207687_10095108 | 3300025927 | Bacteria | 2182 |
| 182 | Ga0207700_10002355 | 3300025928 | Bacteria | 10850 |
| 183 | Ga0207700_10002830 | 3300025928 | Bacteria | 9981 |
| 184 | Ga0207700_10007455 | 3300025928 | Bacteria | 6685 |
| 185 | Ga0207700_10040961 | 3300025928 | Bacteria | 3385 |
| 186 | Ga0207700_10318488 | 3300025928 | Bacteria | 1347 |
| 187 | Ga0207664_10000060 | 3300025929 | Bacteria | 116764 |
| 188 | Ga0207664_10002459 | 3300025929 | Bacteria | 12263 |
| 189 | Ga0207664_10004846 | 3300025929 | Bacteria | 9151 |
| 190 | Ga0207664_10021019 | 3300025929 | Bacteria | 4844 |
| 191 | Ga0207644_10133857 | 3300025931 | Bacteria | 1901 |
| 192 | Ga0207644_10302278 | 3300025931 | Bacteria | 1290 |
| 193 | Ga0207690_10000328 | 3300025932 | Bacteria | 31713 |
| 194 | Ga0207690_10055122 | 3300025932 | Bacteria | 2676 |
| 195 | Ga0207706_10060281 | 3300025933 | Bacteria | 3341 |
| 196 | Ga0207706_10243218 | 3300025933 | Bacteria | 1573 |
| 197 | Ga0207686_10241878 | 3300025934 | Bacteria | 1314 |
| 198 | Ga0207709_10010699 | 3300025935 | Bacteria | 5053 |
| 199 | Ga0207709_10092095 | 3300025935 | Bacteria | 1984 |
| 200 | Ga0207669_10056703 | 3300025937 | Bacteria | 2381 |
| 201 | Ga0207669_10169833 | 3300025937 | Bacteria | 1551 |
| 202 | Ga0207704_10046266 | 3300025938 | Bacteria | 2592 |
| 203 | Ga0207704_10107433 | 3300025938 | Bacteria | 1877 |
| 204 | Ga0207665_10002563 | 3300025939 | Bacteria | 12203 |
| 205 | Ga0207689_10033898 | 3300025942 | Bacteria | 4241 |
| 206 | Ga0207661_10001985 | 3300025944 | Bacteria | 14083 |
| 207 | Ga0207661_10002631 | 3300025944 | Bacteria | 12355 |
| 208 | Ga0207661_10130597 | 3300025944 | Bacteria | 2151 |
| 209 | Ga0207679_10002540 | 3300025945 | Bacteria | 11248 |
| 210 | Ga0207679_10017050 | 3300025945 | Bacteria | 4834 |
| 211 | Ga0207679_10151163 | 3300025945 | Bacteria | 1890 |
| 212 | Ga0207712_10048302 | 3300025961 | Bacteria | 2960 |
| 213 | Ga0207712_10131473 | 3300025961 | Bacteria | 1908 |
| 214 | Ga0207640_10044456 | 3300025981 | Bacteria | 2846 |
| 215 | Ga0207640_10161605 | 3300025981 | Bacteria | 1658 |
| 216 | Ga0207658_10142489 | 3300025986 | Bacteria | 1942 |
| 217 | Ga0207677_10072368 | 3300026023 | Bacteria | 2437 |
| 218 | Ga0207703_10711816 | 3300026035 | Bacteria | 955 |
| 219 | Ga0207678_10184061 | 3300026067 | Bacteria | 1784 |
| 220 | Ga0207708_10003021 | 3300026075 | Bacteria | 12409 |
| 221 | Ga0207708_10087204 | 3300026075 | Bacteria | 2403 |
| 222 | Ga0207708_10135339 | 3300026075 | Bacteria | 1930 |
| 223 | Ga0207702_10002389 | 3300026078 | Bacteria | 17876 |
| 224 | Ga0207702_10006607 | 3300026078 | Bacteria | 9973 |
| 225 | Ga0207648_10098033 | 3300026089 | Bacteria | 2566 |
| 226 | Ga0207648_10098670 | 3300026089 | Bacteria | 2558 |
| 227 | Ga0207648_10270112 | 3300026089 | Bacteria | 1519 |
| 228 | Ga0207674_10001810 | 3300026116 | Bacteria | 27274 |
| 229 | Ga0207674_10036967 | 3300026116 | Bacteria | 5082 |
| 230 | Ga0207675_100018890 | 3300026118 | Bacteria | 6433 |
| 231 | Ga0207675_100057571 | 3300026118 | Bacteria | 3627 |
| 232 | Ga0207675_100112750 | 3300026118 | Bacteria | 2567 |
| 233 | Ga0207675_100223791 | 3300026118 | Bacteria | 1813 |
| 234 | Ga0207683_10002893 | 3300026121 | Bacteria | 14970 |
| 235 | Ga0207683_10062078 | 3300026121 | Bacteria | 3290 |
| 236 | Ga0207698_10043212 | 3300026142 | Bacteria | 3375 |
| 237 | Ga0207698_10056150 | 3300026142 | Bacteria | 3039 |
| 238 | Ga0268266_10008844 | 3300028379 | Bacteria | 8917 |
| 239 | Ga0268264_10160690 | 3300028381 | Bacteria | 2023 |
| 240 | Ga0265326_10000024 | 3300028558 | Bacteria | 112928 |
| 241 | Ga0265319_1000116 | 3300028563 | Bacteria | 60553 |
| 242 | Ga0265334_10000151 | 3300028573 | Bacteria | 42917 |
| 243 | Ga0265336_10006718 | 3300028666 | Bacteria | 4123 |
| 244 | Ga0265338_10001994 | 3300028800 | Bacteria | 31709 |
| 245 | Ga0265324_10008959 | 3300029957 | Bacteria | 3936 |
| 246 | Ga0265327_10031394 | 3300031251 | Bacteria | 2985 |
| 247 | Ga0307408_100048614 | 3300031548 | Bacteria | 3043 |
| 248 | Ga0307408_100185731 | 3300031548 | Bacteria | 1671 |
| 249 | Ga0307405_10042222 | 3300031731 | Bacteria | 2775 |
| 250 | Ga0307405_10119470 | 3300031731 | Bacteria | 1801 |
| 251 | Ga0307413_10037024 | 3300031824 | Bacteria | 2815 |
| 252 | Ga0307413_10183290 | 3300031824 | Bacteria | 1495 |
| 253 | Ga0307413_10201985 | 3300031824 | Bacteria | 1436 |
| 254 | Ga0307413_10216807 | 3300031824 | Bacteria | 1395 |
| 255 | Ga0307410_10073994 | 3300031852 | Bacteria | 2371 |
| 256 | Ga0307410_10082688 | 3300031852 | Bacteria | 2259 |
| 257 | Ga0307410_10256255 | 3300031852 | Bacteria | 1362 |
| 258 | Ga0307406_10012775 | 3300031901 | Bacteria | 4793 |
| 259 | Ga0307406_10173302 | 3300031901 | Bacteria | 1563 |
| 260 | Ga0307406_10212811 | 3300031901 | Bacteria | 1431 |
| 261 | Ga0307406_10280898 | 3300031901 | Bacteria | 1270 |
| 262 | Ga0307407_10009600 | 3300031903 | Bacteria | 4515 |
| 263 | Ga0307407_10016601 | 3300031903 | Bacteria | 3670 |
| 264 | Ga0307407_10068501 | 3300031903 | Bacteria | 2102 |
| 265 | Ga0307407_10094006 | 3300031903 | Bacteria | 1845 |
| 266 | Ga0307407_10108736 | 3300031903 | Bacteria | 1736 |
| 267 | Ga0307412_10049095 | 3300031911 | Bacteria | 2779 |
| 268 | Ga0307409_100003756 | 3300031995 | Bacteria | 8349 |
| 269 | Ga0307409_100025701 | 3300031995 | Bacteria | 4136 |
| 270 | Ga0307409_100072101 | 3300031995 | Bacteria | 2749 |
| 271 | Ga0307409_100074615 | 3300031995 | Bacteria | 2711 |
| 272 | Ga0307409_100092499 | 3300031995 | Bacteria | 2482 |
| 273 | Ga0307409_100107783 | 3300031995 | Bacteria | 2328 |
| 274 | Ga0307409_100258019 | 3300031995 | Bacteria | 1598 |
| 275 | Ga0307409_100279231 | 3300031995 | Bacteria | 1543 |
| 276 | Ga0307409_100422066 | 3300031995 | Bacteria | 1280 |
| 277 | Ga0307416_100053336 | 3300032002 | Bacteria | 3243 |
| 278 | Ga0307416_100056864 | 3300032002 | Bacteria | 3160 |
| 279 | Ga0307416_100182629 | 3300032002 | Bacteria | 1968 |
| 280 | Ga0307416_100270451 | 3300032002 | Bacteria | 1668 |
| 281 | Ga0307416_100342664 | 3300032002 | Bacteria | 1508 |
| 282 | Ga0307416_100347051 | 3300032002 | Bacteria | 1500 |
| 283 | Ga0307416_100367108 | 3300032002 | Bacteria | 1464 |
| 284 | Ga0307416_100652331 | 3300032002 | Bacteria | 1137 |
| 285 | Ga0307414_10450940 | 3300032004 | Bacteria | 1128 |
| 286 | Ga0307411_10136864 | 3300032005 | Bacteria | 1800 |
| 287 | Ga0307415_100004089 | 3300032126 | Bacteria | 7526 |
| 288 | Ga0307415_100017461 | 3300032126 | Bacteria | 4304 |
| 289 | Ga0307415_100021281 | 3300032126 | Bacteria | 3982 |
| 290 | Ga0307415_100239678 | 3300032126 | Bacteria | 1466 |
| 291 | Ga0307415_100289327 | 3300032126 | Bacteria | 1352 |
| 292 | Ga0373959_0000036 | 3300034820 | Bacteria | 29513 |
| 293 | Ga0373923_0020647 | 3300035111 | Bacteria | 2561 |
| 294 | Ga0373936_0006445 | 3300035113 | Bacteria | 4426 |
| 295 | Ga0373953_0070870 | 3300035117 | Bacteria | 1437 |
| 296 | Ga0373954_0089328 | 3300035118 | Bacteria | 1478 |
| 297 | Ga0373956_0008238 | 3300035119 | Bacteria | 4218 |
| 298 | Ga0373956_0058640 | 3300035119 | Bacteria | 1741 |
| 299 | Ga0373957_0000714 | 3300035120 | Bacteria | 8607 |
| 300 | Ga0373943_0087361 | 3300035170 | Bacteria | 1609 |
| 301 | Ga0373946_0042948 | 3300035171 | Bacteria | 1861 |
| 302 | Ga0373955_0004537 | 3300035172 | Bacteria | 6153 |
| 303 | Ga0373924_0000429 | 3300035410 | Bacteria | 12892 |
| 304 | Ga0373935_0018471 | 3300035692 | Bacteria | 4241 |
| 305 | Ga0373933_0101262 | 3300035724 | Bacteria | 1788 |
| 306 | Ga0373947_0205173 | 3300035725 | Bacteria | 1291 |
| 307 | Ga0373937_0057955 | 3300036401 | Bacteria | 3558 |
| 308 | Ga0395899_0099440 | 3300037312 | Bacteria | 2101 |
| 309 | Ga0395900_0024961 | 3300037418 | Bacteria | 6117 |
| 310 | Ga0395900_0026768 | 3300037418 | Bacteria | 5902 |
| 311 | Ga0395900_0180330 | 3300037418 | Bacteria | 2147 |
| 312 | Ga0395900_0252665 | 3300037418 | Bacteria | 1764 |
| 313 | Ga0395898_0072226 | 3300037466 | Bacteria | 3334 |
| 314 | Ga0395898_0159101 | 3300037466 | Bacteria | 2160 |
| 315 | Ga0395898_0328792 | 3300037466 | Bacteria | 1458 |
| 316 | Ga0395905_0181580 | 3300037471 | Bacteria | 1975 |
| 317 | Ga0436364_0260207 | 3300037853 | Bacteria | 10812 |
| 318 | Ga0436364_0650330 | 3300037853 | Bacteria | 1107 |
| 319 | Ga0436364_0680087 | 3300037853 | Bacteria | 18176 |
| 320 | Ga0436364_0747883 | 3300037853 | Bacteria | 6731 |
| 321 | Ga0436364_1026511 | 3300037853 | Bacteria | 8468 |
| 322 | Ga0436364_1425865 | 3300037853 | Bacteria | 2064 |
| 323 | Ga0395901_0021587 | 3300038443 | Bacteria | 6596 |
| 324 | Ga0395901_0031082 | 3300038443 | Bacteria | 5505 |
| 325 | Ga0395901_0239235 | 3300038443 | Bacteria | 1894 |
| 326 | Ga0436365_0066499 | 3300039437 | Bacteria | 2285 |
| 327 | Ga0436365_0442366 | 3300039437 | Bacteria | 4485 |
| 328 | Ga0436365_1286349 | 3300039437 | Bacteria | 3388 |
| 329 | Ga0436365_1768242 | 3300039437 | Bacteria | 4630 |
| 330 | Ga0436365_1933925 | 3300039437 | Bacteria | 8043 |
| 331 | Ga0436363_0666383 | 3300039450 | Bacteria | 1679 |
| 332 | Ga0436363_1082191 | 3300039450 | Bacteria | 18751 |
| 333 | Ga0439465_0013322 | 3300041413 | Bacteria | 2566 |
| 334 | Ga0439465_0013641 | 3300041413 | Bacteria | 2532 |
| 335 | Ga0439465_0050632 | 3300041413 | Bacteria | 1359 |
| 336 | Ga0439445_0012291 | 3300042004 | Bacteria | 2054 |
| 337 | Ga0439450_008666 | 3300042008 | Bacteria | 1905 |
| 338 | Ga0439463_001759 | 3300042016 | Bacteria | 5631 |
| 339 | Ga0451577_0085975 | 3300042876 | Bacteria | 2806 |
| 340 | Ga0466969_0029978 | 3300044656 | Bacteria | 2774 |
| 341 | Ga0466965_0110229 | 3300044683 | Bacteria | 1414 |
| 342 | Ga0466965_0143556 | 3300044683 | Bacteria | 1245 |
| 343 | Ga0466966_0074136 | 3300044684 | Bacteria | 2128 |
| 344 | Ga0466966_0166802 | 3300044684 | Bacteria | 1339 |
| 345 | Ga0466966_0232134 | 3300044684 | Bacteria | 1113 |
| 346 | Ga0466966_0246315 | 3300044684 | Bacteria | 1077 |
| 347 | Ga0466961_0035351 | 3300044693 | Bacteria | 3209 |
| 348 | Ga0466961_0063738 | 3300044693 | Bacteria | 2342 |
| 349 | Ga0466963_0045551 | 3300044694 | Bacteria | 2889 |
| 350 | Ga0466963_0055458 | 3300044694 | Bacteria | 2636 |
| 351 | Ga0466963_0067035 | 3300044694 | Bacteria | 2408 |
| 352 | Ga0466963_0071048 | 3300044694 | Bacteria | 2342 |
| 353 | Ga0466963_0226857 | 3300044694 | Bacteria | 1309 |
| 354 | Ga0466963_0291942 | 3300044694 | Bacteria | 1146 |
| 355 | Ga0466971_0007663 | 3300044719 | Bacteria | 4709 |
| 356 | Ga0466971_0027622 | 3300044719 | Bacteria | 2542 |
| 357 | Ga0466968_0030526 | 3300044735 | Bacteria | 2233 |
| 358 | Ga0466970_0035870 | 3300044765 | Bacteria | 2626 |
| 359 | Ga0466970_0044600 | 3300044765 | Bacteria | 2361 |
| 360 | Ga0466970_0255684 | 3300044765 | Bacteria | 982 |
| 361 | Ga0466957_0012198 | 3300044842 | Bacteria | 4973 |
| 362 | Ga0466957_0015199 | 3300044842 | Bacteria | 4494 |
| 363 | Ga0466957_0066468 | 3300044842 | Bacteria | 2223 |
| 364 | Ga0466957_0208819 | 3300044842 | Bacteria | 1285 |
| 365 | Ga0466957_0214908 | 3300044842 | Bacteria | 1268 |
| 366 | Ga0466960_0000237 | 3300044901 | Bacteria | 19109 |
| 367 | Ga0466960_0037284 | 3300044901 | Bacteria | 2280 |
| 368 | Ga0466960_0058071 | 3300044901 | Bacteria | 1889 |
| 369 | Ga0466960_0072951 | 3300044901 | Bacteria | 1712 |
| 370 | Ga0466960_0127815 | 3300044901 | Bacteria | 1338 |
| 371 | Ga0466960_0255806 | 3300044901 | Bacteria | 974 |
| 372 | Ga0466959_0015322 | 3300045049 | Bacteria | 5582 |
| 373 | Ga0466959_0048861 | 3300045049 | Bacteria | 3108 |
| 374 | Ga0466959_0124646 | 3300045049 | Bacteria | 1829 |
| 375 | Ga0466959_0342222 | 3300045049 | Bacteria | 1020 |
| 376 | Ga0466958_0015000 | 3300045836 | Bacteria | 4434 |
| 377 | Ga0466958_0031318 | 3300045836 | Bacteria | 3161 |
| 378 | Ga0466958_0054453 | 3300045836 | Bacteria | 2426 |
| 379 | Ga0466958_0086378 | 3300045836 | Bacteria | 1936 |
| 380 | Ga0466958_0156227 | 3300045836 | Bacteria | 1440 |
| 381 | Ga0466958_0237130 | 3300045836 | Bacteria | 1165 |
| 382 | Ga0466967_0015938 | 3300045976 | Bacteria | 5908 |
| 383 | Ga0466967_0031676 | 3300045976 | Bacteria | 4455 |
| 384 | Ga0466967_0032594 | 3300045976 | Bacteria | 4401 |
| 385 | Ga0466967_0032951 | 3300045976 | Bacteria | 4381 |
| 386 | Ga0466967_0033244 | 3300045976 | Bacteria | 4364 |
| 387 | Ga0466967_0151193 | 3300045976 | Bacteria | 2170 |
| 388 | Ga0466967_0181230 | 3300045976 | Bacteria | 1987 |
| 389 | Ga0466967_0211355 | 3300045976 | Bacteria | 1840 |
| 390 | Ga0466967_0211614 | 3300045976 | Bacteria | 1839 |
| 391 | Ga0466967_0365590 | 3300045976 | Bacteria | 1398 |
| 392 | Ga0466967_0398483 | 3300045976 | Bacteria | 1339 |
| 393 | Ga0466967_0467133 | 3300045976 | Bacteria | 1235 |
| 394 | Ga0466967_0477975 | 3300045976 | Bacteria | 1220 |
| 395 | Ga0466967_0502994 | 3300045976 | Bacteria | 1189 |
| 396 | Ga0495592_0059336 | 3300046454 | Bacteria | 2818 |
| 397 | Ga0495592_0108552 | 3300046454 | Bacteria | 1967 |
| 398 | Ga0495629_0009584 | 3300046459 | Bacteria | 7075 |
| 399 | Ga0495629_0108122 | 3300046459 | Bacteria | 1940 |
| 400 | Ga0495641_0063347 | 3300046461 | Bacteria | 1667 |
| 401 | Ga0495651_0050468 | 3300046462 | Bacteria | 3209 |
| 402 | Ga0495651_0071817 | 3300046462 | Bacteria | 2630 |
| 403 | Ga0495653_0025801 | 3300046463 | Bacteria | 4715 |
| 404 | Ga0495653_0123711 | 3300046463 | Bacteria | 1839 |
| 405 | Ga0495653_0125888 | 3300046463 | Bacteria | 1820 |
| 406 | Ga0495650_0000055 | 3300046471 | Bacteria | 308438 |
| 407 | Ga0495582_0002461 | 3300046473 | Bacteria | 10322 |
| 408 | Ga0495582_0192998 | 3300046473 | Bacteria | 1162 |
| 409 | Ga0495662_0002246 | 3300046476 | Bacteria | 9742 |
| 410 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 411 | Ga0495664_0034980 | 3300046477 | Bacteria | 2956 |
| 412 | Ga0495584_0076694 | 3300046491 | Bacteria | 1681 |
| 413 | Ga0495608_0005880 | 3300046511 | Bacteria | 8731 |
| 414 | Ga0495608_0019271 | 3300046511 | Bacteria | 4697 |
| 415 | Ga0495618_0019416 | 3300046514 | Bacteria | 4181 |
| 416 | Ga0495628_0029687 | 3300046516 | Bacteria | 4432 |
| 417 | Ga0495628_0084420 | 3300046516 | Bacteria | 2464 |
| 418 | Ga0495628_0147130 | 3300046516 | Bacteria | 1795 |
| 419 | Ga0495630_0083663 | 3300046517 | Bacteria | 2409 |
| 420 | Ga0495652_0058249 | 3300046529 | Bacteria | 3272 |
| 421 | Ga0495665_0014736 | 3300046531 | Bacteria | 4213 |
| 422 | Ga0495640_0014300 | 3300046533 | Bacteria | 6009 |
| 423 | Ga0495640_0026590 | 3300046533 | Bacteria | 4179 |
| 424 | Ga0495640_0061625 | 3300046533 | Bacteria | 2547 |
| 425 | Ga0495587_0013976 | 3300046536 | Bacteria | 5040 |
| 426 | Ga0495587_0047062 | 3300046536 | Bacteria | 2558 |
| 427 | Ga0495645_0027079 | 3300046543 | Bacteria | 4164 |
| 428 | Ga0495645_0059517 | 3300046543 | Bacteria | 2769 |
| 429 | Ga0495645_0073654 | 3300046543 | Bacteria | 2460 |
| 430 | Ga0495667_0015912 | 3300046559 | Bacteria | 5084 |
| 431 | Ga0495667_0043026 | 3300046559 | Bacteria | 2994 |
| 432 | Ga0495667_0108385 | 3300046559 | Bacteria | 1794 |
| 433 | Ga0495634_0012983 | 3300046642 | Bacteria | 6026 |
| 434 | Ga0495634_0047775 | 3300046642 | Bacteria | 2883 |
| 435 | Ga0495634_0075685 | 3300046642 | Bacteria | 2210 |
| 436 | Ga0495635_0015413 | 3300046663 | Bacteria | 5346 |
| 437 | Ga0495635_0017163 | 3300046663 | Bacteria | 5055 |
| 438 | Ga0495657_0008803 | 3300046675 | Bacteria | 7689 |
| 439 | Ga0495657_0035590 | 3300046675 | Bacteria | 3449 |
| 440 | Ga0495599_0052435 | 3300046678 | Bacteria | 2555 |
| 441 | Ga0495623_0044627 | 3300046679 | Bacteria | 2816 |
| 442 | Ga0495646_0007330 | 3300046680 | Bacteria | 7008 |
| 443 | Ga0495646_0028962 | 3300046680 | Bacteria | 3465 |
| 444 | Ga0495613_0028770 | 3300046689 | Bacteria | 4133 |
| 445 | Ga0495624_0007724 | 3300046690 | Bacteria | 7545 |
| 446 | Ga0495600_0001528 | 3300046809 | Bacteria | 12859 |
| 447 | Ga0495600_0002882 | 3300046809 | Bacteria | 10025 |
| 448 | Ga0495581_0004445 | 3300047315 | Bacteria | 8102 |
| 449 | Ga0495581_0174254 | 3300047315 | Bacteria | 1258 |
| 450 | Ga0495604_0008977 | 3300047317 | Bacteria | 7905 |
| 451 | Ga0495674_0024765 | 3300047319 | Bacteria | 5510 |
| 452 | Ga0495672_0017893 | 3300047320 | Bacteria | 4727 |
| 453 | Ga0495680_0006646 | 3300047322 | Bacteria | 10708 |
| 454 | Ga0495593_0014761 | 3300047673 | Bacteria | 4439 |
| 455 | Ga0495593_0025346 | 3300047673 | Bacteria | 3283 |
| 456 | Ga0495602_0011820 | 3300048088 | Bacteria | 9015 |
| 457 | Ga0495602_0050424 | 3300048088 | Bacteria | 3718 |
| 458 | Ga0496100_0000470 | 3300048903 | Bacteria | 19279 |
| 459 | Ga0496100_0067633 | 3300048903 | Bacteria | 2373 |
| 460 | Ga0496100_0192128 | 3300048903 | Bacteria | 1483 |
| 461 | Ga0496100_0284208 | 3300048903 | Bacteria | 1234 |
| 462 | Ga0496101_0006054 | 3300048904 | Bacteria | 7763 |
| 463 | Ga0496101_0249731 | 3300048904 | Bacteria | 1382 |
| 464 | Ga0496101_0337790 | 3300048904 | Bacteria | 1183 |
| 465 | Ga0496102_0002009 | 3300048905 | Bacteria | 17567 |
| 466 | Ga0496102_0042064 | 3300048905 | Bacteria | 4140 |
| 467 | Ga0496103_0007363 | 3300048906 | Bacteria | 6560 |
| 468 | Ga0496103_0206906 | 3300048906 | Bacteria | 1262 |
| 469 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 470 | Ga0496104_0006133 | 3300048907 | Bacteria | 10549 |
| 471 | Ga0496104_0008487 | 3300048907 | Bacteria | 9136 |
| 472 | Ga0496104_0018652 | 3300048907 | Bacteria | 6333 |
| 473 | Ga0496104_0062923 | 3300048907 | Bacteria | 3519 |
| 474 | Ga0496104_0092737 | 3300048907 | Bacteria | 2888 |
| 475 | Ga0496104_0100929 | 3300048907 | Bacteria | 2763 |
| 476 | Ga0496104_0572899 | 3300048907 | Bacteria | 1039 |
| 477 | Ga0496105_0010539 | 3300048908 | Bacteria | 7271 |
| 478 | Ga0496105_0054631 | 3300048908 | Bacteria | 3297 |
| 479 | Ga0496105_0074603 | 3300048908 | Bacteria | 2802 |
| 480 | Ga0496105_0102142 | 3300048908 | Bacteria | 2368 |
| 481 | Ga0496105_0178117 | 3300048908 | Bacteria | 1741 |
| 482 | Ga0496105_0235241 | 3300048908 | Bacteria | 1488 |
| 483 | Ga0496105_0305440 | 3300048908 | Bacteria | 1278 |
| 484 | Ga0496106_0004922 | 3300048909 | Bacteria | 9886 |
| 485 | Ga0496106_0014586 | 3300048909 | Bacteria | 5807 |
| 486 | Ga0496106_0029806 | 3300048909 | Bacteria | 4068 |
| 487 | Ga0496106_0035052 | 3300048909 | Bacteria | 3750 |
| 488 | Ga0496106_0208539 | 3300048909 | Bacteria | 1556 |
| 489 | Ga0496107_0002555 | 3300048910 | Bacteria | 11866 |
| 490 | Ga0496107_0004823 | 3300048910 | Bacteria | 9154 |
| 491 | Ga0496107_0090571 | 3300048910 | Bacteria | 2234 |
| 492 | Ga0496107_0256369 | 3300048910 | Bacteria | 1302 |
| 493 | Ga0496107_0381366 | 3300048910 | Bacteria | 1049 |
| 494 | Ga0496108_0002444 | 3300048911 | Bacteria | 14848 |
| 495 | Ga0496109_0000635 | 3300048912 | Bacteria | 29263 |
| 496 | Ga0496109_0032485 | 3300048912 | Bacteria | 4692 |
| 497 | Ga0496109_0032943 | 3300048912 | Bacteria | 4661 |
| 498 | Ga0496109_0041794 | 3300048912 | Bacteria | 4152 |
| 499 | Ga0496109_0049207 | 3300048912 | Bacteria | 3837 |
| 500 | Ga0496109_0151555 | 3300048912 | Bacteria | 2171 |
| 501 | Ga0496109_0316464 | 3300048912 | Bacteria | 1473 |
| 502 | Ga0496109_0500272 | 3300048912 | Bacteria | 1147 |
| 503 | Ga0496109_0616855 | 3300048912 | Bacteria | 1021 |
| 504 | Ga0496110_0000362 | 3300048913 | Bacteria | 30414 |
| 505 | Ga0496110_0056299 | 3300048913 | Bacteria | 3460 |
| 506 | Ga0496110_0056662 | 3300048913 | Bacteria | 3449 |
| 507 | Ga0496110_0151702 | 3300048913 | Bacteria | 2098 |
| 508 | Ga0496110_0162609 | 3300048913 | Bacteria | 2024 |
| 509 | Ga0496110_0505657 | 3300048913 | Bacteria | 1100 |
| 510 | Ga0496111_0004903 | 3300048914 | Bacteria | 8502 |
| 511 | Ga0496111_0006736 | 3300048914 | Bacteria | 7481 |
| 512 | Ga0496111_0041907 | 3300048914 | Bacteria | 3287 |
| 513 | Ga0496111_0067181 | 3300048914 | Bacteria | 2604 |
| 514 | Ga0496111_0083693 | 3300048914 | Bacteria | 2331 |
| 515 | Ga0496111_0091325 | 3300048914 | Bacteria | 2231 |
| 516 | Ga0496111_0183593 | 3300048914 | Bacteria | 1555 |
| 517 | Ga0496112_0002049 | 3300048915 | Bacteria | 15972 |
| 518 | Ga0496112_0029098 | 3300048915 | Bacteria | 5340 |
| 519 | Ga0496112_0032894 | 3300048915 | Bacteria | 5036 |
| 520 | Ga0496112_0118688 | 3300048915 | Bacteria | 2615 |
| 521 | Ga0496112_0127213 | 3300048915 | Bacteria | 2518 |
| 522 | Ga0496112_0191124 | 3300048915 | Bacteria | 2009 |
| 523 | Ga0496112_0281279 | 3300048915 | Bacteria | 1611 |
| 524 | Ga0496112_0316249 | 3300048915 | Bacteria | 1506 |
| 525 | Ga0496112_0531990 | 3300048915 | Bacteria | 1110 |
| 526 | Ga0496113_0008875 | 3300048916 | Bacteria | 6574 |
| 527 | Ga0496113_0040688 | 3300048916 | Bacteria | 3426 |
| 528 | Ga0496113_0043152 | 3300048916 | Bacteria | 3336 |
| 529 | Ga0496113_0077657 | 3300048916 | Bacteria | 2539 |
| 530 | Ga0496113_0134710 | 3300048916 | Bacteria | 1940 |
| 531 | Ga0496113_0400016 | 3300048916 | Bacteria | 1103 |
| 532 | Ga0496114_0000566 | 3300048917 | Bacteria | 27443 |
| 533 | Ga0496114_0047621 | 3300048917 | Bacteria | 3566 |
| 534 | Ga0496114_0102606 | 3300048917 | Bacteria | 2444 |
| 535 | Ga0496115_0058979 | 3300048918 | Bacteria | 3090 |
| 536 | Ga0496115_0080302 | 3300048918 | Bacteria | 2655 |
| 537 | Ga0496115_0350726 | 3300048918 | Bacteria | 1204 |
| 538 | Ga0496115_0404011 | 3300048918 | Bacteria | 1108 |
| 539 | Ga0496121_0028323 | 3300048924 | Bacteria | 5218 |
| 540 | Ga0496122_0034168 | 3300048925 | Bacteria | 4167 |
| 541 | Ga0496123_0015211 | 3300048926 | Bacteria | 6327 |
| 542 | Ga0496124_0071138 | 3300048927 | Bacteria | 2885 |
| 543 | Ga0501034_0064304 | 3300049571 | Bacteria | 3683 |
| 544 | Ga0501039_0181166 | 3300049575 | Bacteria | 1657 |
| 545 | Ga0501067_0067500 | 3300049583 | Bacteria | 1980 |
| 546 | Ga0501069_0003742 | 3300049585 | Bacteria | 7817 |
| 547 | Ga0501070_0165021 | 3300049586 | Bacteria | 1825 |
| 548 | Ga0501071_0013001 | 3300049587 | Bacteria | 5663 |
| 549 | Ga0501071_0107687 | 3300049587 | Bacteria | 2058 |
| 550 | Ga0501071_0225616 | 3300049587 | Bacteria | 1411 |
| 551 | Ga0501072_0017135 | 3300049588 | Bacteria | 5567 |
| 552 | Ga0501072_0260338 | 3300049588 | Bacteria | 1381 |
| 553 | Ga0501075_0269676 | 3300049591 | Bacteria | 1297 |
| 554 | Ga0501076_0288312 | 3300049592 | Bacteria | 1345 |
| 555 | Ga0501077_0096301 | 3300049593 | Bacteria | 1876 |
| 556 | Ga0501079_0030481 | 3300049741 | Bacteria | 4144 |
| 557 | Ga0501079_0480102 | 3300049741 | Bacteria | 977 |
| 558 | Ga0501080_0020957 | 3300049742 | Bacteria | 6049 |
| 559 | nmdc:mga03n38_93966_c1 | 3300050490 | Bacteria | 1433 |
| 560 | nmdc:mga00v17_130299_c1 | 3300050491 | Bacteria | 1607 |
| 561 | nmdc:mga00v17_1601_c1 | 3300050491 | Bacteria | 11824 |
| 562 | nmdc:mga00v17_22822_c1 | 3300050491 | Bacteria | 3615 |
| 563 | nmdc:mga09592_10451_c1 | 3300050508 | Bacteria | 7552 |
| 564 | nmdc:mga08y16_171869_c1 | 3300050511 | Bacteria | 2251 |
| 565 | nmdc:mga08y16_333107_c1 | 3300050511 | Bacteria | 1561 |
| 566 | nmdc:mga0a205_412617_c1 | 3300050515 | Bacteria | 1213 |
| 567 | nmdc:mga0a205_62431_c1 | 3300050515 | Bacteria | 3599 |
| 568 | Ga0495601_0025416 | 3300053077 | Bacteria | 3651 |
| 569 | Ga0495601_0283457 | 3300053077 | Bacteria | 1080 |
| 570 | Ga0495612_0006531 | 3300053078 | Bacteria | 4791 |
| 571 | Ga0495595_0009349 | 3300053084 | Bacteria | 4053 |
| 572 | Ga0495619_0035656 | 3300053085 | Bacteria | 3236 |
| 573 | Ga0495619_0067645 | 3300053085 | Bacteria | 2385 |
| 574 | Ga0495619_0081455 | 3300053085 | Bacteria | 2179 |
| 575 | Ga0500554_009284 | 3300053102 | Bacteria | 2349 |
| 576 | Ga0500616_0001555 | 3300053153 | Bacteria | 21520 |
| 577 | Ga0500616_0045578 | 3300053153 | Bacteria | 2335 |
| 578 | Ga0501082_0027429 | 3300060353 | Bacteria | 4903 |
| 579 | Ga0466962_0017629 | 3300061719 | Bacteria | 3438 |
| 580 | Ga0466962_0028461 | 3300061719 | Bacteria | 2677 |
| 581 | Ga0530510_0033367 | 3300061734 | Bacteria | 3707 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100082952 | Ga0070706_1000829524 | 233 |
| 2 | 3300005471 | Ga0070698_100143968 | Ga0070698_1001439682 | 233 |
| 3 | 3300005518 | Ga0070699_100079395 | Ga0070699_1000793953 | 233 |
| 4 | 3300006028 | Ga0070717_10009518 | Ga0070717_100095187 | 233 |
| 5 | 3300025910 | Ga0207684_10491536 | Ga0207684_104915361 | 233 |
| 6 | 3300025922 | Ga0207646_10065164 | Ga0207646_100651641 | 233 |
| 7 | 3300005536 | Ga0070697_100001164 | Ga0070697_10000116410 | 234 |
| 8 | 3300048925 | Ga0496122_0034168 | Ga0496122_0034168_116_1075 | 258 |
| 9 | 3300041413 | Ga0439465_0013322 | Ga0439465_0013322_595_1521 | 260 |
| 10 | 3300042004 | Ga0439445_0012291 | Ga0439445_0012291_995_1915 | 260 |
| 11 | 3300048088 | Ga0495602_0050424 | Ga0495602_0050424_39_881 | 264 |
| 12 | 3300046491 | Ga0495584_0076694 | Ga0495584_0076694_201_1124 | 265 |
| 13 | 3300048926 | Ga0496123_0015211 | Ga0496123_0015211_5493_6308 | 266 |
| 14 | iso_pu_bacteria | 2643221961 | 2645719520 | 266 |
| 15 | 3300041413 | Ga0439465_0050632 | Ga0439465_0050632_371_1291 | 267 |
| 16 | 3300044684 | Ga0466966_0166802 | Ga0466966_0166802_29_841 | 268 |
| 17 | 3300035171 | Ga0373946_0042948 | Ga0373946_0042948_783_1706 | 269 |
| 18 | 3300046473 | Ga0495582_0192998 | Ga0495582_0192998_176_1099 | 269 |
| 19 | 3300005937 | Ga0081455_10000061 | Ga0081455_1000006199 | 270 |
| 20 | 3300048910 | Ga0496107_0381366 | Ga0496107_0381366_130_1023 | 270 |
| 21 | 3300048927 | Ga0496124_0071138 | Ga0496124_0071138_1474_2358 | 270 |
| 22 | 3300045976 | Ga0466967_0032951 | Ga0466967_0032951_480_1304 | 272 |
| 23 | 3300031731 | Ga0307405_10042222 | Ga0307405_100422223 | 273 |
| 24 | 3300031824 | Ga0307413_10216807 | Ga0307413_102168072 | 273 |
| 25 | 3300031995 | Ga0307409_100279231 | Ga0307409_1002792312 | 273 |
| 26 | 3300005435 | Ga0070714_100320762 | Ga0070714_1003207622 | 274 |
| 27 | 3300045976 | Ga0466967_0151193 | Ga0466967_0151193_783_1706 | 274 |
| 28 | 3300021388 | Ga0213875_10005976 | Ga0213875_100059764 | 276 |
| 29 | 3300031548 | Ga0307408_100185731 | Ga0307408_1001857312 | 276 |
| 30 | 3300031852 | Ga0307410_10073994 | Ga0307410_100739943 | 276 |
| 31 | 3300031903 | Ga0307407_10108736 | Ga0307407_101087362 | 276 |
| 32 | 3300032002 | Ga0307416_100182629 | Ga0307416_1001826293 | 276 |
| 33 | 3300037853 | Ga0436364_0680087 | Ga0436364_0680087_1200_2081 | 276 |
| 34 | 3300044765 | Ga0466970_0255684 | Ga0466970_0255684_37_909 | 276 |
| 35 | 3300045836 | Ga0466958_0086378 | Ga0466958_0086378_67_915 | 276 |
| 36 | 3300045976 | Ga0466967_0015938 | Ga0466967_0015938_3157_4035 | 276 |
| 37 | 3300045976 | Ga0466967_0502994 | Ga0466967_0502994_73_942 | 276 |
| 38 | 3300047315 | Ga0495581_0174254 | Ga0495581_0174254_359_1207 | 276 |
| 39 | 3300005329 | Ga0070683_100000273 | Ga0070683_10000027334 | 277 |
| 40 | 3300005341 | Ga0070691_10002612 | Ga0070691_100026124 | 277 |
| 41 | 3300005435 | Ga0070714_100020329 | Ga0070714_1000203294 | 277 |
| 42 | 3300005436 | Ga0070713_100000482 | Ga0070713_10000048214 | 277 |
| 43 | 3300005535 | Ga0070684_100001353 | Ga0070684_1000013535 | 277 |
| 44 | 3300005577 | Ga0068857_100002277 | Ga0068857_10000227712 | 277 |
| 45 | 3300005614 | Ga0068856_100028706 | Ga0068856_1000287062 | 277 |
| 46 | 3300006028 | Ga0070717_10261613 | Ga0070717_102616131 | 277 |
| 47 | 3300013105 | Ga0157369_10017241 | Ga0157369_100172412 | 277 |
| 48 | 3300025928 | Ga0207700_10002830 | Ga0207700_100028304 | 277 |
| 49 | 3300025929 | Ga0207664_10021019 | Ga0207664_100210193 | 277 |
| 50 | 3300025944 | Ga0207661_10001985 | Ga0207661_100019852 | 277 |
| 51 | 3300025945 | Ga0207679_10002540 | Ga0207679_100025403 | 277 |
| 52 | 3300026078 | Ga0207702_10002389 | Ga0207702_100023894 | 277 |
| 53 | 3300026116 | Ga0207674_10001810 | Ga0207674_1000181012 | 277 |
| 54 | 3300044684 | Ga0466966_0246315 | Ga0466966_0246315_174_1031 | 277 |
| 55 | 3300044842 | Ga0466957_0208819 | Ga0466957_0208819_88_945 | 277 |
| 56 | 3300048908 | Ga0496105_0235241 | Ga0496105_0235241_174_1160 | 277 |
| 57 | 3300048912 | Ga0496109_0151555 | Ga0496109_0151555_421_1407 | 277 |
| 58 | 3300050511 | nmdc:mga08y16_333107_c1 | nmdc:mga08y16_333107_c1_34_921 | 277 |
| 59 | 3300003659 | JGI25404J52841_10006763 | JGI25404J52841_100067633 | 278 |
| 60 | 3300025928 | Ga0207700_10318488 | Ga0207700_103184882 | 278 |
| 61 | 3300042876 | Ga0451577_0085975 | Ga0451577_0085975_107_976 | 278 |
| 62 | 3300044694 | Ga0466963_0291942 | Ga0466963_0291942_238_1116 | 278 |
| 63 | 3300048907 | Ga0496104_0092737 | Ga0496104_0092737_743_1621 | 278 |
| 64 | 3300050491 | nmdc:mga00v17_130299_c1 | nmdc:mga00v17_130299_c1_468_1406 | 278 |
| 65 | iso_pu_bacteria | 2643221962 | 2645726427 | 278 |
| 66 | 3300005329 | Ga0070683_100085500 | Ga0070683_1000855003 | 279 |
| 67 | 3300005336 | Ga0070680_100055512 | Ga0070680_1000555124 | 279 |
| 68 | 3300005337 | Ga0070682_100087690 | Ga0070682_1000876902 | 279 |
| 69 | 3300005339 | Ga0070660_100160760 | Ga0070660_1001607601 | 279 |
| 70 | 3300005344 | Ga0070661_100217614 | Ga0070661_1002176142 | 279 |
| 71 | 3300005364 | Ga0070673_100236661 | Ga0070673_1002366612 | 279 |
| 72 | 3300005441 | Ga0070700_100151883 | Ga0070700_1001518832 | 279 |
| 73 | 3300005455 | Ga0070663_100109588 | Ga0070663_1001095882 | 279 |
| 74 | 3300005456 | Ga0070678_100002983 | Ga0070678_10000298312 | 279 |
| 75 | 3300005458 | Ga0070681_10023828 | Ga0070681_100238285 | 279 |
| 76 | 3300005530 | Ga0070679_100050313 | Ga0070679_1000503134 | 279 |
| 77 | 3300005535 | Ga0070684_100001222 | Ga0070684_10000122218 | 279 |
| 78 | 3300005547 | Ga0070693_100003064 | Ga0070693_1000030646 | 279 |
| 79 | 3300005614 | Ga0068856_100010876 | Ga0068856_1000108769 | 279 |
| 80 | 3300005615 | Ga0070702_100060083 | Ga0070702_1000600833 | 279 |
| 81 | 3300006358 | Ga0068871_100239102 | Ga0068871_1002391022 | 279 |
| 82 | 3300009148 | Ga0105243_10027181 | Ga0105243_100271813 | 279 |
| 83 | 3300009174 | Ga0105241_10123667 | Ga0105241_101236672 | 279 |
| 84 | 3300009553 | Ga0105249_10337195 | Ga0105249_103371952 | 279 |
| 85 | 3300011119 | Ga0105246_10163516 | Ga0105246_101635162 | 279 |
| 86 | 3300013308 | Ga0157375_10012778 | Ga0157375_100127786 | 279 |
| 87 | 3300014969 | Ga0157376_10116556 | Ga0157376_101165562 | 279 |
| 88 | 3300025917 | Ga0207660_10041400 | Ga0207660_100414004 | 279 |
| 89 | 3300025919 | Ga0207657_10139030 | Ga0207657_101390302 | 279 |
| 90 | 3300025920 | Ga0207649_10025548 | Ga0207649_100255483 | 279 |
| 91 | 3300025921 | Ga0207652_10110518 | Ga0207652_101105184 | 279 |
| 92 | 3300025935 | Ga0207709_10010699 | Ga0207709_100106993 | 279 |
| 93 | 3300025944 | Ga0207661_10002631 | Ga0207661_1000263110 | 279 |
| 94 | 3300025945 | Ga0207679_10017050 | Ga0207679_100170504 | 279 |
| 95 | 3300026067 | Ga0207678_10184061 | Ga0207678_101840612 | 279 |
| 96 | 3300026078 | Ga0207702_10006607 | Ga0207702_100066073 | 279 |
| 97 | 3300026121 | Ga0207683_10002893 | Ga0207683_100028939 | 279 |
| 98 | 3300031903 | Ga0307407_10094006 | Ga0307407_100940062 | 279 |
| 99 | 3300031995 | Ga0307409_100258019 | Ga0307409_1002580192 | 279 |
| 100 | 3300032002 | Ga0307416_100342664 | Ga0307416_1003426641 | 279 |
| 101 | 3300044694 | Ga0466963_0226857 | Ga0466963_0226857_236_1096 | 279 |
| 102 | 3300048903 | Ga0496100_0284208 | Ga0496100_0284208_110_982 | 279 |
| 103 | 3300048905 | Ga0496102_0002009 | Ga0496102_0002009_670_1542 | 279 |
| 104 | 3300048906 | Ga0496103_0007363 | Ga0496103_0007363_5040_5912 | 279 |
| 105 | 3300048907 | Ga0496104_0018652 | Ga0496104_0018652_2400_3272 | 279 |
| 106 | 3300048908 | Ga0496105_0010539 | Ga0496105_0010539_2461_3333 | 279 |
| 107 | 3300048917 | Ga0496114_0000566 | Ga0496114_0000566_20922_21794 | 279 |
| 108 | 3300049587 | Ga0501071_0225616 | Ga0501071_0225616_351_1271 | 279 |
| 109 | 3300049591 | Ga0501075_0269676 | Ga0501075_0269676_225_1145 | 279 |
| 110 | 3300005327 | Ga0070658_10140827 | Ga0070658_101408272 | 280 |
| 111 | 3300005329 | Ga0070683_100146238 | Ga0070683_1001462382 | 280 |
| 112 | 3300005455 | Ga0070663_100148620 | Ga0070663_1001486202 | 280 |
| 113 | 3300005457 | Ga0070662_100085307 | Ga0070662_1000853073 | 280 |
| 114 | 3300009148 | Ga0105243_10458144 | Ga0105243_104581442 | 280 |
| 115 | 3300013105 | Ga0157369_10454113 | Ga0157369_104541132 | 280 |
| 116 | 3300013306 | Ga0163162_10377765 | Ga0163162_103777652 | 280 |
| 117 | 3300014326 | Ga0157380_10522032 | Ga0157380_105220321 | 280 |
| 118 | 3300014745 | Ga0157377_10111855 | Ga0157377_101118552 | 280 |
| 119 | 3300020081 | Ga0206354_10937210 | Ga0206354_109372101 | 280 |
| 120 | 3300021384 | Ga0213876_10051944 | Ga0213876_100519444 | 280 |
| 121 | 3300025933 | Ga0207706_10060281 | Ga0207706_100602813 | 280 |
| 122 | 3300025937 | Ga0207669_10056703 | Ga0207669_100567032 | 280 |
| 123 | 3300025944 | Ga0207661_10130597 | Ga0207661_101305972 | 280 |
| 124 | 3300025945 | Ga0207679_10151163 | Ga0207679_101511632 | 280 |
| 125 | 3300025981 | Ga0207640_10044456 | Ga0207640_100444563 | 280 |
| 126 | 3300026023 | Ga0207677_10072368 | Ga0207677_100723684 | 280 |
| 127 | 3300026075 | Ga0207708_10087204 | Ga0207708_100872043 | 280 |
| 128 | 3300031548 | Ga0307408_100048614 | Ga0307408_1000486142 | 280 |
| 129 | 3300031731 | Ga0307405_10119470 | Ga0307405_101194702 | 280 |
| 130 | 3300031824 | Ga0307413_10183290 | Ga0307413_101832902 | 280 |
| 131 | 3300031824 | Ga0307413_10201985 | Ga0307413_102019852 | 280 |
| 132 | 3300031852 | Ga0307410_10256255 | Ga0307410_102562552 | 280 |
| 133 | 3300031901 | Ga0307406_10012775 | Ga0307406_100127752 | 280 |
| 134 | 3300031901 | Ga0307406_10173302 | Ga0307406_101733022 | 280 |
| 135 | 3300031901 | Ga0307406_10280898 | Ga0307406_102808981 | 280 |
| 136 | 3300031903 | Ga0307407_10009600 | Ga0307407_100096004 | 280 |
| 137 | 3300031903 | Ga0307407_10016601 | Ga0307407_100166013 | 280 |
| 138 | 3300031911 | Ga0307412_10049095 | Ga0307412_100490952 | 280 |
| 139 | 3300031995 | Ga0307409_100025701 | Ga0307409_1000257012 | 280 |
| 140 | 3300031995 | Ga0307409_100072101 | Ga0307409_1000721011 | 280 |
| 141 | 3300031995 | Ga0307409_100074615 | Ga0307409_1000746153 | 280 |
| 142 | 3300031995 | Ga0307409_100422066 | Ga0307409_1004220662 | 280 |
| 143 | 3300032002 | Ga0307416_100056864 | Ga0307416_1000568644 | 280 |
| 144 | 3300032002 | Ga0307416_100270451 | Ga0307416_1002704512 | 280 |
| 145 | 3300032002 | Ga0307416_100347051 | Ga0307416_1003470512 | 280 |
| 146 | 3300032004 | Ga0307414_10450940 | Ga0307414_104509401 | 280 |
| 147 | 3300032126 | Ga0307415_100017461 | Ga0307415_1000174614 | 280 |
| 148 | 3300032126 | Ga0307415_100239678 | Ga0307415_1002396782 | 280 |
| 149 | 3300032126 | Ga0307415_100289327 | Ga0307415_1002893271 | 280 |
| 150 | 3300035725 | Ga0373947_0205173 | Ga0373947_0205173_243_1109 | 280 |
| 151 | 3300037418 | Ga0395900_0026768 | Ga0395900_0026768_4340_5245 | 280 |
| 152 | 3300037466 | Ga0395898_0072226 | Ga0395898_0072226_1381_2286 | 280 |
| 153 | 3300037466 | Ga0395898_0159101 | Ga0395898_0159101_506_1411 | 280 |
| 154 | 3300039437 | Ga0436365_1286349 | Ga0436365_1286349_1344_2231 | 280 |
| 155 | 3300041413 | Ga0439465_0013641 | Ga0439465_0013641_401_1285 | 280 |
| 156 | 3300044684 | Ga0466966_0232134 | Ga0466966_0232134_173_1078 | 280 |
| 157 | 3300044693 | Ga0466961_0063738 | Ga0466961_0063738_904_1821 | 280 |
| 158 | 3300044694 | Ga0466963_0045551 | Ga0466963_0045551_481_1392 | 280 |
| 159 | 3300044765 | Ga0466970_0035870 | Ga0466970_0035870_660_1577 | 280 |
| 160 | 3300044842 | Ga0466957_0214908 | Ga0466957_0214908_126_1100 | 280 |
| 161 | 3300044901 | Ga0466960_0037284 | Ga0466960_0037284_831_1736 | 280 |
| 162 | 3300044901 | Ga0466960_0072951 | Ga0466960_0072951_697_1563 | 280 |
| 163 | 3300044901 | Ga0466960_0127815 | Ga0466960_0127815_76_981 | 280 |
| 164 | 3300044901 | Ga0466960_0255806 | Ga0466960_0255806_25_918 | 280 |
| 165 | 3300045836 | Ga0466958_0156227 | Ga0466958_0156227_437_1348 | 280 |
| 166 | 3300045976 | Ga0466967_0031676 | Ga0466967_0031676_2879_3784 | 280 |
| 167 | 3300045976 | Ga0466967_0033244 | Ga0466967_0033244_2116_3021 | 280 |
| 168 | 3300045976 | Ga0466967_0398483 | Ga0466967_0398483_15_992 | 280 |
| 169 | 3300048915 | Ga0496112_0531990 | Ga0496112_0531990_79_963 | 280 |
| 170 | 3300049587 | Ga0501071_0107687 | Ga0501071_0107687_864_1751 | 280 |
| 171 | 3300049588 | Ga0501072_0017135 | Ga0501072_0017135_143_1030 | 280 |
| 172 | iso_pu_bacteria | 2643221649 | 2644279834 | 280 |
| 173 | 3300005436 | Ga0070713_100444784 | Ga0070713_1004447842 | 281 |
| 174 | 3300005468 | Ga0070707_100014238 | Ga0070707_1000142383 | 281 |
| 175 | 3300006051 | Ga0075364_10009834 | Ga0075364_100098343 | 281 |
| 176 | 3300009148 | Ga0105243_10116023 | Ga0105243_101160232 | 281 |
| 177 | 3300025906 | Ga0207699_10242547 | Ga0207699_102425472 | 281 |
| 178 | 3300025935 | Ga0207709_10092095 | Ga0207709_100920952 | 281 |
| 179 | 3300034820 | Ga0373959_0000036 | Ga0373959_0000036_3005_3934 | 281 |
| 180 | 3300035111 | Ga0373923_0020647 | Ga0373923_0020647_1346_2251 | 281 |
| 181 | 3300035113 | Ga0373936_0006445 | Ga0373936_0006445_3403_4308 | 281 |
| 182 | 3300035117 | Ga0373953_0070870 | Ga0373953_0070870_145_1050 | 281 |
| 183 | 3300035118 | Ga0373954_0089328 | Ga0373954_0089328_260_1165 | 281 |
| 184 | 3300035119 | Ga0373956_0008238 | Ga0373956_0008238_2838_3743 | 281 |
| 185 | 3300035120 | Ga0373957_0000714 | Ga0373957_0000714_7539_8444 | 281 |
| 186 | 3300035170 | Ga0373943_0087361 | Ga0373943_0087361_587_1492 | 281 |
| 187 | 3300035172 | Ga0373955_0004537 | Ga0373955_0004537_1585_2490 | 281 |
| 188 | 3300035410 | Ga0373924_0000429 | Ga0373924_0000429_4358_5263 | 281 |
| 189 | 3300035692 | Ga0373935_0018471 | Ga0373935_0018471_2145_3050 | 281 |
| 190 | 3300037312 | Ga0395899_0099440 | Ga0395899_0099440_1154_2083 | 281 |
| 191 | 3300037471 | Ga0395905_0181580 | Ga0395905_0181580_1028_1957 | 281 |
| 192 | 3300037853 | Ga0436364_0650330 | Ga0436364_0650330_94_1011 | 281 |
| 193 | 3300038443 | Ga0395901_0021587 | Ga0395901_0021587_2638_3567 | 281 |
| 194 | 3300039450 | Ga0436363_0666383 | Ga0436363_0666383_260_1129 | 281 |
| 195 | 3300045976 | Ga0466967_0365590 | Ga0466967_0365590_53_922 | 281 |
| 196 | 3300045976 | Ga0466967_0467133 | Ga0466967_0467133_116_985 | 281 |
| 197 | 3300046459 | Ga0495629_0009584 | Ga0495629_0009584_3325_4230 | 281 |
| 198 | 3300046462 | Ga0495651_0071817 | Ga0495651_0071817_394_1299 | 281 |
| 199 | 3300046463 | Ga0495653_0123711 | Ga0495653_0123711_873_1778 | 281 |
| 200 | 3300046473 | Ga0495582_0002461 | Ga0495582_0002461_9202_10107 | 281 |
| 201 | 3300046476 | Ga0495662_0002246 | Ga0495662_0002246_297_1202 | 281 |
| 202 | 3300046477 | Ga0495664_0034980 | Ga0495664_0034980_252_1157 | 281 |
| 203 | 3300046511 | Ga0495608_0019271 | Ga0495608_0019271_595_1500 | 281 |
| 204 | 3300046516 | Ga0495628_0147130 | Ga0495628_0147130_476_1381 | 281 |
| 205 | 3300046531 | Ga0495665_0014736 | Ga0495665_0014736_3050_3955 | 281 |
| 206 | 3300046533 | Ga0495640_0014300 | Ga0495640_0014300_4717_5622 | 281 |
| 207 | 3300046536 | Ga0495587_0013976 | Ga0495587_0013976_3574_4479 | 281 |
| 208 | 3300046543 | Ga0495645_0059517 | Ga0495645_0059517_193_1098 | 281 |
| 209 | 3300046543 | Ga0495645_0073654 | Ga0495645_0073654_151_1056 | 281 |
| 210 | 3300046559 | Ga0495667_0108385 | Ga0495667_0108385_522_1427 | 281 |
| 211 | 3300046642 | Ga0495634_0012983 | Ga0495634_0012983_476_1381 | 281 |
| 212 | 3300046663 | Ga0495635_0015413 | Ga0495635_0015413_3966_4871 | 281 |
| 213 | 3300046675 | Ga0495657_0035590 | Ga0495657_0035590_873_1778 | 281 |
| 214 | 3300046678 | Ga0495599_0052435 | Ga0495599_0052435_873_1778 | 281 |
| 215 | 3300046680 | Ga0495646_0028962 | Ga0495646_0028962_2146_3051 | 281 |
| 216 | 3300046689 | Ga0495613_0028770 | Ga0495613_0028770_161_1066 | 281 |
| 217 | 3300046690 | Ga0495624_0007724 | Ga0495624_0007724_155_1060 | 281 |
| 218 | 3300046809 | Ga0495600_0001528 | Ga0495600_0001528_8459_9364 | 281 |
| 219 | 3300047315 | Ga0495581_0004445 | Ga0495581_0004445_7079_7984 | 281 |
| 220 | 3300047673 | Ga0495593_0014761 | Ga0495593_0014761_3338_4243 | 281 |
| 221 | 3300049575 | Ga0501039_0181166 | Ga0501039_0181166_698_1591 | 281 |
| 222 | 3300049583 | Ga0501067_0067500 | Ga0501067_0067500_1030_1920 | 281 |
| 223 | 3300049741 | Ga0501079_0480102 | Ga0501079_0480102_52_966 | 281 |
| 224 | 3300050491 | nmdc:mga00v17_1601_c1 | nmdc:mga00v17_1601_c1_6217_7146 | 281 |
| 225 | 3300053078 | Ga0495612_0006531 | Ga0495612_0006531_2790_3695 | 281 |
| 226 | 3300053085 | Ga0495619_0081455 | Ga0495619_0081455_625_1530 | 281 |
| 227 | 3300053102 | Ga0500554_009284 | Ga0500554_009284_814_1716 | 281 |
| 228 | 3300005434 | Ga0070709_10006089 | Ga0070709_100060893 | 282 |
| 229 | 3300005435 | Ga0070714_100029533 | Ga0070714_1000295334 | 282 |
| 230 | 3300005435 | Ga0070714_100029681 | Ga0070714_1000296814 | 282 |
| 231 | 3300005436 | Ga0070713_100043399 | Ga0070713_1000433992 | 282 |
| 232 | 3300005437 | Ga0070710_10014749 | Ga0070710_100147492 | 282 |
| 233 | 3300005439 | Ga0070711_100284466 | Ga0070711_1002844661 | 282 |
| 234 | 3300006028 | Ga0070717_10256769 | Ga0070717_102567692 | 282 |
| 235 | 3300006173 | Ga0070716_100062528 | Ga0070716_1000625282 | 282 |
| 236 | 3300006175 | Ga0070712_100042477 | Ga0070712_1000424772 | 282 |
| 237 | 3300025906 | Ga0207699_10089203 | Ga0207699_100892032 | 282 |
| 238 | 3300025915 | Ga0207693_10034195 | Ga0207693_100341952 | 282 |
| 239 | 3300025928 | Ga0207700_10002355 | Ga0207700_100023552 | 282 |
| 240 | 3300025928 | Ga0207700_10007455 | Ga0207700_100074552 | 282 |
| 241 | 3300025929 | Ga0207664_10004846 | Ga0207664_100048467 | 282 |
| 242 | 3300025939 | Ga0207665_10002563 | Ga0207665_1000256311 | 282 |
| 243 | 3300044683 | Ga0466965_0143556 | Ga0466965_0143556_163_1080 | 282 |
| 244 | 3300049593 | Ga0501077_0096301 | Ga0501077_0096301_812_1735 | 282 |
| 245 | iso_pu_bacteria | 2643221681 | 2644457272 | 282 |
| 246 | 3300005354 | Ga0070675_100408169 | Ga0070675_1004081691 | 283 |
| 247 | 3300005366 | Ga0070659_100000030 | Ga0070659_100000030107 | 283 |
| 248 | 3300005435 | Ga0070714_100000228 | Ga0070714_10000022841 | 283 |
| 249 | 3300005435 | Ga0070714_100014755 | Ga0070714_1000147552 | 283 |
| 250 | 3300005437 | Ga0070710_10000009 | Ga0070710_10000009148 | 283 |
| 251 | 3300005440 | Ga0070705_100001133 | Ga0070705_1000011334 | 283 |
| 252 | 3300005441 | Ga0070700_100099772 | Ga0070700_1000997723 | 283 |
| 253 | 3300006028 | Ga0070717_10000013 | Ga0070717_1000001321 | 283 |
| 254 | 3300006175 | Ga0070712_100000003 | Ga0070712_100000003107 | 283 |
| 255 | 3300009093 | Ga0105240_10073705 | Ga0105240_100737056 | 283 |
| 256 | 3300009176 | Ga0105242_10516851 | Ga0105242_105168512 | 283 |
| 257 | 3300010375 | Ga0105239_10124568 | Ga0105239_101245683 | 283 |
| 258 | 3300011119 | Ga0105246_10063300 | Ga0105246_100633002 | 283 |
| 259 | 3300025898 | Ga0207692_10000005 | Ga0207692_10000005179 | 283 |
| 260 | 3300025915 | Ga0207693_10000009 | Ga0207693_1000000917 | 283 |
| 261 | 3300025929 | Ga0207664_10000060 | Ga0207664_1000006040 | 283 |
| 262 | 3300025929 | Ga0207664_10002459 | Ga0207664_1000245911 | 283 |
| 263 | 3300025932 | Ga0207690_10000328 | Ga0207690_1000032810 | 283 |
| 264 | 3300026075 | Ga0207708_10135339 | Ga0207708_101353393 | 283 |
| 265 | 3300028558 | Ga0265326_10000024 | Ga0265326_1000002472 | 283 |
| 266 | 3300028563 | Ga0265319_1000116 | Ga0265319_100011646 | 283 |
| 267 | 3300028573 | Ga0265334_10000151 | Ga0265334_100001514 | 283 |
| 268 | 3300028666 | Ga0265336_10006718 | Ga0265336_100067181 | 283 |
| 269 | 3300028800 | Ga0265338_10001994 | Ga0265338_1000199424 | 283 |
| 270 | 3300029957 | Ga0265324_10008959 | Ga0265324_100089592 | 283 |
| 271 | 3300031251 | Ga0265327_10031394 | Ga0265327_100313943 | 283 |
| 272 | 3300031903 | Ga0307407_10068501 | Ga0307407_100685012 | 283 |
| 273 | 3300031995 | Ga0307409_100092499 | Ga0307409_1000924992 | 283 |
| 274 | 3300044694 | Ga0466963_0071048 | Ga0466963_0071048_533_1459 | 283 |
| 275 | 3300044719 | Ga0466971_0027622 | Ga0466971_0027622_943_1869 | 283 |
| 276 | 3300044842 | Ga0466957_0015199 | Ga0466957_0015199_1621_2547 | 283 |
| 277 | 3300044901 | Ga0466960_0058071 | Ga0466960_0058071_633_1562 | 283 |
| 278 | 3300047320 | Ga0495672_0017893 | Ga0495672_0017893_3143_4000 | 283 |
| 279 | 3300048903 | Ga0496100_0000470 | Ga0496100_0000470_7074_7934 | 283 |
| 280 | 3300048904 | Ga0496101_0006054 | Ga0496101_0006054_370_1230 | 283 |
| 281 | 3300048912 | Ga0496109_0032485 | Ga0496109_0032485_1293_2153 | 283 |
| 282 | 3300049585 | Ga0501069_0003742 | Ga0501069_0003742_1801_2658 | 283 |
| 283 | 3300049741 | Ga0501079_0030481 | Ga0501079_0030481_229_1086 | 283 |
| 284 | 3300049742 | Ga0501080_0020957 | Ga0501080_0020957_83_940 | 283 |
| 285 | 3300050508 | nmdc:mga09592_10451_c1 | nmdc:mga09592_10451_c1_1231_2091 | 283 |
| 286 | 3300050515 | nmdc:mga0a205_412617_c1 | nmdc:mga0a205_412617_c1_325_1185 | 283 |
| 287 | 3300061719 | Ga0466962_0017629 | Ga0466962_0017629_2226_3152 | 283 |
| 288 | 3300005329 | Ga0070683_100037529 | Ga0070683_1000375292 | 284 |
| 289 | 3300005353 | Ga0070669_100001519 | Ga0070669_10000151914 | 284 |
| 290 | 3300005937 | Ga0081455_10014973 | Ga0081455_100149733 | 284 |
| 291 | 3300006880 | Ga0075429_100011965 | Ga0075429_1000119655 | 284 |
| 292 | 3300025906 | Ga0207699_10190624 | Ga0207699_101906242 | 284 |
| 293 | 3300025923 | Ga0207681_10003140 | Ga0207681_100031408 | 284 |
| 294 | 3300026089 | Ga0207648_10098033 | Ga0207648_100980333 | 284 |
| 295 | 3300035724 | Ga0373933_0101262 | Ga0373933_0101262_68_997 | 284 |
| 296 | 3300039437 | Ga0436365_0066499 | Ga0436365_0066499_194_1135 | 284 |
| 297 | 3300045049 | Ga0466959_0124646 | Ga0466959_0124646_292_1218 | 284 |
| 298 | 3300045836 | Ga0466958_0054453 | Ga0466958_0054453_1403_2329 | 284 |
| 299 | 3300045976 | Ga0466967_0181230 | Ga0466967_0181230_320_1234 | 284 |
| 300 | 3300046454 | Ga0495592_0108552 | Ga0495592_0108552_818_1747 | 284 |
| 301 | 3300046463 | Ga0495653_0125888 | Ga0495653_0125888_519_1448 | 284 |
| 302 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_324412_325290 | 284 |
| 303 | 3300046516 | Ga0495628_0084420 | Ga0495628_0084420_99_1028 | 284 |
| 304 | 3300046529 | Ga0495652_0058249 | Ga0495652_0058249_118_1047 | 284 |
| 305 | 3300046533 | Ga0495640_0026590 | Ga0495640_0026590_1246_2175 | 284 |
| 306 | 3300046543 | Ga0495645_0027079 | Ga0495645_0027079_1483_2412 | 284 |
| 307 | 3300046559 | Ga0495667_0043026 | Ga0495667_0043026_1466_2395 | 284 |
| 308 | 3300046642 | Ga0495634_0075685 | Ga0495634_0075685_1254_2183 | 284 |
| 309 | 3300048915 | Ga0496112_0002049 | Ga0496112_0002049_4877_5755 | 284 |
| 310 | 3300048916 | Ga0496113_0077657 | Ga0496113_0077657_663_1532 | 284 |
| 311 | 3300053077 | Ga0495601_0025416 | Ga0495601_0025416_1659_2588 | 284 |
| 312 | 3300053085 | Ga0495619_0067645 | Ga0495619_0067645_126_1055 | 284 |
| 313 | 3300005458 | Ga0070681_10172230 | Ga0070681_101722302 | 285 |
| 314 | 3300005937 | Ga0081455_10012210 | Ga0081455_100122108 | 285 |
| 315 | 3300005981 | Ga0081538_10004166 | Ga0081538_100041664 | 285 |
| 316 | 3300005985 | Ga0081539_10030182 | Ga0081539_100301823 | 285 |
| 317 | 3300031995 | Ga0307409_100003756 | Ga0307409_1000037563 | 285 |
| 318 | 3300031995 | Ga0307409_100107783 | Ga0307409_1001077831 | 285 |
| 319 | 3300032002 | Ga0307416_100053336 | Ga0307416_1000533363 | 285 |
| 320 | 3300032005 | Ga0307411_10136864 | Ga0307411_101368641 | 285 |
| 321 | 3300032126 | Ga0307415_100004089 | Ga0307415_1000040893 | 285 |
| 322 | 3300037418 | Ga0395900_0252665 | Ga0395900_0252665_39_908 | 285 |
| 323 | 3300038443 | Ga0395901_0239235 | Ga0395901_0239235_599_1468 | 285 |
| 324 | 3300045976 | Ga0466967_0211614 | Ga0466967_0211614_288_1154 | 285 |
| 325 | 3300048908 | Ga0496105_0074603 | Ga0496105_0074603_1640_2629 | 285 |
| 326 | 3300048912 | Ga0496109_0000635 | Ga0496109_0000635_2193_3128 | 285 |
| 327 | 3300005338 | Ga0068868_100087153 | Ga0068868_1000871532 | 286 |
| 328 | 3300005355 | Ga0070671_100309627 | Ga0070671_1003096272 | 286 |
| 329 | 3300005435 | Ga0070714_100043792 | Ga0070714_1000437924 | 286 |
| 330 | 3300005466 | Ga0070685_10113676 | Ga0070685_101136762 | 286 |
| 331 | 3300005578 | Ga0068854_100103784 | Ga0068854_1001037842 | 286 |
| 332 | 3300005617 | Ga0068859_100532309 | Ga0068859_1005323091 | 286 |
| 333 | 3300005719 | Ga0068861_100183417 | Ga0068861_1001834172 | 286 |
| 334 | 3300005842 | Ga0068858_100261857 | Ga0068858_1002618572 | 286 |
| 335 | 3300005981 | Ga0081538_10027953 | Ga0081538_100279533 | 286 |
| 336 | 3300006881 | Ga0068865_100129908 | Ga0068865_1001299082 | 286 |
| 337 | 3300006931 | Ga0097620_100532296 | Ga0097620_1005322961 | 286 |
| 338 | 3300009148 | Ga0105243_10184345 | Ga0105243_101843452 | 286 |
| 339 | 3300009553 | Ga0105249_10149050 | Ga0105249_101490503 | 286 |
| 340 | 3300011119 | Ga0105246_10114548 | Ga0105246_101145482 | 286 |
| 341 | 3300013104 | Ga0157370_10154667 | Ga0157370_101546672 | 286 |
| 342 | 3300025901 | Ga0207688_10033001 | Ga0207688_100330013 | 286 |
| 343 | 3300025931 | Ga0207644_10302278 | Ga0207644_103022781 | 286 |
| 344 | 3300025933 | Ga0207706_10243218 | Ga0207706_102432182 | 286 |
| 345 | 3300025938 | Ga0207704_10046266 | Ga0207704_100462662 | 286 |
| 346 | 3300025961 | Ga0207712_10131473 | Ga0207712_101314732 | 286 |
| 347 | 3300026035 | Ga0207703_10711816 | Ga0207703_107118161 | 286 |
| 348 | 3300031824 | Ga0307413_10037024 | Ga0307413_100370243 | 286 |
| 349 | 3300032002 | Ga0307416_100367108 | Ga0307416_1003671082 | 286 |
| 350 | 3300032002 | Ga0307416_100652331 | Ga0307416_1006523312 | 286 |
| 351 | 3300032126 | Ga0307415_100021281 | Ga0307415_1000212813 | 286 |
| 352 | 3300037418 | Ga0395900_0024961 | Ga0395900_0024961_3084_4076 | 286 |
| 353 | 3300037418 | Ga0395900_0180330 | Ga0395900_0180330_1134_1997 | 286 |
| 354 | 3300042016 | Ga0439463_001759 | Ga0439463_001759_1753_2709 | 286 |
| 355 | 3300044656 | Ga0466969_0029978 | Ga0466969_0029978_1875_2741 | 286 |
| 356 | 3300044684 | Ga0466966_0074136 | Ga0466966_0074136_329_1195 | 286 |
| 357 | 3300044694 | Ga0466963_0067035 | Ga0466963_0067035_1001_1867 | 286 |
| 358 | 3300044735 | Ga0466968_0030526 | Ga0466968_0030526_198_1064 | 286 |
| 359 | 3300045049 | Ga0466959_0048861 | Ga0466959_0048861_1472_2338 | 286 |
| 360 | 3300045836 | Ga0466958_0031318 | Ga0466958_0031318_1898_2764 | 286 |
| 361 | 3300045976 | Ga0466967_0211355 | Ga0466967_0211355_430_1296 | 286 |
| 362 | 3300045976 | Ga0466967_0477975 | Ga0466967_0477975_16_987 | 286 |
| 363 | 3300048903 | Ga0496100_0067633 | Ga0496100_0067633_875_1807 | 286 |
| 364 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_624140_625069 | 286 |
| 365 | 3300048909 | Ga0496106_0004922 | Ga0496106_0004922_8503_9435 | 286 |
| 366 | 3300048909 | Ga0496106_0029806 | Ga0496106_0029806_120_989 | 286 |
| 367 | 3300048909 | Ga0496106_0208539 | Ga0496106_0208539_68_991 | 286 |
| 368 | 3300048910 | Ga0496107_0002555 | Ga0496107_0002555_8999_9931 | 286 |
| 369 | 3300048910 | Ga0496107_0256369 | Ga0496107_0256369_264_1133 | 286 |
| 370 | 3300048912 | Ga0496109_0032943 | Ga0496109_0032943_2033_2956 | 286 |
| 371 | 3300048912 | Ga0496109_0316464 | Ga0496109_0316464_360_1229 | 286 |
| 372 | 3300048913 | Ga0496110_0151702 | Ga0496110_0151702_24_947 | 286 |
| 373 | 3300048914 | Ga0496111_0004903 | Ga0496111_0004903_1647_2570 | 286 |
| 374 | 3300048914 | Ga0496111_0183593 | Ga0496111_0183593_486_1355 | 286 |
| 375 | 3300048915 | Ga0496112_0118688 | Ga0496112_0118688_306_1229 | 286 |
| 376 | 3300048916 | Ga0496113_0040688 | Ga0496113_0040688_367_1290 | 286 |
| 377 | 3300049588 | Ga0501072_0260338 | Ga0501072_0260338_68_985 | 286 |
| 378 | 3300050490 | nmdc:mga03n38_93966_c1 | nmdc:mga03n38_93966_c1_328_1248 | 286 |
| 379 | 3300050491 | nmdc:mga00v17_22822_c1 | nmdc:mga00v17_22822_c1_975_1895 | 286 |
| 380 | 3300013306 | Ga0163162_10257599 | Ga0163162_102575992 | 287 |
| 381 | 3300026118 | Ga0207675_100112750 | Ga0207675_1001127503 | 287 |
| 382 | 3300044694 | Ga0466963_0055458 | Ga0466963_0055458_95_1057 | 287 |
| 383 | 3300044719 | Ga0466971_0007663 | Ga0466971_0007663_1783_2745 | 287 |
| 384 | 3300044842 | Ga0466957_0012198 | Ga0466957_0012198_1129_2091 | 287 |
| 385 | 3300053153 | Ga0500616_0001555 | Ga0500616_0001555_7966_8892 | 287 |
| 386 | 3300061719 | Ga0466962_0028461 | Ga0466962_0028461_579_1541 | 287 |
| 387 | iso_pu_bacteria | 2855386786 | 2855388172 | 287 |
| 388 | 3300005441 | Ga0070700_100018947 | Ga0070700_1000189471 | 288 |
| 389 | 3300005445 | Ga0070708_100261161 | Ga0070708_1002611612 | 288 |
| 390 | 3300005455 | Ga0070663_100401207 | Ga0070663_1004012072 | 288 |
| 391 | 3300005468 | Ga0070707_100011610 | Ga0070707_1000116107 | 288 |
| 392 | 3300005468 | Ga0070707_100025661 | Ga0070707_1000256616 | 288 |
| 393 | 3300005468 | Ga0070707_100055121 | Ga0070707_1000551214 | 288 |
| 394 | 3300005536 | Ga0070697_100031546 | Ga0070697_1000315463 | 288 |
| 395 | 3300005545 | Ga0070695_100106485 | Ga0070695_1001064852 | 288 |
| 396 | 3300005719 | Ga0068861_100116631 | Ga0068861_1001166312 | 288 |
| 397 | 3300006844 | Ga0075428_100474101 | Ga0075428_1004741012 | 288 |
| 398 | 3300009098 | Ga0105245_10205182 | Ga0105245_102051822 | 288 |
| 399 | 3300009148 | Ga0105243_10045679 | Ga0105243_100456792 | 288 |
| 400 | 3300021384 | Ga0213876_10096880 | Ga0213876_100968802 | 288 |
| 401 | 3300021384 | Ga0213876_10099209 | Ga0213876_100992092 | 288 |
| 402 | 3300021388 | Ga0213875_10004578 | Ga0213875_100045785 | 288 |
| 403 | 3300025910 | Ga0207684_10066593 | Ga0207684_100665933 | 288 |
| 404 | 3300025922 | Ga0207646_10010743 | Ga0207646_100107436 | 288 |
| 405 | 3300025922 | Ga0207646_10019332 | Ga0207646_100193325 | 288 |
| 406 | 3300025937 | Ga0207669_10169833 | Ga0207669_101698332 | 288 |
| 407 | 3300025938 | Ga0207704_10107433 | Ga0207704_101074332 | 288 |
| 408 | 3300026075 | Ga0207708_10003021 | Ga0207708_1000302116 | 288 |
| 409 | 3300026089 | Ga0207648_10098670 | Ga0207648_100986702 | 288 |
| 410 | 3300026118 | Ga0207675_100018890 | Ga0207675_1000188904 | 288 |
| 411 | 3300031852 | Ga0307410_10082688 | Ga0307410_100826882 | 288 |
| 412 | 3300037853 | Ga0436364_0260207 | Ga0436364_0260207_4130_5008 | 288 |
| 413 | 3300039437 | Ga0436365_0442366 | Ga0436365_0442366_1864_2805 | 288 |
| 414 | 3300042008 | Ga0439450_008666 | Ga0439450_008666_222_1097 | 288 |
| 415 | 3300044683 | Ga0466965_0110229 | Ga0466965_0110229_129_1004 | 288 |
| 416 | 3300048907 | Ga0496104_0006133 | Ga0496104_0006133_7531_8496 | 288 |
| 417 | 3300048908 | Ga0496105_0102142 | Ga0496105_0102142_837_1802 | 288 |
| 418 | 3300048912 | Ga0496109_0500272 | Ga0496109_0500272_28_993 | 288 |
| 419 | 3300048915 | Ga0496112_0191124 | Ga0496112_0191124_589_1554 | 288 |
| 420 | 3300049571 | Ga0501034_0064304 | Ga0501034_0064304_1940_2848 | 288 |
| 421 | 3300005339 | Ga0070660_100067557 | Ga0070660_1000675573 | 289 |
| 422 | 3300009093 | Ga0105240_10023970 | Ga0105240_100239704 | 289 |
| 423 | 3300011119 | Ga0105246_10099445 | Ga0105246_100994453 | 289 |
| 424 | 3300013307 | Ga0157372_10492262 | Ga0157372_104922622 | 289 |
| 425 | 3300025919 | Ga0207657_10037457 | Ga0207657_100374574 | 289 |
| 426 | 3300045836 | Ga0466958_0237130 | Ga0466958_0237130_101_1021 | 289 |
| 427 | 3300049586 | Ga0501070_0165021 | Ga0501070_0165021_30_989 | 289 |
| 428 | 3300049587 | Ga0501071_0013001 | Ga0501071_0013001_3148_4107 | 289 |
| 429 | 3300049592 | Ga0501076_0288312 | Ga0501076_0288312_92_1051 | 289 |
| 430 | 3300060353 | Ga0501082_0027429 | Ga0501082_0027429_1783_2742 | 289 |
| 431 | 3300061734 | Ga0530510_0033367 | Ga0530510_0033367_2041_3000 | 289 |
| 432 | 3300005436 | Ga0070713_100103620 | Ga0070713_1001036202 | 290 |
| 433 | 3300005437 | Ga0070710_10006857 | Ga0070710_100068574 | 290 |
| 434 | 3300005985 | Ga0081539_10025587 | Ga0081539_100255871 | 290 |
| 435 | 3300006028 | Ga0070717_10125024 | Ga0070717_101250242 | 290 |
| 436 | 3300025915 | Ga0207693_10094501 | Ga0207693_100945012 | 290 |
| 437 | 3300025928 | Ga0207700_10040961 | Ga0207700_100409612 | 290 |
| 438 | 3300031901 | Ga0307406_10212811 | Ga0307406_102128112 | 290 |
| 439 | 3300035119 | Ga0373956_0058640 | Ga0373956_0058640_117_998 | 290 |
| 440 | 3300036401 | Ga0373937_0057955 | Ga0373937_0057955_1612_2493 | 290 |
| 441 | 3300037466 | Ga0395898_0328792 | Ga0395898_0328792_347_1234 | 290 |
| 442 | 3300037853 | Ga0436364_0747883 | Ga0436364_0747883_5522_6403 | 290 |
| 443 | 3300038443 | Ga0395901_0031082 | Ga0395901_0031082_948_1847 | 290 |
| 444 | 3300039437 | Ga0436365_1768242 | Ga0436365_1768242_546_1427 | 290 |
| 445 | 3300044693 | Ga0466961_0035351 | Ga0466961_0035351_361_1308 | 290 |
| 446 | 3300044765 | Ga0466970_0044600 | Ga0466970_0044600_1322_2251 | 290 |
| 447 | 3300044901 | Ga0466960_0000237 | Ga0466960_0000237_4866_5768 | 290 |
| 448 | 3300045049 | Ga0466959_0015322 | Ga0466959_0015322_1253_2200 | 290 |
| 449 | 3300045976 | Ga0466967_0032594 | Ga0466967_0032594_1614_2510 | 290 |
| 450 | 3300046454 | Ga0495592_0059336 | Ga0495592_0059336_658_1539 | 290 |
| 451 | 3300046459 | Ga0495629_0108122 | Ga0495629_0108122_97_978 | 290 |
| 452 | 3300046462 | Ga0495651_0050468 | Ga0495651_0050468_1222_2103 | 290 |
| 453 | 3300046463 | Ga0495653_0025801 | Ga0495653_0025801_1875_2756 | 290 |
| 454 | 3300046471 | Ga0495650_0000055 | Ga0495650_0000055_104235_105143 | 290 |
| 455 | 3300046511 | Ga0495608_0005880 | Ga0495608_0005880_1063_1944 | 290 |
| 456 | 3300046514 | Ga0495618_0019416 | Ga0495618_0019416_2842_3723 | 290 |
| 457 | 3300046516 | Ga0495628_0029687 | Ga0495628_0029687_1353_2234 | 290 |
| 458 | 3300046517 | Ga0495630_0083663 | Ga0495630_0083663_503_1384 | 290 |
| 459 | 3300046533 | Ga0495640_0061625 | Ga0495640_0061625_849_1730 | 290 |
| 460 | 3300046536 | Ga0495587_0047062 | Ga0495587_0047062_861_1742 | 290 |
| 461 | 3300046559 | Ga0495667_0015912 | Ga0495667_0015912_3642_4523 | 290 |
| 462 | 3300046642 | Ga0495634_0047775 | Ga0495634_0047775_502_1383 | 290 |
| 463 | 3300046663 | Ga0495635_0017163 | Ga0495635_0017163_128_1009 | 290 |
| 464 | 3300046675 | Ga0495657_0008803 | Ga0495657_0008803_764_1645 | 290 |
| 465 | 3300046679 | Ga0495623_0044627 | Ga0495623_0044627_877_1758 | 290 |
| 466 | 3300046680 | Ga0495646_0007330 | Ga0495646_0007330_4331_5212 | 290 |
| 467 | 3300046809 | Ga0495600_0002882 | Ga0495600_0002882_3525_4406 | 290 |
| 468 | 3300047317 | Ga0495604_0008977 | Ga0495604_0008977_4660_5541 | 290 |
| 469 | 3300047319 | Ga0495674_0024765 | Ga0495674_0024765_1001_1882 | 290 |
| 470 | 3300047322 | Ga0495680_0006646 | Ga0495680_0006646_3067_3948 | 290 |
| 471 | 3300047673 | Ga0495593_0025346 | Ga0495593_0025346_1612_2493 | 290 |
| 472 | 3300048088 | Ga0495602_0011820 | Ga0495602_0011820_3647_4528 | 290 |
| 473 | 3300048903 | Ga0496100_0192128 | Ga0496100_0192128_109_1098 | 290 |
| 474 | 3300048907 | Ga0496104_0062923 | Ga0496104_0062923_1265_2146 | 290 |
| 475 | 3300048908 | Ga0496105_0305440 | Ga0496105_0305440_132_1013 | 290 |
| 476 | 3300048912 | Ga0496109_0616855 | Ga0496109_0616855_77_958 | 290 |
| 477 | 3300048913 | Ga0496110_0056662 | Ga0496110_0056662_1110_1991 | 290 |
| 478 | 3300048913 | Ga0496110_0505657 | Ga0496110_0505657_54_935 | 290 |
| 479 | 3300048914 | Ga0496111_0041907 | Ga0496111_0041907_761_1642 | 290 |
| 480 | 3300048914 | Ga0496111_0067181 | Ga0496111_0067181_1393_2382 | 290 |
| 481 | 3300048915 | Ga0496112_0029098 | Ga0496112_0029098_3434_4315 | 290 |
| 482 | 3300048915 | Ga0496112_0127213 | Ga0496112_0127213_1366_2247 | 290 |
| 483 | 3300048915 | Ga0496112_0281279 | Ga0496112_0281279_408_1289 | 290 |
| 484 | 3300048915 | Ga0496112_0316249 | Ga0496112_0316249_350_1339 | 290 |
| 485 | 3300048916 | Ga0496113_0043152 | Ga0496113_0043152_1709_2698 | 290 |
| 486 | 3300048916 | Ga0496113_0134710 | Ga0496113_0134710_287_1168 | 290 |
| 487 | 3300048916 | Ga0496113_0400016 | Ga0496113_0400016_133_1014 | 290 |
| 488 | 3300048918 | Ga0496115_0404011 | Ga0496115_0404011_129_1010 | 290 |
| 489 | 3300048924 | Ga0496121_0028323 | Ga0496121_0028323_410_1321 | 290 |
| 490 | 3300053077 | Ga0495601_0283457 | Ga0495601_0283457_16_897 | 290 |
| 491 | 3300053084 | Ga0495595_0009349 | Ga0495595_0009349_1234_2115 | 290 |
| 492 | 3300053085 | Ga0495619_0035656 | Ga0495619_0035656_1629_2510 | 290 |
| 493 | 3300053153 | Ga0500616_0045578 | Ga0500616_0045578_1072_1953 | 290 |
| 494 | 3300005337 | Ga0070682_100198461 | Ga0070682_1001984611 | 291 |
| 495 | 3300005340 | Ga0070689_100101309 | Ga0070689_1001013092 | 291 |
| 496 | 3300005343 | Ga0070687_100147067 | Ga0070687_1001470671 | 291 |
| 497 | 3300005347 | Ga0070668_100080532 | Ga0070668_1000805322 | 291 |
| 498 | 3300005366 | Ga0070659_100148450 | Ga0070659_1001484502 | 291 |
| 499 | 3300005466 | Ga0070685_10089946 | Ga0070685_100899462 | 291 |
| 500 | 3300005549 | Ga0070704_100098335 | Ga0070704_1000983352 | 291 |
| 501 | 3300005615 | Ga0070702_100023262 | Ga0070702_1000232622 | 291 |
| 502 | 3300005616 | Ga0068852_100024037 | Ga0068852_1000240373 | 291 |
| 503 | 3300005616 | Ga0068852_100078703 | Ga0068852_1000787032 | 291 |
| 504 | 3300005617 | Ga0068859_100040708 | Ga0068859_1000407084 | 291 |
| 505 | 3300005618 | Ga0068864_100140064 | Ga0068864_1001400642 | 291 |
| 506 | 3300005718 | Ga0068866_10026269 | Ga0068866_100262693 | 291 |
| 507 | 3300005719 | Ga0068861_100204786 | Ga0068861_1002047862 | 291 |
| 508 | 3300005983 | Ga0081540_1001012 | Ga0081540_10010123 | 291 |
| 509 | 3300006931 | Ga0097620_100040703 | Ga0097620_1000407034 | 291 |
| 510 | 3300009098 | Ga0105245_10505995 | Ga0105245_105059951 | 291 |
| 511 | 3300009101 | Ga0105247_10038643 | Ga0105247_100386434 | 291 |
| 512 | 3300009174 | Ga0105241_10234947 | Ga0105241_102349472 | 291 |
| 513 | 3300009176 | Ga0105242_10257745 | Ga0105242_102577452 | 291 |
| 514 | 3300009553 | Ga0105249_10038105 | Ga0105249_100381053 | 291 |
| 515 | 3300009553 | Ga0105249_10197019 | Ga0105249_101970192 | 291 |
| 516 | 3300010375 | Ga0105239_10256483 | Ga0105239_102564832 | 291 |
| 517 | 3300013102 | Ga0157371_10205104 | Ga0157371_102051042 | 291 |
| 518 | 3300014969 | Ga0157376_10153050 | Ga0157376_101530502 | 291 |
| 519 | 3300017792 | Ga0163161_10079222 | Ga0163161_100792223 | 291 |
| 520 | 3300025901 | Ga0207688_10012664 | Ga0207688_100126642 | 291 |
| 521 | 3300025904 | Ga0207647_10047416 | Ga0207647_100474162 | 291 |
| 522 | 3300025916 | Ga0207663_10068536 | Ga0207663_100685362 | 291 |
| 523 | 3300025918 | Ga0207662_10095976 | Ga0207662_100959762 | 291 |
| 524 | 3300025919 | Ga0207657_10060673 | Ga0207657_100606732 | 291 |
| 525 | 3300025923 | Ga0207681_10099308 | Ga0207681_100993082 | 291 |
| 526 | 3300025926 | Ga0207659_10105141 | Ga0207659_101051412 | 291 |
| 527 | 3300025927 | Ga0207687_10016161 | Ga0207687_100161612 | 291 |
| 528 | 3300025927 | Ga0207687_10095108 | Ga0207687_100951082 | 291 |
| 529 | 3300025931 | Ga0207644_10133857 | Ga0207644_101338572 | 291 |
| 530 | 3300025932 | Ga0207690_10055122 | Ga0207690_100551222 | 291 |
| 531 | 3300025934 | Ga0207686_10241878 | Ga0207686_102418782 | 291 |
| 532 | 3300025942 | Ga0207689_10033898 | Ga0207689_100338982 | 291 |
| 533 | 3300025961 | Ga0207712_10048302 | Ga0207712_100483023 | 291 |
| 534 | 3300025981 | Ga0207640_10161605 | Ga0207640_101616052 | 291 |
| 535 | 3300025986 | Ga0207658_10142489 | Ga0207658_101424892 | 291 |
| 536 | 3300026089 | Ga0207648_10270112 | Ga0207648_102701122 | 291 |
| 537 | 3300026116 | Ga0207674_10036967 | Ga0207674_100369674 | 291 |
| 538 | 3300026118 | Ga0207675_100057571 | Ga0207675_1000575712 | 291 |
| 539 | 3300026118 | Ga0207675_100223791 | Ga0207675_1002237912 | 291 |
| 540 | 3300026121 | Ga0207683_10062078 | Ga0207683_100620783 | 291 |
| 541 | 3300026142 | Ga0207698_10043212 | Ga0207698_100432122 | 291 |
| 542 | 3300026142 | Ga0207698_10056150 | Ga0207698_100561503 | 291 |
| 543 | 3300028381 | Ga0268264_10160690 | Ga0268264_101606902 | 291 |
| 544 | 3300039437 | Ga0436365_1933925 | Ga0436365_1933925_673_1575 | 291 |
| 545 | 3300039450 | Ga0436363_1082191 | Ga0436363_1082191_12430_13332 | 291 |
| 546 | 3300045049 | Ga0466959_0342222 | Ga0466959_0342222_42_1007 | 291 |
| 547 | 3300046461 | Ga0495641_0063347 | Ga0495641_0063347_613_1536 | 291 |
| 548 | 3300048904 | Ga0496101_0249731 | Ga0496101_0249731_153_1031 | 291 |
| 549 | 3300048904 | Ga0496101_0337790 | Ga0496101_0337790_259_1170 | 291 |
| 550 | 3300048905 | Ga0496102_0042064 | Ga0496102_0042064_655_1566 | 291 |
| 551 | 3300048906 | Ga0496103_0206906 | Ga0496103_0206906_236_1126 | 291 |
| 552 | 3300048907 | Ga0496104_0008487 | Ga0496104_0008487_7621_8544 | 291 |
| 553 | 3300048907 | Ga0496104_0100929 | Ga0496104_0100929_39_1025 | 291 |
| 554 | 3300048907 | Ga0496104_0572899 | Ga0496104_0572899_119_997 | 291 |
| 555 | 3300048908 | Ga0496105_0054631 | Ga0496105_0054631_475_1398 | 291 |
| 556 | 3300048908 | Ga0496105_0178117 | Ga0496105_0178117_62_973 | 291 |
| 557 | 3300048909 | Ga0496106_0014586 | Ga0496106_0014586_2429_3352 | 291 |
| 558 | 3300048909 | Ga0496106_0035052 | Ga0496106_0035052_2003_2893 | 291 |
| 559 | 3300048910 | Ga0496107_0004823 | Ga0496107_0004823_3591_4481 | 291 |
| 560 | 3300048910 | Ga0496107_0090571 | Ga0496107_0090571_1231_2142 | 291 |
| 561 | 3300048911 | Ga0496108_0002444 | Ga0496108_0002444_9547_10470 | 291 |
| 562 | 3300048912 | Ga0496109_0041794 | Ga0496109_0041794_3112_4035 | 291 |
| 563 | 3300048912 | Ga0496109_0049207 | Ga0496109_0049207_2440_3351 | 291 |
| 564 | 3300048913 | Ga0496110_0000362 | Ga0496110_0000362_25385_26308 | 291 |
| 565 | 3300048913 | Ga0496110_0056299 | Ga0496110_0056299_476_1354 | 291 |
| 566 | 3300048913 | Ga0496110_0162609 | Ga0496110_0162609_269_1225 | 291 |
| 567 | 3300048914 | Ga0496111_0006736 | Ga0496111_0006736_4488_5411 | 291 |
| 568 | 3300048914 | Ga0496111_0083693 | Ga0496111_0083693_153_1064 | 291 |
| 569 | 3300048914 | Ga0496111_0091325 | Ga0496111_0091325_163_1041 | 291 |
| 570 | 3300048915 | Ga0496112_0032894 | Ga0496112_0032894_472_1395 | 291 |
| 571 | 3300048916 | Ga0496113_0008875 | Ga0496113_0008875_2909_3832 | 291 |
| 572 | 3300048917 | Ga0496114_0047621 | Ga0496114_0047621_141_1019 | 291 |
| 573 | 3300048917 | Ga0496114_0102606 | Ga0496114_0102606_300_1190 | 291 |
| 574 | 3300048918 | Ga0496115_0058979 | Ga0496115_0058979_394_1284 | 291 |
| 575 | 3300048918 | Ga0496115_0080302 | Ga0496115_0080302_205_1116 | 291 |
| 576 | 3300048918 | Ga0496115_0350726 | Ga0496115_0350726_128_1006 | 291 |
| 577 | 3300050511 | nmdc:mga08y16_171869_c1 | nmdc:mga08y16_171869_c1_1083_1994 | 291 |
| 578 | 3300050515 | nmdc:mga0a205_62431_c1 | nmdc:mga0a205_62431_c1_705_1616 | 291 |
| 579 | 3300003203 | JGI25406J46586_10058365 | JGI25406J46586_100583651 | 292 |
| 580 | 3300005548 | Ga0070665_100002263 | Ga0070665_10000226311 | 292 |
| 581 | 3300005985 | Ga0081539_10008321 | Ga0081539_100083213 | 292 |
| 582 | 3300028379 | Ga0268266_10008844 | Ga0268266_100088448 | 292 |
| 583 | 3300037853 | Ga0436364_1026511 | Ga0436364_1026511_3342_4298 | 292 |
| 584 | 3300037853 | Ga0436364_1425865 | Ga0436364_1425865_566_1483 | 292 |
| 585 | 3300044842 | Ga0466957_0066468 | Ga0466957_0066468_254_1204 | 292 |
| 586 | 3300045836 | Ga0466958_0015000 | Ga0466958_0015000_2272_3222 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9252 | 6 | 218 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.917 | 5 | 218 |
| 6xgz-assembly3.cif.gz_E | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.908 | 2 | 218 |
| 6xgz-assembly2.cif.gz_C | crystal structure of e. coli mlafb abc transport subunits in the monomeric state | 0.9068 | 2 | 217 |
| 7d06-assembly1.cif.gz_B | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.9051 | 5 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9474 | 1 | 218 | 3.40.50.300 |
| af_Q555Z5_479_734_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9368 | 2 | 215 | 3.40.50.300 |
| af_Q4DWA3_1535_1779_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9351 | 5 | 218 | 3.40.50.300 |
| af_E9PWJ7_506_745_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9321 | 4 | 217 | 3.40.50.300 |
| af_Q0E8Q7_1247_1483_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9314 | 5 | 215 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5DMZ3-F1-model_v4 | ABC transporter | 0.9674 | 1 | 200 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A7V9B0A6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9641 | 86 | 218 |
GO:0005524
GO:0016887 |
| AF-A0A3D5DMZ3-F1-model_v4 | ABC transporter | 0.9534 | 1 | 200 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A6I6A3C4-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9521 | 1 | 218 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A1I2M2I1-F1-model_v4 | ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein | 0.9519 | 4 | 218 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar