F466493

General Info

Members Datasets Scaffolds Average Seq Length
585 302 585 186

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000604|Ga0496104_0000604_2428_3090
Length 220
Sequence LRREGQSGLFIAAPEDYLLFIPSPALNRMISEACMFIQTESTPNPATLKFLPGGPVLENGSRDMPSVEDAKVSPLASALFTIEGVSGVFLGPDFISVTKSSGEWQHLKPAILGTIMEHFMSGGPILSPDAAEPDARHQEFFAPEHAETVVAIKELLENQVRPAVASDGGDIVFRGFKDGVVYLHMKGACSGCPSSTATLKRGIQNLLCHFLPDVKSVEQV

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
82 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 2.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 7.18
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10033212 3300002244 Bacteria 906
2 Ga0058860_12142977 3300004801 Bacteria 709
3 Ga0070683_100092767 3300005329 Bacteria 2836
4 Ga0070690_100099288 3300005330 Bacteria 1928
5 Ga0070670_100071032 3300005331 Bacteria 2989
6 Ga0070666_10423636 3300005335 Bacteria 959
7 Ga0070680_100027016 3300005336 Bacteria 4595
8 Ga0070680_100196424 3300005336 Bacteria 1701
9 Ga0070680_101118606 3300005336 Bacteria 681
10 Ga0070682_100059360 3300005337 Bacteria 2416
11 Ga0068868_100419097 3300005338 Bacteria 1159
12 Ga0068868_100465471 3300005338 Bacteria 1102
13 Ga0068868_100684949 3300005338 Bacteria 916
14 Ga0070691_10069787 3300005341 Bacteria 1704
15 Ga0070692_10188542 3300005345 Bacteria 1200
16 Ga0070668_100009939 3300005347 Bacteria 7048
17 Ga0070669_100429563 3300005353 Bacteria 1085
18 Ga0070671_100489895 3300005355 Bacteria 1057
19 Ga0070688_100212269 3300005365 Bacteria 1360
20 Ga0070659_100221370 3300005366 Bacteria 1562
21 Ga0070659_100294522 3300005366 Bacteria 1352
22 Ga0070667_100025204 3300005367 Bacteria 4943
23 Ga0070667_100421644 3300005367 Bacteria 1216
24 Ga0070703_10003324 3300005406 Bacteria 4587
25 Ga0070703_10029443 3300005406 Bacteria 1648
26 Ga0070709_10034824 3300005434 Bacteria 3056
27 Ga0070709_10127644 3300005434 Bacteria 1732
28 Ga0070714_100012825 3300005435 Bacteria 6698
29 Ga0070701_10021326 3300005438 Bacteria 3089
30 Ga0070705_100000427 3300005440 Bacteria 24212
31 Ga0070700_100002813 3300005441 Bacteria 8923
32 Ga0070700_100278443 3300005441 Bacteria 1212
33 Ga0070700_100543961 3300005441 Bacteria 901
34 Ga0070694_100017214 3300005444 Bacteria 4564
35 Ga0070694_100026501 3300005444 Bacteria 3757
36 Ga0070708_100128672 3300005445 Bacteria 2342
37 Ga0070663_100054771 3300005455 Bacteria 2852
38 Ga0070678_100083070 3300005456 Bacteria 2434
39 Ga0070681_10020054 3300005458 Bacteria 6698
40 Ga0068867_100388729 3300005459 Bacteria 1174
41 Ga0068867_100831630 3300005459 Bacteria 826
42 Ga0068867_101041423 3300005459 Bacteria 744
43 Ga0070699_100059429 3300005518 Bacteria 3311
44 Ga0070679_100063548 3300005530 Bacteria 3679
45 Ga0070684_100260037 3300005535 Bacteria 1588
46 Ga0070684_101102611 3300005535 Bacteria 746
47 Ga0070697_100170871 3300005536 Bacteria 1840
48 Ga0068853_100340218 3300005539 Bacteria 1394
49 Ga0070695_100004704 3300005545 Bacteria 8031
50 Ga0070695_100185385 3300005545 Bacteria 1477
51 Ga0070696_100029690 3300005546 Bacteria 3740
52 Ga0070693_100004150 3300005547 Bacteria 6830
53 Ga0070704_100025023 3300005549 Bacteria 3925
54 Ga0070704_100032866 3300005549 Bacteria 3503
55 Ga0070704_100373503 3300005549 Bacteria 1209
56 Ga0068855_100116551 3300005563 Bacteria 3061
57 Ga0070664_101183177 3300005564 Bacteria 721
58 Ga0068857_100049678 3300005577 Bacteria 3721
59 Ga0068857_100075950 3300005577 Bacteria 2995
60 Ga0068854_100035896 3300005578 Bacteria 3473
61 Ga0068859_100001914 3300005617 Bacteria 21237
62 Ga0068859_100088096 3300005617 Bacteria 3153
63 Ga0068859_101271702 3300005617 Bacteria 811
64 Ga0068864_100031959 3300005618 Bacteria 4469
65 Ga0068864_100122993 3300005618 Bacteria 2322
66 Ga0068861_100207844 3300005719 Bacteria 1647
67 Ga0068861_100295139 3300005719 Bacteria 1401
68 Ga0068861_100300315 3300005719 Bacteria 1390
69 Ga0068861_100356974 3300005719 Bacteria 1284
70 Ga0068863_100041278 3300005841 Bacteria 4386
71 Ga0068863_100656824 3300005841 Bacteria 1040
72 Ga0068858_100492058 3300005842 Bacteria 1184
73 Ga0068858_100641361 3300005842 Bacteria 1032
74 Ga0068860_100046332 3300005843 Bacteria 4146
75 Ga0068860_100055488 3300005843 Bacteria 3767
76 Ga0068862_100047782 3300005844 Bacteria 3653
77 Ga0068862_100263674 3300005844 Bacteria 1574
78 Ga0081455_10001595 3300005937 Bacteria 27705
79 Ga0081540_1002918 3300005983 Bacteria 13763
80 Ga0081539_10087706 3300005985 Bacteria 1616
81 Ga0075365_10404486 3300006038 Bacteria 963
82 Ga0075365_10432964 3300006038 Bacteria 929
83 Ga0075363_100020834 3300006048 Bacteria 3293
84 Ga0070715_10114509 3300006163 Bacteria 1277
85 Ga0070712_100677485 3300006175 Bacteria 878
86 Ga0075370_10052509 3300006353 Bacteria 2313
87 Ga0075428_100260089 3300006844 Bacteria 1869
88 Ga0075428_100268461 3300006844 Bacteria 1836
89 Ga0075430_100040569 3300006846 Bacteria 3940
90 Ga0075431_100031680 3300006847 Bacteria 5446
91 Ga0075433_10000150 3300006852 Bacteria 37277
92 Ga0075433_10192144 3300006852 Bacteria 1816
93 Ga0075434_100002118 3300006871 Bacteria 17265
94 Ga0075434_100035347 3300006871 Bacteria 4940
95 Ga0068865_100120057 3300006881 Bacteria 1953
96 Ga0097620_100001914 3300006931 Bacteria 21237
97 Ga0097620_100088091 3300006931 Bacteria 3153
98 Ga0097620_101271635 3300006931 Bacteria 811
99 Ga0075435_100022930 3300007076 Bacteria 4819
100 Ga0099794_10025198 3300007265 Bacteria 2737
101 Ga0099795_10041163 3300007788 Bacteria 1644
102 Ga0105250_10134442 3300009092 Bacteria 1022
103 Ga0105240_10117882 3300009093 Bacteria 3200
104 Ga0111539_10003908 3300009094 Bacteria 19597
105 Ga0111539_10033514 3300009094 Bacteria 6236
106 Ga0111539_10058388 3300009094 Bacteria 4577
107 Ga0111539_10279852 3300009094 Bacteria 1941
108 Ga0105245_10057667 3300009098 Bacteria 3493
109 Ga0105245_10596627 3300009098 Bacteria 1130
110 Ga0105247_10008332 3300009101 Bacteria 6323
111 Ga0114129_10057811 3300009147 Bacteria 5426
112 Ga0114129_10414064 3300009147 Bacteria 1774
113 Ga0114129_11210630 3300009147 Bacteria 940
114 Ga0105243_10059012 3300009148 Bacteria 3060
115 Ga0105243_10080683 3300009148 Bacteria 2654
116 Ga0105242_11234092 3300009176 Bacteria 768
117 Ga0105248_10180829 3300009177 Bacteria 2376
118 Ga0105248_10482465 3300009177 Bacteria 1397
119 Ga0105249_10006173 3300009553 Bacteria 10397
120 Ga0105249_10835081 3300009553 Bacteria 986
121 Ga0099796_10102444 3300010159 Bacteria 1079
122 Ga0105239_10012676 3300010375 Bacteria 9380
123 Ga0105239_10312975 3300010375 Bacteria 1770
124 Ga0105246_10307679 3300011119 Bacteria 1282
125 Ga0105246_10361220 3300011119 Bacteria 1193
126 Ga0105246_10455011 3300011119 Bacteria 1077
127 Ga0105246_10680369 3300011119 Bacteria 899
128 Ga0157341_1006900 3300012494 Bacteria 890
129 Ga0157342_1005900 3300012507 Bacteria 1141
130 Ga0157370_10313437 3300013104 Bacteria 1447
131 Ga0157374_10740647 3300013296 Eukaryota 997
132 Ga0163162_10115057 3300013306 Bacteria 2789
133 Ga0157372_10017628 3300013307 Eukaryota 7664
134 Ga0157372_11095122 3300013307 Bacteria 922
135 Ga0157375_10027698 3300013308 Bacteria 5301
136 Ga0157375_10264513 3300013308 Bacteria 1881
137 Ga0163163_10048919 3300014325 Bacteria 4160
138 Ga0157380_10007714 3300014326 Bacteria 7657
139 Ga0157380_10203842 3300014326 Bacteria 1757
140 Ga0182008_10131340 3300014497 Bacteria 1248
141 Ga0157379_10119206 3300014968 Bacteria 2374
142 Ga0157379_10667469 3300014968 Bacteria 974
143 Ga0157376_10357844 3300014969 Bacteria 1399
144 Ga0163161_10295416 3300017792 Bacteria 1275
145 Ga0163161_10435914 3300017792 Bacteria 1057
146 Ga0206356_11534066 3300020070 Bacteria 1114
147 Ga0206355_1452686 3300020076 Bacteria 884
148 Ga0206352_11101380 3300020078 Bacteria 1230
149 Ga0206353_11194519 3300020082 Bacteria 1587
150 Ga0206353_11592444 3300020082 Bacteria 748
151 Ga0224712_10240290 3300022467 Bacteria 834
152 Ga0207653_10000631 3300025885 Bacteria 12123
153 Ga0207692_10377362 3300025898 Bacteria 879
154 Ga0207642_10326661 3300025899 Bacteria 897
155 Ga0207710_10079885 3300025900 Bacteria 1515
156 Ga0207699_10123355 3300025906 Bacteria 1679
157 Ga0207645_10285035 3300025907 Bacteria 1097
158 Ga0207645_10622737 3300025907 Bacteria 733
159 Ga0207707_10141612 3300025912 Bacteria 2102
160 Ga0207695_10478271 3300025913 Bacteria 1128
161 Ga0207693_10004273 3300025915 Bacteria 12116
162 Ga0207693_10578233 3300025915 Bacteria 875
163 Ga0207660_10275089 3300025917 Bacteria 1335
164 Ga0207681_10055329 3300025923 Bacteria 2702
165 Ga0207681_10489942 3300025923 Bacteria 1005
166 Ga0207694_10599782 3300025924 Bacteria 926
167 Ga0207650_10046419 3300025925 Bacteria 3199
168 Ga0207664_10101638 3300025929 Bacteria 2376
169 Ga0207664_10130698 3300025929 Bacteria 2113
170 Ga0207644_10250096 3300025931 Bacteria 1414
171 Ga0207690_10386696 3300025932 Bacteria 1113
172 Ga0207709_10221030 3300025935 Bacteria 1366
173 Ga0207709_10315818 3300025935 Bacteria 1167
174 Ga0207709_10855492 3300025935 Bacteria 737
175 Ga0207669_10107533 3300025937 Bacteria 1861
176 Ga0207704_10322339 3300025938 Bacteria 1192
177 Ga0207665_10052047 3300025939 Bacteria 2758
178 Ga0207691_10008893 3300025940 Bacteria 9642
179 Ga0207711_10347328 3300025941 Bacteria 1373
180 Ga0207711_10899970 3300025941 Bacteria 823
181 Ga0207689_10133770 3300025942 Bacteria 2041
182 Ga0207661_10215818 3300025944 Bacteria 1693
183 Ga0207712_10002132 3300025961 Bacteria 12932
184 Ga0207712_10359262 3300025961 Bacteria 1213
185 Ga0207668_10004553 3300025972 Bacteria 8156
186 Ga0207668_10028368 3300025972 Bacteria 3660
187 Ga0207668_10351450 3300025972 Bacteria 1233
188 Ga0207640_10298176 3300025981 Bacteria 1274
189 Ga0207658_10493671 3300025986 Bacteria 1089
190 Ga0207677_10392464 3300026023 Bacteria 1175
191 Ga0207677_10765587 3300026023 Bacteria 862
192 Ga0207703_10272229 3300026035 Bacteria 1534
193 Ga0207703_10828746 3300026035 Bacteria 884
194 Ga0207639_10250301 3300026041 Bacteria 1545
195 Ga0207678_10031190 3300026067 Bacteria 4650
196 Ga0207708_10007125 3300026075 Bacteria 8263
197 Ga0207708_10081805 3300026075 Bacteria 2482
198 Ga0207708_10251638 3300026075 Bacteria 1424
199 Ga0207708_10349141 3300026075 Bacteria 1213
200 Ga0207708_11025579 3300026075 Bacteria 717
201 Ga0207702_10039530 3300026078 Bacteria 3953
202 Ga0207641_10096129 3300026088 Bacteria 2601
203 Ga0207641_10170614 3300026088 Bacteria 1985
204 Ga0207648_10165779 3300026089 Bacteria 1952
205 Ga0207648_10186433 3300026089 Bacteria 1838
206 Ga0207676_10059277 3300026095 Bacteria 3022
207 Ga0207674_10093506 3300026116 Bacteria 2995
208 Ga0207674_10446173 3300026116 Bacteria 1250
209 Ga0207675_100027412 3300026118 Bacteria 5306
210 Ga0207675_100099440 3300026118 Bacteria 2740
211 Ga0207675_100151694 3300026118 Bacteria 2206
212 Ga0207675_100223009 3300026118 Bacteria 1817
213 Ga0207675_100266573 3300026118 Bacteria 1661
214 Ga0207675_101544140 3300026118 Bacteria 684
215 Ga0207683_11484418 3300026121 Bacteria 626
216 Ga0207698_10063130 3300026142 Bacteria 2897
217 Ga0209179_1043289 3300027512 Bacteria 952
218 Ga0209588_1037538 3300027671 Bacteria 1559
219 Ga0209974_10022748 3300027876 Bacteria 2076
220 Ga0207428_10056772 3300027907 Bacteria 3110
221 Ga0207428_10307965 3300027907 Bacteria 1171
222 Ga0268266_10785094 3300028379 Bacteria 920
223 Ga0268265_10007612 3300028380 Bacteria 7306
224 Ga0268265_10281366 3300028380 Bacteria 1488
225 Ga0268264_10018306 3300028381 Bacteria 5728
226 Ga0268264_10066519 3300028381 Bacteria 3039
227 Ga0268264_10317754 3300028381 Bacteria 1471
228 Ga0307515_10527144 3300028794 Bacteria 791
229 Ga0265331_10007887 3300031250 Bacteria 6104
230 Ga0307408_100781470 3300031548 Bacteria 865
231 Ga0316575_10104976 3300031665 Bacteria 1150
232 Ga0316575_10177277 3300031665 Bacteria 884
233 Ga0316579_10038651 3300031691 Bacteria 2207
234 Ga0265314_10082530 3300031711 Bacteria 2114
235 Ga0316576_10256736 3300031727 Bacteria 1311
236 Ga0316576_10308249 3300031727 Bacteria 1182
237 Ga0307405_10664587 3300031731 Bacteria 859
238 Ga0316577_10313979 3300031733 Bacteria 888
239 Ga0307410_11015312 3300031852 Bacteria 716
240 Ga0307406_10922324 3300031901 Bacteria 745
241 Ga0307407_10077389 3300031903 Bacteria 2001
242 Ga0307409_100191294 3300031995 Bacteria 1822
243 Ga0307411_10765261 3300032005 Bacteria 847
244 Ga0307411_11126675 3300032005 Bacteria 708
245 Ga0316583_10002462 3300032133 Bacteria 6429
246 Ga0316585_10032885 3300032137 Bacteria 1634
247 Ga0316588_1105129 3300033528 Bacteria 708
248 Ga0316587_1009123 3300033529 Bacteria 1570
249 Ga0373959_0041208 3300034820 Bacteria 969
250 Ga0373938_0021927 3300034957 Bacteria 1300
251 Ga0373928_0020631 3300035084 Bacteria 1383
252 Ga0373949_0021681 3300035090 Bacteria 1476
253 Ga0373932_0017521 3300035112 Bacteria 1840
254 Ga0373939_0005250 3300035114 Bacteria 3080
255 Ga0373939_0009445 3300035114 Bacteria 2418
256 Ga0373941_0016896 3300035115 Bacteria 1991
257 Ga0373941_0167521 3300035115 Bacteria 817
258 Ga0373960_0087699 3300035121 Bacteria 990
259 Ga0373960_0110611 3300035121 Bacteria 901
260 Ga0373943_0063196 3300035170 Bacteria 1855
261 Ga0373942_0016883 3300035207 Bacteria 1795
262 Ga0373962_0013944 3300035242 Bacteria 2042
263 Ga0373962_0020488 3300035242 Bacteria 1737
264 Ga0316574_0253326 3300035398 Bacteria 1124
265 Ga0373924_0171808 3300035410 Bacteria 953
266 Ga0373931_0000951 3300035691 Bacteria 12183
267 Ga0373931_0014099 3300035691 Bacteria 3902
268 Ga0373931_0038925 3300035691 Bacteria 2490
269 Ga0373931_0227711 3300035691 Bacteria 1125
270 Ga0373935_0086886 3300035692 Bacteria 2041
271 Ga0373927_0016229 3300035695 Bacteria 4914
272 Ga0373927_0053183 3300035695 Bacteria 2619
273 Ga0373927_0382013 3300035695 Bacteria 929
274 Ga0373947_0000526 3300035725 Bacteria 22356
275 Ga0373937_0216682 3300036401 Bacteria 1802
276 Ga0316582_0233004 3300036647 Bacteria 1260
277 Ga0316582_0243369 3300036647 Bacteria 1232
278 Ga0316584_0622372 3300036712 Bacteria 746
279 Ga0373925_0017928 3300037068 Bacteria 5139
280 Ga0316581_0002304 3300037588 Bacteria 4532
281 Ga0436364_0574354 3300037853 Bacteria 3151
282 Ga0439456_092791 3300042013 Bacteria 680
283 Ga0439435_0025306 3300042436 Bacteria 1573
284 Ga0466967_0568650 3300045976 Bacteria 1117
285 Ga0495603_0001765 3300046455 Bacteria 12743
286 Ga0495629_0168672 3300046459 Bacteria 1520
287 Ga0495641_0025115 3300046461 Bacteria 2927
288 Ga0495651_0149179 3300046462 Bacteria 1688
289 Ga0495580_0007608 3300046472 Bacteria 8693
290 Ga0495580_0394589 3300046472 Bacteria 934
291 Ga0495582_0003623 3300046473 Bacteria 8698
292 Ga0495639_0001758 3300046475 Bacteria 9612
293 Ga0495664_0232673 3300046477 Bacteria 1115
294 Ga0495594_0000569 3300046499 Bacteria 18955
295 Ga0495608_0361500 3300046511 Bacteria 892
296 Ga0495618_0447886 3300046514 Bacteria 784
297 Ga0495630_0222723 3300046517 Bacteria 1440
298 Ga0495637_0117934 3300046520 Bacteria 1024
299 Ga0495666_0021187 3300046526 Bacteria 3218
300 Ga0495652_0118734 3300046529 Bacteria 2113
301 Ga0495640_0310595 3300046533 Bacteria 978
302 Ga0495640_0474783 3300046533 Bacteria 762
303 Ga0495609_0204208 3300046538 Bacteria 825
304 Ga0495667_0152501 3300046559 Bacteria 1487
305 Ga0495667_0192738 3300046559 Bacteria 1306
306 Ga0495668_0206745 3300046616 Bacteria 1075
307 Ga0495634_0017885 3300046642 Bacteria 5052
308 Ga0495625_0104593 3300046660 Bacteria 1941
309 Ga0495635_0037618 3300046663 Bacteria 3350
310 Ga0495659_0093706 3300046664 Bacteria 1156
311 Ga0495647_0007853 3300046681 Bacteria 3582
312 Ga0495658_0010713 3300046683 Bacteria 4590
313 Ga0495613_0014993 3300046689 Bacteria 5752
314 Ga0495624_0032941 3300046690 Bacteria 3358
315 Ga0495604_0219644 3300047317 Bacteria 1309
316 Ga0495636_0052293 3300047318 Bacteria 1713
317 Ga0495676_0037971 3300047321 Bacteria 4004
318 Ga0495680_0008364 3300047322 Bacteria 9409
319 Ga0495680_0149684 3300047322 Bacteria 1703
320 Ga0495675_0299491 3300047444 Bacteria 955
321 Ga0495675_0504691 3300047444 Bacteria 694
322 Ga0495602_0113278 3300048088 Bacteria 2199
323 Ga0495614_0006753 3300048089 Bacteria 5135
324 Ga0496100_0440359 3300048903 Bacteria 998
325 Ga0496100_0650307 3300048903 Bacteria 821
326 Ga0496101_0337197 3300048904 Bacteria 1184
327 Ga0496102_0037218 3300048905 Bacteria 4388
328 Ga0496102_0159345 3300048905 Bacteria 2122
329 Ga0496102_0227949 3300048905 Bacteria 1757
330 Ga0496102_0884741 3300048905 Bacteria 815
331 Ga0496102_1102462 3300048905 Bacteria 714
332 Ga0496102_1250597 3300048905 Bacteria 662
333 Ga0496103_0064387 3300048906 Bacteria 2285
334 Ga0496103_0198957 3300048906 Bacteria 1289
335 Ga0496104_0000604 3300048907 Bacteria 30841
336 Ga0496104_0049381 3300048907 Bacteria 3968
337 Ga0496104_0057638 3300048907 Bacteria 3675
338 Ga0496105_0000132 3300048908 Bacteria 50105
339 Ga0496105_0001618 3300048908 Bacteria 15993
340 Ga0496105_0036117 3300048908 Bacteria 4070
341 Ga0496105_0718580 3300048908 Bacteria 765
342 Ga0496106_0021711 3300048909 Bacteria 4767
343 Ga0496107_0119810 3300048910 Bacteria 1938
344 Ga0496107_0321122 3300048910 Bacteria 1152
345 Ga0496107_0582589 3300048910 Bacteria 828
346 Ga0496108_0266852 3300048911 Bacteria 1490
347 Ga0496108_0411241 3300048911 Bacteria 1182
348 Ga0496109_0328391 3300048912 Bacteria 1444
349 Ga0496109_0836687 3300048912 Bacteria 858
350 Ga0496109_1096035 3300048912 Bacteria 733
351 Ga0496110_0004787 3300048913 Bacteria 10541
352 Ga0496110_0021047 3300048913 Bacteria 5513
353 Ga0496110_0040100 3300048913 Bacteria 4081
354 Ga0496111_0019160 3300048914 Bacteria 4748
355 Ga0496111_0025412 3300048914 Bacteria 4179
356 Ga0496112_0004042 3300048915 Bacteria 12307
357 Ga0496112_0242141 3300048915 Bacteria 1756
358 Ga0496112_0501855 3300048915 Bacteria 1149
359 Ga0496113_0387829 3300048916 Bacteria 1121
360 Ga0496113_0909090 3300048916 Bacteria 696
361 Ga0496114_0084706 3300048917 Bacteria 2684
362 Ga0496114_0514263 3300048917 Bacteria 1059
363 Ga0496114_0514832 3300048917 Bacteria 1058
364 Ga0496115_0003665 3300048918 Bacteria 11054
365 Ga0496115_0759646 3300048918 Unclassified 757
366 Ga0496119_0005517 3300048922 Bacteria 12070
367 Ga0496125_0050432 3300048928 Bacteria 3446
368 Ga0496126_0670721 3300048929 Bacteria 809
369 Ga0501031_0015973 3300049568 Bacteria 4874
370 Ga0501031_0056236 3300049568 Bacteria 2563
371 Ga0501031_0147877 3300049568 Bacteria 1535
372 Ga0501031_0207761 3300049568 Bacteria 1276
373 Ga0501031_0542288 3300049568 Bacteria 749
374 Ga0501032_0074934 3300049569 Bacteria 2254
375 Ga0501032_0309942 3300049569 Bacteria 1020
376 Ga0501032_0314249 3300049569 Bacteria 1012
377 Ga0501032_0415028 3300049569 Bacteria 864
378 Ga0501032_0582371 3300049569 Bacteria 712
379 Ga0501032_0648435 3300049569 Bacteria 671
380 Ga0501033_0044731 3300049570 Bacteria 3295
381 Ga0501033_0131243 3300049570 Unclassified 1815
382 Ga0501034_0066171 3300049571 Bacteria 3627
383 Ga0501034_0114692 3300049571 Bacteria 2683
384 Ga0501034_0161885 3300049571 Bacteria 2208
385 Ga0501034_0178882 3300049571 Bacteria 2086
386 Ga0501034_0335640 3300049571 Bacteria 1442
387 Ga0501034_0364913 3300049571 Bacteria 1371
388 Ga0501034_0877219 3300049571 Bacteria 786
389 Ga0501036_0045297 3300049572 Bacteria 3727
390 Ga0501036_0047831 3300049572 Bacteria 3621
391 Ga0501036_0065677 3300049572 Bacteria 3070
392 Ga0501037_0048534 3300049573 Bacteria 3110
393 Ga0501037_0075360 3300049573 Bacteria 2450
394 Ga0501037_0204903 3300049573 Bacteria 1393
395 Ga0501037_0214902 3300049573 Bacteria 1355
396 Ga0501038_0047290 3300049574 Bacteria 3727
397 Ga0501038_0098147 3300049574 Bacteria 2443
398 Ga0501038_0119994 3300049574 Bacteria 2170
399 Ga0501038_0173411 3300049574 Bacteria 1744
400 Ga0501038_0193912 3300049574 Bacteria 1633
401 Ga0501038_0463318 3300049574 Bacteria 973
402 Ga0501039_0016425 3300049575 Bacteria 5669
403 Ga0501039_0018685 3300049575 Bacteria 5321
404 Ga0501039_0125605 3300049575 Bacteria 2012
405 Ga0501039_0389808 3300049575 Bacteria 1094
406 Ga0501039_0727563 3300049575 Bacteria 775
407 Ga0501040_0002823 3300049576 Bacteria 11209
408 Ga0501040_0033743 3300049576 Bacteria 3469
409 Ga0501040_0061120 3300049576 Bacteria 2590
410 Ga0501040_0108073 3300049576 Bacteria 1944
411 Ga0501040_0159017 3300049576 Bacteria 1597
412 Ga0501041_0011754 3300049577 Bacteria 5181
413 Ga0501041_0013809 3300049577 Bacteria 4788
414 Ga0501041_0053592 3300049577 Bacteria 2460
415 Ga0501041_0237868 3300049577 Bacteria 1144
416 Ga0501041_0396132 3300049577 Bacteria 874
417 Ga0501041_0740425 3300049577 Bacteria 630
418 Ga0501042_0265719 3300049578 Bacteria 1239
419 Ga0501042_0338580 3300049578 Bacteria 1087
420 Ga0501043_0057267 3300049579 Bacteria 3061
421 Ga0501043_0109254 3300049579 Bacteria 2172
422 Ga0501043_0111488 3300049579 Bacteria 2148
423 Ga0501043_0205162 3300049579 Bacteria 1529
424 Ga0501043_0619828 3300049579 Bacteria 797
425 Ga0501046_0000108 3300049580 Bacteria 87513
426 Ga0501046_0029709 3300049580 Bacteria 4442
427 Ga0501046_0041897 3300049580 Bacteria 3651
428 Ga0501046_0091415 3300049580 Bacteria 2341
429 Ga0501046_0129665 3300049580 Bacteria 1913
430 Ga0501046_0138795 3300049580 Bacteria 1841
431 Ga0501047_0064690 3300049581 Bacteria 3527
432 Ga0501047_0073352 3300049581 Bacteria 3295
433 Ga0501047_0074681 3300049581 Bacteria 3264
434 Ga0501047_0591766 3300049581 Bacteria 931
435 Ga0501048_0040036 3300049582 Bacteria 3359
436 Ga0501048_0073962 3300049582 Bacteria 2404
437 Ga0501048_0284058 3300049582 Bacteria 1177
438 Ga0501048_0443362 3300049582 Bacteria 929
439 Ga0501067_0123076 3300049583 Bacteria 1443
440 Ga0501068_0022313 3300049584 Bacteria 3701
441 Ga0501068_0067514 3300049584 Bacteria 2179
442 Ga0501068_0145346 3300049584 Bacteria 1488
443 Ga0501068_0181535 3300049584 Bacteria 1331
444 Ga0501069_0107833 3300049585 Bacteria 1584
445 Ga0501069_0110352 3300049585 Bacteria 1566
446 Ga0501070_0013195 3300049586 Bacteria 6965
447 Ga0501070_0081241 3300049586 Bacteria 2681
448 Ga0501070_0239452 3300049586 Bacteria 1485
449 Ga0501070_0446085 3300049586 Bacteria 1043
450 Ga0501071_0006779 3300049587 Bacteria 7457
451 Ga0501071_0039409 3300049587 Bacteria 3380
452 Ga0501071_0052424 3300049587 Bacteria 2942
453 Ga0501071_0081679 3300049587 Bacteria 2366
454 Ga0501071_0106938 3300049587 Bacteria 2065
455 Ga0501071_0114038 3300049587 Bacteria 1999
456 Ga0501071_0242477 3300049587 Bacteria 1359
457 Ga0501071_0543386 3300049587 Bacteria 892
458 Ga0501071_1028207 3300049587 Bacteria 636
459 Ga0501072_0003579 3300049588 Bacteria 11688
460 Ga0501072_0018544 3300049588 Bacteria 5362
461 Ga0501072_0023345 3300049588 Bacteria 4804
462 Ga0501072_0146530 3300049588 Bacteria 1882
463 Ga0501072_0325896 3300049588 Bacteria 1220
464 Ga0501072_0530405 3300049588 Bacteria 930
465 Ga0501073_0043755 3300049589 Bacteria 3157
466 Ga0501073_0239273 3300049589 Bacteria 1254
467 Ga0501074_0024951 3300049590 Bacteria 4343
468 Ga0501074_0072284 3300049590 Bacteria 2478
469 Ga0501074_0091851 3300049590 Bacteria 2174
470 Ga0501075_0033033 3300049591 Bacteria 3848
471 Ga0501075_0060350 3300049591 Bacteria 2857
472 Ga0501075_0069371 3300049591 Bacteria 2664
473 Ga0501075_0132289 3300049591 Bacteria 1900
474 Ga0501075_0217185 3300049591 Bacteria 1458
475 Ga0501076_0010887 3300049592 Bacteria 6765
476 Ga0501076_0027798 3300049592 Bacteria 4386
477 Ga0501076_0045416 3300049592 Bacteria 3468
478 Ga0501076_0057250 3300049592 Bacteria 3095
479 Ga0501076_0072069 3300049592 Bacteria 2764
480 Ga0501076_0204125 3300049592 Bacteria 1614
481 Ga0501076_0264888 3300049592 Bacteria 1407
482 Ga0501077_0003781 3300049593 Bacteria 9111
483 Ga0501077_0014463 3300049593 Bacteria 4959
484 Ga0501077_0016838 3300049593 Bacteria 4611
485 Ga0501077_0041653 3300049593 Bacteria 2922
486 Ga0501077_0213105 3300049593 Bacteria 1227
487 Ga0501079_0013945 3300049741 Bacteria 6130
488 Ga0501079_0016914 3300049741 Bacteria 5570
489 Ga0501079_0243390 3300049741 Bacteria 1405
490 Ga0501079_0288304 3300049741 Bacteria 1284
491 Ga0501080_0064676 3300049742 Bacteria 3402
492 Ga0501080_0151453 3300049742 Bacteria 2143
493 Ga0501080_0975474 3300049742 Bacteria 736
494 Ga0501080_1035120 3300049742 Bacteria 711
495 Ga0501081_0001225 3300049743 Bacteria 15621
496 Ga0501081_0024073 3300049743 Bacteria 4087
497 Ga0501081_0065866 3300049743 Bacteria 2519
498 Ga0501081_0066641 3300049743 Bacteria 2504
499 Ga0501081_0068052 3300049743 Bacteria 2478
500 Ga0501081_0142070 3300049743 Bacteria 1721
501 Ga0501081_0178971 3300049743 Bacteria 1533
502 Ga0501081_0403929 3300049743 Bacteria 1011
503 Ga0501083_0013422 3300049744 Bacteria 5727
504 Ga0501083_0022280 3300049744 Bacteria 4396
505 Ga0501083_0097745 3300049744 Bacteria 1937
506 Ga0501083_0216791 3300049744 Bacteria 1247
507 Ga0501083_0288195 3300049744 Bacteria 1068
508 Ga0501035_0043235 3300049822 Bacteria 4061
509 Ga0501035_0044668 3300049822 Bacteria 3989
510 Ga0501035_0114738 3300049822 Bacteria 2358
511 Ga0501035_0234018 3300049822 Bacteria 1565
512 Ga0501044_0065512 3300049823 Bacteria 3705
513 Ga0501044_0081989 3300049823 Bacteria 3264
514 Ga0501044_0291132 3300049823 Bacteria 1564
515 Ga0501044_0389363 3300049823 Bacteria 1308
516 Ga0501045_0003878 3300049824 Bacteria 10286
517 Ga0501045_0010207 3300049824 Bacteria 6574
518 Ga0501045_0018012 3300049824 Bacteria 5015
519 Ga0501045_0047550 3300049824 Bacteria 3126
520 Ga0501045_0057144 3300049824 Bacteria 2855
521 Ga0501045_0249109 3300049824 Bacteria 1322
522 Ga0501045_0896782 3300049824 Bacteria 651
523 nmdc:mga0yw44_289763_c1 3300050492 Bacteria 1095
524 nmdc:mga07m45_126110_c1 3300050496 Bacteria 1480
525 nmdc:mga05p37_339187_c1 3300050507 Bacteria 1773
526 nmdc:mga05p37_34272_c1 3300050507 Bacteria 6217
527 nmdc:mga05p37_616556_c1 3300050507 Bacteria 1222
528 nmdc:mga09592_36292_c1 3300050508 Bacteria 4128
529 nmdc:mga0qj67_203921_c1 3300050509 Bacteria 1606
530 nmdc:mga0qj67_446420_c1 3300050509 Bacteria 1042
531 nmdc:mga0qj67_642713_c1 3300050509 Bacteria 847
532 nmdc:mga06r32_122233_c1 3300050510 Bacteria 2569
533 nmdc:mga06r32_389353_c1 3300050510 Bacteria 1376
534 nmdc:mga06r32_64132_c1 3300050510 Bacteria 3542
535 nmdc:mga06r32_648382_c1 3300050510 Bacteria 1024
536 nmdc:mga06r32_782936_c1 3300050510 Bacteria 915
537 nmdc:mga08y16_136588_c1 3300050511 Bacteria 2549
538 nmdc:mga08y16_167447_c1 3300050511 Bacteria 2283
539 nmdc:mga08y16_61416_c1 3300050511 Bacteria 3924
540 nmdc:mga08y16_82714_c1 3300050511 Bacteria 3347
541 nmdc:mga0n895_13375_c1 3300050512 Bacteria 7400
542 nmdc:mga0n895_23388_c1 3300050512 Bacteria 5808
543 nmdc:mga0n895_256121_c1 3300050512 Bacteria 1776
544 nmdc:mga0rr50_16598_c1 3300050513 Bacteria 4896
545 nmdc:mga0rr50_291892_c1 3300050513 Bacteria 1363
546 nmdc:mga0rr50_82340_c1 3300050513 Bacteria 2485
547 nmdc:mga0a205_120276_c1 3300050515 Bacteria 2525
548 nmdc:mga0a205_2229_c1 3300050515 Bacteria 17057
549 nmdc:mga0a205_290241_c1 3300050515 Bacteria 1510
550 nmdc:mga0a205_36738_c1 3300050515 Bacteria 4708
551 nmdc:mga0a205_637464_c1 3300050515 Bacteria 917
552 Ga0495655_0132288 3300053083 Bacteria 769
553 Ga0495619_0001221 3300053085 Bacteria 16842
554 Ga0495619_0164199 3300053085 Bacteria 1534
555 Ga0495619_0180870 3300053085 Bacteria 1459
556 Ga0500644_0157867 3300053088 Bacteria 915
557 Ga0500556_0000054 3300053104 Bacteria 115949
558 Ga0500616_0002525 3300053153 Bacteria 15140
559 Ga0501084_0078994 3300054114 Bacteria 2758
560 Ga0501084_0090135 3300054114 Bacteria 2574
561 Ga0501084_0164758 3300054114 Bacteria 1871
562 Ga0501084_0190632 3300054114 Bacteria 1729
563 Ga0501084_0231167 3300054114 Bacteria 1561
564 Ga0501084_0392923 3300054114 Bacteria 1172
565 Ga0587082_105958 3300059504 Bacteria 619
566 Ga0587085_094958 3300059506 Bacteria 621
567 Ga0587088_077657 3300059508 Bacteria 705
568 Ga0587095_020453 3300059514 Bacteria 633
569 Ga0587128_090805 3300059630 Bacteria 626
570 Ga0587076_074995 3300059645 Bacteria 710
571 Ga0587078_047969 3300059646 Bacteria 620
572 Ga0587079_138277 3300059647 Bacteria 619
573 Ga0501082_0006604 3300060353 Bacteria 10036
574 Ga0501082_0056485 3300060353 Bacteria 3382
575 Ga0501082_0257776 3300060353 Bacteria 1517
576 Ga0501082_0276894 3300060353 Bacteria 1461
577 Ga0501082_0371262 3300060353 Bacteria 1248
578 Ga0501082_0957387 3300060353 Bacteria 748
579 Ga0501082_1165599 3300060353 Bacteria 673
580 Ga0530510_0003947 3300061734 Bacteria 10228
581 Ga0530510_0042834 3300061734 Bacteria 3270
582 Ga0530510_0139876 3300061734 Bacteria 1783
583 Ga0530510_0260967 3300061734 Bacteria 1292
584 Ga0530510_0413650 3300061734 Bacteria 1017
585 Ga0530510_0538752 3300061734 Bacteria 886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031250 Ga0265331_10007887 Ga0265331_100078875 178
2 3300049570 Ga0501033_0131243 Ga0501033_0131243_360_917 178
3 3300049571 Ga0501034_0114692 Ga0501034_0114692_1658_2215 178
4 3300031711 Ga0265314_10082530 Ga0265314_100825302 180
5 3300047318 Ga0495636_0052293 Ga0495636_0052293_718_1278 181
6 3300004801 Ga0058860_12142977 Ga0058860_121429771 182
7 3300005435 Ga0070714_100012825 Ga0070714_1000128255 182
8 3300005842 Ga0068858_100492058 Ga0068858_1004920582 182
9 3300013296 Ga0157374_10740647 Ga0157374_107406471 182
10 3300013307 Ga0157372_10017628 Ga0157372_100176281 182
11 3300020078 Ga0206352_11101380 Ga0206352_111013802 182
12 3300020082 Ga0206353_11592444 Ga0206353_115924441 182
13 3300025929 Ga0207664_10130698 Ga0207664_101306983 182
14 3300049571 Ga0501034_0066171 Ga0501034_0066171_1722_2285 182
15 3300049823 Ga0501044_0389363 Ga0501044_0389363_366_929 182
16 3300050509 nmdc:mga0qj67_446420_c1 nmdc:mga0qj67_446420_c1_381_938 182
17 3300050510 nmdc:mga06r32_782936_c1 nmdc:mga06r32_782936_c1_11_568 182
18 3300006163 Ga0070715_10114509 Ga0070715_101145092 183
19 3300031731 Ga0307405_10664587 Ga0307405_106645872 183
20 3300031903 Ga0307407_10077389 Ga0307407_100773892 183
21 3300032005 Ga0307411_10765261 Ga0307411_107652611 183
22 3300035410 Ga0373924_0171808 Ga0373924_0171808_253_804 183
23 3300037853 Ga0436364_0574354 Ga0436364_0574354_2334_2912 183
24 3300046462 Ga0495651_0149179 Ga0495651_0149179_1055_1606 183
25 3300046529 Ga0495652_0118734 Ga0495652_0118734_179_730 183
26 3300046559 Ga0495667_0192738 Ga0495667_0192738_694_1245 183
27 3300047317 Ga0495604_0219644 Ga0495604_0219644_112_663 183
28 3300047444 Ga0495675_0504691 Ga0495675_0504691_101_652 183
29 3300048088 Ga0495602_0113278 Ga0495602_0113278_212_763 183
30 3300053085 Ga0495619_0164199 Ga0495619_0164199_313_864 183
31 3300005331 Ga0070670_100071032 Ga0070670_1000710324 184
32 3300005335 Ga0070666_10423636 Ga0070666_104236362 184
33 3300005336 Ga0070680_100027016 Ga0070680_1000270162 184
34 3300005336 Ga0070680_101118606 Ga0070680_1011186061 184
35 3300005338 Ga0068868_100684949 Ga0068868_1006849492 184
36 3300005341 Ga0070691_10069787 Ga0070691_100697871 184
37 3300005347 Ga0070668_100009939 Ga0070668_1000099394 184
38 3300005355 Ga0070671_100489895 Ga0070671_1004898952 184
39 3300005367 Ga0070667_100025204 Ga0070667_1000252045 184
40 3300005406 Ga0070703_10003324 Ga0070703_100033246 184
41 3300005438 Ga0070701_10021326 Ga0070701_100213263 184
42 3300005440 Ga0070705_100000427 Ga0070705_1000004272 184
43 3300005441 Ga0070700_100002813 Ga0070700_10000281311 184
44 3300005441 Ga0070700_100278443 Ga0070700_1002784431 184
45 3300005445 Ga0070708_100128672 Ga0070708_1001286722 184
46 3300005455 Ga0070663_100054771 Ga0070663_1000547713 184
47 3300005458 Ga0070681_10020054 Ga0070681_100200542 184
48 3300005459 Ga0068867_100831630 Ga0068867_1008316301 184
49 3300005459 Ga0068867_101041423 Ga0068867_1010414231 184
50 3300005518 Ga0070699_100059429 Ga0070699_1000594292 184
51 3300005535 Ga0070684_101102611 Ga0070684_1011026111 184
52 3300005536 Ga0070697_100170871 Ga0070697_1001708712 184
53 3300005539 Ga0068853_100340218 Ga0068853_1003402182 184
54 3300005545 Ga0070695_100185385 Ga0070695_1001853852 184
55 3300005547 Ga0070693_100004150 Ga0070693_1000041502 184
56 3300005549 Ga0070704_100025023 Ga0070704_1000250232 184
57 3300005564 Ga0070664_101183177 Ga0070664_1011831771 184
58 3300005577 Ga0068857_100075950 Ga0068857_1000759504 184
59 3300005617 Ga0068859_100001914 Ga0068859_1000019142 184
60 3300005618 Ga0068864_100031959 Ga0068864_1000319594 184
61 3300005618 Ga0068864_100122993 Ga0068864_1001229932 184
62 3300005719 Ga0068861_100295139 Ga0068861_1002951392 184
63 3300005719 Ga0068861_100300315 Ga0068861_1003003152 184
64 3300005841 Ga0068863_100041278 Ga0068863_1000412786 184
65 3300005841 Ga0068863_100656824 Ga0068863_1006568242 184
66 3300005843 Ga0068860_100046332 Ga0068860_1000463325 184
67 3300005844 Ga0068862_100047782 Ga0068862_1000477822 184
68 3300005844 Ga0068862_100263674 Ga0068862_1002636742 184
69 3300006038 Ga0075365_10404486 Ga0075365_104044861 184
70 3300006038 Ga0075365_10432964 Ga0075365_104329642 184
71 3300006847 Ga0075431_100031680 Ga0075431_1000316806 184
72 3300006931 Ga0097620_100001914 Ga0097620_10000191427 184
73 3300007265 Ga0099794_10025198 Ga0099794_100251983 184
74 3300007788 Ga0099795_10041163 Ga0099795_100411633 184
75 3300009092 Ga0105250_10134442 Ga0105250_101344422 184
76 3300009094 Ga0111539_10279852 Ga0111539_102798523 184
77 3300009098 Ga0105245_10596627 Ga0105245_105966271 184
78 3300009147 Ga0114129_10057811 Ga0114129_100578117 184
79 3300009148 Ga0105243_10059012 Ga0105243_100590123 184
80 3300009553 Ga0105249_10006173 Ga0105249_100061732 184
81 3300010159 Ga0099796_10102444 Ga0099796_101024441 184
82 3300011119 Ga0105246_10361220 Ga0105246_103612201 184
83 3300011119 Ga0105246_10680369 Ga0105246_106803692 184
84 3300014326 Ga0157380_10203842 Ga0157380_102038422 184
85 3300025885 Ga0207653_10000631 Ga0207653_100006312 184
86 3300025907 Ga0207645_10622737 Ga0207645_106227371 184
87 3300025912 Ga0207707_10141612 Ga0207707_101416122 184
88 3300025923 Ga0207681_10055329 Ga0207681_100553293 184
89 3300025925 Ga0207650_10046419 Ga0207650_100464194 184
90 3300025931 Ga0207644_10250096 Ga0207644_102500962 184
91 3300025935 Ga0207709_10315818 Ga0207709_103158182 184
92 3300025942 Ga0207689_10133770 Ga0207689_101337703 184
93 3300025961 Ga0207712_10002132 Ga0207712_100021322 184
94 3300025972 Ga0207668_10004553 Ga0207668_100045535 184
95 3300025972 Ga0207668_10351450 Ga0207668_103514502 184
96 3300025986 Ga0207658_10493671 Ga0207658_104936711 184
97 3300026023 Ga0207677_10765587 Ga0207677_107655871 184
98 3300026041 Ga0207639_10250301 Ga0207639_102503012 184
99 3300026067 Ga0207678_10031190 Ga0207678_100311905 184
100 3300026075 Ga0207708_10007125 Ga0207708_100071259 184
101 3300026075 Ga0207708_10251638 Ga0207708_102516381 184
102 3300026088 Ga0207641_10096129 Ga0207641_100961295 184
103 3300026088 Ga0207641_10170614 Ga0207641_101706141 184
104 3300026089 Ga0207648_10186433 Ga0207648_101864333 184
105 3300026095 Ga0207676_10059277 Ga0207676_100592774 184
106 3300026116 Ga0207674_10093506 Ga0207674_100935063 184
107 3300026118 Ga0207675_100151694 Ga0207675_1001516943 184
108 3300026118 Ga0207675_101544140 Ga0207675_1015441401 184
109 3300027512 Ga0209179_1043289 Ga0209179_10432892 184
110 3300027671 Ga0209588_1037538 Ga0209588_10375382 184
111 3300027907 Ga0207428_10307965 Ga0207428_103079652 184
112 3300028379 Ga0268266_10785094 Ga0268266_107850942 184
113 3300028380 Ga0268265_10007612 Ga0268265_100076125 184
114 3300028380 Ga0268265_10281366 Ga0268265_102813662 184
115 3300028381 Ga0268264_10018306 Ga0268264_100183062 184
116 3300028381 Ga0268264_10317754 Ga0268264_103177541 184
117 3300042436 Ga0439435_0025306 Ga0439435_0025306_198_752 184
118 3300046533 Ga0495640_0474783 Ga0495640_0474783_74_628 184
119 3300048905 Ga0496102_0159345 Ga0496102_0159345_780_1334 184
120 3300048905 Ga0496102_0227949 Ga0496102_0227949_1119_1673 184
121 3300048906 Ga0496103_0064387 Ga0496103_0064387_748_1302 184
122 3300048906 Ga0496103_0198957 Ga0496103_0198957_66_620 184
123 3300048909 Ga0496106_0021711 Ga0496106_0021711_808_1362 184
124 3300048910 Ga0496107_0119810 Ga0496107_0119810_529_1083 184
125 3300048910 Ga0496107_0582589 Ga0496107_0582589_34_588 184
126 3300048911 Ga0496108_0411241 Ga0496108_0411241_467_1021 184
127 3300048912 Ga0496109_0328391 Ga0496109_0328391_81_635 184
128 3300048917 Ga0496114_0514263 Ga0496114_0514263_474_1028 184
129 3300049568 Ga0501031_0542288 Ga0501031_0542288_65_646 184
130 3300049571 Ga0501034_0335640 Ga0501034_0335640_769_1323 184
131 3300049571 Ga0501034_0364913 Ga0501034_0364913_697_1308 184
132 3300049571 Ga0501034_0877219 Ga0501034_0877219_138_692 184
133 3300049574 Ga0501038_0463318 Ga0501038_0463318_56_610 184
134 3300049577 Ga0501041_0740425 Ga0501041_0740425_42_596 184
135 3300049580 Ga0501046_0000108 Ga0501046_0000108_12086_12640 184
136 3300049580 Ga0501046_0091415 Ga0501046_0091415_1066_1620 184
137 3300049580 Ga0501046_0138795 Ga0501046_0138795_289_843 184
138 3300049581 Ga0501047_0073352 Ga0501047_0073352_2420_2974 184
139 3300049582 Ga0501048_0284058 Ga0501048_0284058_587_1141 184
140 3300049583 Ga0501067_0123076 Ga0501067_0123076_374_928 184
141 3300049585 Ga0501069_0110352 Ga0501069_0110352_613_1167 184
142 3300049586 Ga0501070_0239452 Ga0501070_0239452_400_954 184
143 3300049587 Ga0501071_0543386 Ga0501071_0543386_206_760 184
144 3300049589 Ga0501073_0043755 Ga0501073_0043755_2247_2801 184
145 3300049590 Ga0501074_0091851 Ga0501074_0091851_16_570 184
146 3300049593 Ga0501077_0213105 Ga0501077_0213105_64_618 184
147 3300049741 Ga0501079_0288304 Ga0501079_0288304_262_816 184
148 3300049742 Ga0501080_0151453 Ga0501080_0151453_795_1349 184
149 3300049742 Ga0501080_0975474 Ga0501080_0975474_146_700 184
150 3300049743 Ga0501081_0142070 Ga0501081_0142070_1089_1643 184
151 3300049743 Ga0501081_0178971 Ga0501081_0178971_259_813 184
152 3300049823 Ga0501044_0291132 Ga0501044_0291132_550_1104 184
153 3300049824 Ga0501045_0010207 Ga0501045_0010207_4022_4576 184
154 3300049824 Ga0501045_0047550 Ga0501045_0047550_980_1534 184
155 3300050492 nmdc:mga0yw44_289763_c1 nmdc:mga0yw44_289763_c1_73_627 184
156 3300050507 nmdc:mga05p37_34272_c1 nmdc:mga05p37_34272_c1_2050_2604 184
157 3300050510 nmdc:mga06r32_64132_c1 nmdc:mga06r32_64132_c1_2931_3485 184
158 3300053104 Ga0500556_0000054 Ga0500556_0000054_58154_58708 184
159 3300053153 Ga0500616_0002525 Ga0500616_0002525_6234_6788 184
160 3300054114 Ga0501084_0078994 Ga0501084_0078994_275_829 184
161 3300054114 Ga0501084_0164758 Ga0501084_0164758_871_1425 184
162 3300054114 Ga0501084_0231167 Ga0501084_0231167_972_1526 184
163 3300059504 Ga0587082_105958 Ga0587082_105958_25_579 184
164 3300059506 Ga0587085_094958 Ga0587085_094958_22_576 184
165 3300059508 Ga0587088_077657 Ga0587088_077657_128_682 184
166 3300059514 Ga0587095_020453 Ga0587095_020453_40_594 184
167 3300059630 Ga0587128_090805 Ga0587128_090805_27_581 184
168 3300059645 Ga0587076_074995 Ga0587076_074995_25_579 184
169 3300059646 Ga0587078_047969 Ga0587078_047969_26_580 184
170 3300059647 Ga0587079_138277 Ga0587079_138277_25_579 184
171 3300060353 Ga0501082_0257776 Ga0501082_0257776_131_685 184
172 3300060353 Ga0501082_0371262 Ga0501082_0371262_205_759 184
173 3300061734 Ga0530510_0042834 Ga0530510_0042834_1309_1863 184
174 3300005330 Ga0070690_100099288 Ga0070690_1000992883 185
175 3300005338 Ga0068868_100419097 Ga0068868_1004190972 185
176 3300005353 Ga0070669_100429563 Ga0070669_1004295631 185
177 3300005406 Ga0070703_10029443 Ga0070703_100294432 185
178 3300005434 Ga0070709_10127644 Ga0070709_101276441 185
179 3300005441 Ga0070700_100543961 Ga0070700_1005439611 185
180 3300005444 Ga0070694_100026501 Ga0070694_1000265014 185
181 3300005545 Ga0070695_100004704 Ga0070695_1000047046 185
182 3300005549 Ga0070704_100373503 Ga0070704_1003735032 185
183 3300005617 Ga0068859_101271702 Ga0068859_1012717021 185
184 3300005719 Ga0068861_100207844 Ga0068861_1002078441 185
185 3300005842 Ga0068858_100641361 Ga0068858_1006413612 185
186 3300005983 Ga0081540_1002918 Ga0081540_10029186 185
187 3300005985 Ga0081539_10087706 Ga0081539_100877062 185
188 3300006353 Ga0075370_10052509 Ga0075370_100525092 185
189 3300006844 Ga0075428_100260089 Ga0075428_1002600893 185
190 3300006852 Ga0075433_10000150 Ga0075433_1000015025 185
191 3300006871 Ga0075434_100002118 Ga0075434_1000021182 185
192 3300006871 Ga0075434_100035347 Ga0075434_1000353473 185
193 3300006931 Ga0097620_101271635 Ga0097620_1012716352 185
194 3300007076 Ga0075435_100022930 Ga0075435_1000229302 185
195 3300009094 Ga0111539_10003908 Ga0111539_1000390812 185
196 3300009094 Ga0111539_10033514 Ga0111539_100335147 185
197 3300009098 Ga0105245_10057667 Ga0105245_100576674 185
198 3300009147 Ga0114129_10414064 Ga0114129_104140641 185
199 3300009147 Ga0114129_11210630 Ga0114129_112106302 185
200 3300009176 Ga0105242_11234092 Ga0105242_112340921 185
201 3300009177 Ga0105248_10180829 Ga0105248_101808294 185
202 3300009553 Ga0105249_10835081 Ga0105249_108350812 185
203 3300010375 Ga0105239_10312975 Ga0105239_103129752 185
204 3300011119 Ga0105246_10307679 Ga0105246_103076792 185
205 3300011119 Ga0105246_10455011 Ga0105246_104550111 185
206 3300013308 Ga0157375_10027698 Ga0157375_100276984 185
207 3300013308 Ga0157375_10264513 Ga0157375_102645133 185
208 3300014325 Ga0163163_10048919 Ga0163163_100489196 185
209 3300014497 Ga0182008_10131340 Ga0182008_101313402 185
210 3300014968 Ga0157379_10119206 Ga0157379_101192062 185
211 3300014969 Ga0157376_10357844 Ga0157376_103578442 185
212 3300017792 Ga0163161_10295416 Ga0163161_102954162 185
213 3300025906 Ga0207699_10123355 Ga0207699_101233552 185
214 3300025923 Ga0207681_10489942 Ga0207681_104899422 185
215 3300025935 Ga0207709_10855492 Ga0207709_108554921 185
216 3300025941 Ga0207711_10347328 Ga0207711_103473282 185
217 3300025981 Ga0207640_10298176 Ga0207640_102981761 185
218 3300026023 Ga0207677_10392464 Ga0207677_103924642 185
219 3300026035 Ga0207703_10272229 Ga0207703_102722292 185
220 3300026035 Ga0207703_10828746 Ga0207703_108287461 185
221 3300026075 Ga0207708_10081805 Ga0207708_100818054 185
222 3300026075 Ga0207708_11025579 Ga0207708_110255791 185
223 3300026089 Ga0207648_10165779 Ga0207648_101657795 185
224 3300026118 Ga0207675_100099440 Ga0207675_1000994402 185
225 3300026118 Ga0207675_100266573 Ga0207675_1002665733 185
226 3300027907 Ga0207428_10056772 Ga0207428_100567724 185
227 3300028794 Ga0307515_10527144 Ga0307515_105271442 185
228 3300031665 Ga0316575_10104976 Ga0316575_101049762 185
229 3300031665 Ga0316575_10177277 Ga0316575_101772772 185
230 3300031691 Ga0316579_10038651 Ga0316579_100386513 185
231 3300031727 Ga0316576_10256736 Ga0316576_102567362 185
232 3300031727 Ga0316576_10308249 Ga0316576_103082491 185
233 3300031733 Ga0316577_10313979 Ga0316577_103139792 185
234 3300031852 Ga0307410_11015312 Ga0307410_110153121 185
235 3300032133 Ga0316583_10002462 Ga0316583_100024628 185
236 3300032137 Ga0316585_10032885 Ga0316585_100328852 185
237 3300033528 Ga0316588_1105129 Ga0316588_11051292 185
238 3300033529 Ga0316587_1009123 Ga0316587_10091233 185
239 3300034820 Ga0373959_0041208 Ga0373959_0041208_68_628 185
240 3300035084 Ga0373928_0020631 Ga0373928_0020631_401_961 185
241 3300035112 Ga0373932_0017521 Ga0373932_0017521_849_1409 185
242 3300035114 Ga0373939_0005250 Ga0373939_0005250_246_806 185
243 3300035114 Ga0373939_0009445 Ga0373939_0009445_1413_1973 185
244 3300035115 Ga0373941_0016896 Ga0373941_0016896_1097_1657 185
245 3300035115 Ga0373941_0167521 Ga0373941_0167521_44_604 185
246 3300035121 Ga0373960_0087699 Ga0373960_0087699_335_895 185
247 3300035207 Ga0373942_0016883 Ga0373942_0016883_347_907 185
248 3300035242 Ga0373962_0013944 Ga0373962_0013944_1035_1595 185
249 3300035242 Ga0373962_0020488 Ga0373962_0020488_691_1251 185
250 3300035398 Ga0316574_0253326 Ga0316574_0253326_357_917 185
251 3300035691 Ga0373931_0000951 Ga0373931_0000951_6841_7401 185
252 3300035691 Ga0373931_0014099 Ga0373931_0014099_1002_1562 185
253 3300035691 Ga0373931_0227711 Ga0373931_0227711_16_576 185
254 3300035695 Ga0373927_0053183 Ga0373927_0053183_1559_2119 185
255 3300035695 Ga0373927_0382013 Ga0373927_0382013_308_868 185
256 3300036647 Ga0316582_0233004 Ga0316582_0233004_565_1125 185
257 3300036647 Ga0316582_0243369 Ga0316582_0243369_515_1075 185
258 3300036712 Ga0316584_0622372 Ga0316584_0622372_150_710 185
259 3300037588 Ga0316581_0002304 Ga0316581_0002304_180_740 185
260 3300045976 Ga0466967_0568650 Ga0466967_0568650_103_669 185
261 3300046459 Ga0495629_0168672 Ga0495629_0168672_613_1173 185
262 3300046472 Ga0495580_0394589 Ga0495580_0394589_242_802 185
263 3300048905 Ga0496102_0884741 Ga0496102_0884741_55_615 185
264 3300048905 Ga0496102_1250597 Ga0496102_1250597_22_582 185
265 3300048910 Ga0496107_0321122 Ga0496107_0321122_196_756 185
266 3300048913 Ga0496110_0021047 Ga0496110_0021047_3667_4227 185
267 3300048914 Ga0496111_0019160 Ga0496111_0019160_507_1067 185
268 3300048915 Ga0496112_0242141 Ga0496112_0242141_405_965 185
269 3300048916 Ga0496113_0909090 Ga0496113_0909090_102_662 185
270 3300048918 Ga0496115_0003665 Ga0496115_0003665_1095_1655 185
271 3300049575 Ga0501039_0389808 Ga0501039_0389808_266_823 185
272 3300049577 Ga0501041_0396132 Ga0501041_0396132_289_846 185
273 3300049587 Ga0501071_1028207 Ga0501071_1028207_40_597 185
274 3300049588 Ga0501072_0023345 Ga0501072_0023345_2661_3218 185
275 3300049591 Ga0501075_0217185 Ga0501075_0217185_805_1362 185
276 3300049592 Ga0501076_0057250 Ga0501076_0057250_2385_2942 185
277 3300049743 Ga0501081_0065866 Ga0501081_0065866_699_1256 185
278 3300049824 Ga0501045_0249109 Ga0501045_0249109_676_1233 185
279 3300050496 nmdc:mga07m45_126110_c1 nmdc:mga07m45_126110_c1_731_1291 185
280 3300050507 nmdc:mga05p37_339187_c1 nmdc:mga05p37_339187_c1_685_1245 185
281 3300050507 nmdc:mga05p37_616556_c1 nmdc:mga05p37_616556_c1_567_1127 185
282 3300050508 nmdc:mga09592_36292_c1 nmdc:mga09592_36292_c1_2944_3504 185
283 3300050509 nmdc:mga0qj67_203921_c1 nmdc:mga0qj67_203921_c1_584_1144 185
284 3300050510 nmdc:mga06r32_122233_c1 nmdc:mga06r32_122233_c1_1925_2485 185
285 3300050510 nmdc:mga06r32_389353_c1 nmdc:mga06r32_389353_c1_768_1328 185
286 3300050510 nmdc:mga06r32_648382_c1 nmdc:mga06r32_648382_c1_414_971 185
287 3300050511 nmdc:mga08y16_136588_c1 nmdc:mga08y16_136588_c1_223_783 185
288 3300050511 nmdc:mga08y16_167447_c1 nmdc:mga08y16_167447_c1_59_619 185
289 3300050511 nmdc:mga08y16_82714_c1 nmdc:mga08y16_82714_c1_91_651 185
290 3300050512 nmdc:mga0n895_13375_c1 nmdc:mga0n895_13375_c1_37_597 185
291 3300050512 nmdc:mga0n895_23388_c1 nmdc:mga0n895_23388_c1_2911_3471 185
292 3300050513 nmdc:mga0rr50_16598_c1 nmdc:mga0rr50_16598_c1_1442_2002 185
293 3300050513 nmdc:mga0rr50_291892_c1 nmdc:mga0rr50_291892_c1_513_1073 185
294 3300050513 nmdc:mga0rr50_82340_c1 nmdc:mga0rr50_82340_c1_838_1398 185
295 3300050515 nmdc:mga0a205_120276_c1 nmdc:mga0a205_120276_c1_1149_1709 185
296 3300050515 nmdc:mga0a205_2229_c1 nmdc:mga0a205_2229_c1_10737_11297 185
297 3300050515 nmdc:mga0a205_290241_c1 nmdc:mga0a205_290241_c1_70_630 185
298 3300050515 nmdc:mga0a205_637464_c1 nmdc:mga0a205_637464_c1_191_751 185
299 3300060353 Ga0501082_0957387 Ga0501082_0957387_26_583 185
300 3300061734 Ga0530510_0413650 Ga0530510_0413650_264_821 185
301 3300061734 Ga0530510_0538752 Ga0530510_0538752_295_852 185
302 3300002244 JGI24742J22300_10033212 JGI24742J22300_100332121 186
303 3300005329 Ga0070683_100092767 Ga0070683_1000927675 186
304 3300005336 Ga0070680_100196424 Ga0070680_1001964242 186
305 3300005337 Ga0070682_100059360 Ga0070682_1000593601 186
306 3300005338 Ga0068868_100465471 Ga0068868_1004654711 186
307 3300005345 Ga0070692_10188542 Ga0070692_101885421 186
308 3300005365 Ga0070688_100212269 Ga0070688_1002122692 186
309 3300005366 Ga0070659_100221370 Ga0070659_1002213702 186
310 3300005366 Ga0070659_100294522 Ga0070659_1002945222 186
311 3300005367 Ga0070667_100421644 Ga0070667_1004216442 186
312 3300005434 Ga0070709_10034824 Ga0070709_100348243 186
313 3300005444 Ga0070694_100017214 Ga0070694_1000172147 186
314 3300005456 Ga0070678_100083070 Ga0070678_1000830702 186
315 3300005459 Ga0068867_100388729 Ga0068867_1003887292 186
316 3300005530 Ga0070679_100063548 Ga0070679_1000635485 186
317 3300005535 Ga0070684_100260037 Ga0070684_1002600371 186
318 3300005546 Ga0070696_100029690 Ga0070696_1000296901 186
319 3300005549 Ga0070704_100032866 Ga0070704_1000328661 186
320 3300005563 Ga0068855_100116551 Ga0068855_1001165513 186
321 3300005577 Ga0068857_100049678 Ga0068857_1000496783 186
322 3300005578 Ga0068854_100035896 Ga0068854_1000358963 186
323 3300005617 Ga0068859_100088096 Ga0068859_1000880965 186
324 3300005719 Ga0068861_100356974 Ga0068861_1003569741 186
325 3300005843 Ga0068860_100055488 Ga0068860_1000554881 186
326 3300005937 Ga0081455_10001595 Ga0081455_1000159522 186
327 3300006048 Ga0075363_100020834 Ga0075363_1000208344 186
328 3300006175 Ga0070712_100677485 Ga0070712_1006774851 186
329 3300006844 Ga0075428_100268461 Ga0075428_1002684612 186
330 3300006846 Ga0075430_100040569 Ga0075430_1000405692 186
331 3300006852 Ga0075433_10192144 Ga0075433_101921442 186
332 3300006881 Ga0068865_100120057 Ga0068865_1001200573 186
333 3300006931 Ga0097620_100088091 Ga0097620_1000880915 186
334 3300009093 Ga0105240_10117882 Ga0105240_101178822 186
335 3300009094 Ga0111539_10058388 Ga0111539_100583885 186
336 3300009101 Ga0105247_10008332 Ga0105247_100083329 186
337 3300009148 Ga0105243_10080683 Ga0105243_100806833 186
338 3300009177 Ga0105248_10482465 Ga0105248_104824651 186
339 3300010375 Ga0105239_10012676 Ga0105239_1001267615 186
340 3300012494 Ga0157341_1006900 Ga0157341_10069001 186
341 3300012507 Ga0157342_1005900 Ga0157342_10059003 186
342 3300013104 Ga0157370_10313437 Ga0157370_103134372 186
343 3300013306 Ga0163162_10115057 Ga0163162_101150573 186
344 3300013307 Ga0157372_11095122 Ga0157372_110951222 186
345 3300014326 Ga0157380_10007714 Ga0157380_100077144 186
346 3300014968 Ga0157379_10667469 Ga0157379_106674692 186
347 3300017792 Ga0163161_10435914 Ga0163161_104359142 186
348 3300020070 Ga0206356_11534066 Ga0206356_115340662 186
349 3300020076 Ga0206355_1452686 Ga0206355_14526862 186
350 3300020082 Ga0206353_11194519 Ga0206353_111945192 186
351 3300022467 Ga0224712_10240290 Ga0224712_102402901 186
352 3300025898 Ga0207692_10377362 Ga0207692_103773621 186
353 3300025899 Ga0207642_10326661 Ga0207642_103266612 186
354 3300025900 Ga0207710_10079885 Ga0207710_100798852 186
355 3300025907 Ga0207645_10285035 Ga0207645_102850351 186
356 3300025913 Ga0207695_10478271 Ga0207695_104782711 186
357 3300025915 Ga0207693_10004273 Ga0207693_100042734 186
358 3300025915 Ga0207693_10578233 Ga0207693_105782331 186
359 3300025917 Ga0207660_10275089 Ga0207660_102750891 186
360 3300025924 Ga0207694_10599782 Ga0207694_105997821 186
361 3300025929 Ga0207664_10101638 Ga0207664_101016382 186
362 3300025932 Ga0207690_10386696 Ga0207690_103866962 186
363 3300025935 Ga0207709_10221030 Ga0207709_102210301 186
364 3300025937 Ga0207669_10107533 Ga0207669_101075333 186
365 3300025938 Ga0207704_10322339 Ga0207704_103223392 186
366 3300025939 Ga0207665_10052047 Ga0207665_100520471 186
367 3300025940 Ga0207691_10008893 Ga0207691_1000889313 186
368 3300025941 Ga0207711_10899970 Ga0207711_108999701 186
369 3300025944 Ga0207661_10215818 Ga0207661_102158181 186
370 3300025961 Ga0207712_10359262 Ga0207712_103592621 186
371 3300025972 Ga0207668_10028368 Ga0207668_100283682 186
372 3300026075 Ga0207708_10349141 Ga0207708_103491411 186
373 3300026078 Ga0207702_10039530 Ga0207702_100395303 186
374 3300026116 Ga0207674_10446173 Ga0207674_104461731 186
375 3300026118 Ga0207675_100027412 Ga0207675_1000274122 186
376 3300026118 Ga0207675_100223009 Ga0207675_1002230092 186
377 3300026121 Ga0207683_11484418 Ga0207683_114844181 186
378 3300026142 Ga0207698_10063130 Ga0207698_100631303 186
379 3300027876 Ga0209974_10022748 Ga0209974_100227482 186
380 3300028381 Ga0268264_10066519 Ga0268264_100665193 186
381 3300031548 Ga0307408_100781470 Ga0307408_1007814701 186
382 3300031901 Ga0307406_10922324 Ga0307406_109223241 186
383 3300031995 Ga0307409_100191294 Ga0307409_1001912941 186
384 3300032005 Ga0307411_11126675 Ga0307411_111266751 186
385 3300034957 Ga0373938_0021927 Ga0373938_0021927_63_623 186
386 3300035090 Ga0373949_0021681 Ga0373949_0021681_254_814 186
387 3300035121 Ga0373960_0110611 Ga0373960_0110611_229_789 186
388 3300035170 Ga0373943_0063196 Ga0373943_0063196_966_1526 186
389 3300035691 Ga0373931_0038925 Ga0373931_0038925_203_763 186
390 3300035692 Ga0373935_0086886 Ga0373935_0086886_850_1410 186
391 3300035695 Ga0373927_0016229 Ga0373927_0016229_2652_3212 186
392 3300035725 Ga0373947_0000526 Ga0373947_0000526_4932_5492 186
393 3300036401 Ga0373937_0216682 Ga0373937_0216682_170_730 186
394 3300037068 Ga0373925_0017928 Ga0373925_0017928_4334_4894 186
395 3300042013 Ga0439456_092791 Ga0439456_092791_33_593 186
396 3300046455 Ga0495603_0001765 Ga0495603_0001765_5322_5882 186
397 3300046461 Ga0495641_0025115 Ga0495641_0025115_2273_2833 186
398 3300046472 Ga0495580_0007608 Ga0495580_0007608_2322_2882 186
399 3300046473 Ga0495582_0003623 Ga0495582_0003623_5683_6243 186
400 3300046475 Ga0495639_0001758 Ga0495639_0001758_5707_6267 186
401 3300046477 Ga0495664_0232673 Ga0495664_0232673_389_967 186
402 3300046499 Ga0495594_0000569 Ga0495594_0000569_13147_13707 186
403 3300046511 Ga0495608_0361500 Ga0495608_0361500_259_819 186
404 3300046514 Ga0495618_0447886 Ga0495618_0447886_191_769 186
405 3300046517 Ga0495630_0222723 Ga0495630_0222723_225_788 186
406 3300046520 Ga0495637_0117934 Ga0495637_0117934_268_828 186
407 3300046526 Ga0495666_0021187 Ga0495666_0021187_2511_3071 186
408 3300046533 Ga0495640_0310595 Ga0495640_0310595_376_954 186
409 3300046538 Ga0495609_0204208 Ga0495609_0204208_110_670 186
410 3300046559 Ga0495667_0152501 Ga0495667_0152501_213_773 186
411 3300046616 Ga0495668_0206745 Ga0495668_0206745_36_599 186
412 3300046642 Ga0495634_0017885 Ga0495634_0017885_4099_4659 186
413 3300046660 Ga0495625_0104593 Ga0495625_0104593_1132_1692 186
414 3300046663 Ga0495635_0037618 Ga0495635_0037618_2615_3175 186
415 3300046664 Ga0495659_0093706 Ga0495659_0093706_432_992 186
416 3300046681 Ga0495647_0007853 Ga0495647_0007853_2393_2953 186
417 3300046683 Ga0495658_0010713 Ga0495658_0010713_2576_3136 186
418 3300046689 Ga0495613_0014993 Ga0495613_0014993_3595_4155 186
419 3300046690 Ga0495624_0032941 Ga0495624_0032941_2406_2966 186
420 3300047321 Ga0495676_0037971 Ga0495676_0037971_846_1406 186
421 3300047322 Ga0495680_0008364 Ga0495680_0008364_594_1154 186
422 3300047322 Ga0495680_0149684 Ga0495680_0149684_920_1498 186
423 3300047444 Ga0495675_0299491 Ga0495675_0299491_27_605 186
424 3300048089 Ga0495614_0006753 Ga0495614_0006753_1032_1592 186
425 3300048903 Ga0496100_0440359 Ga0496100_0440359_410_970 186
426 3300048903 Ga0496100_0650307 Ga0496100_0650307_45_605 186
427 3300048904 Ga0496101_0337197 Ga0496101_0337197_557_1117 186
428 3300048905 Ga0496102_0037218 Ga0496102_0037218_785_1345 186
429 3300048905 Ga0496102_1102462 Ga0496102_1102462_80_640 186
430 3300048907 Ga0496104_0000604 Ga0496104_0000604_2428_3090 186
431 3300048907 Ga0496104_0049381 Ga0496104_0049381_1625_2185 186
432 3300048907 Ga0496104_0057638 Ga0496104_0057638_57_617 186
433 3300048908 Ga0496105_0000132 Ga0496105_0000132_27405_28067 186
434 3300048908 Ga0496105_0001618 Ga0496105_0001618_12621_13199 186
435 3300048908 Ga0496105_0036117 Ga0496105_0036117_1086_1646 186
436 3300048908 Ga0496105_0718580 Ga0496105_0718580_195_755 186
437 3300048911 Ga0496108_0266852 Ga0496108_0266852_274_852 186
438 3300048912 Ga0496109_0836687 Ga0496109_0836687_219_779 186
439 3300048912 Ga0496109_1096035 Ga0496109_1096035_150_710 186
440 3300048913 Ga0496110_0004787 Ga0496110_0004787_5964_6542 186
441 3300048913 Ga0496110_0040100 Ga0496110_0040100_2387_2947 186
442 3300048914 Ga0496111_0025412 Ga0496111_0025412_34_594 186
443 3300048915 Ga0496112_0004042 Ga0496112_0004042_8444_9022 186
444 3300048915 Ga0496112_0501855 Ga0496112_0501855_544_1104 186
445 3300048916 Ga0496113_0387829 Ga0496113_0387829_177_737 186
446 3300048917 Ga0496114_0084706 Ga0496114_0084706_1472_2032 186
447 3300048917 Ga0496114_0514832 Ga0496114_0514832_108_668 186
448 3300048918 Ga0496115_0759646 Ga0496115_0759646_41_619 186
449 3300048922 Ga0496119_0005517 Ga0496119_0005517_9269_9829 186
450 3300048928 Ga0496125_0050432 Ga0496125_0050432_2400_2978 186
451 3300048929 Ga0496126_0670721 Ga0496126_0670721_213_773 186
452 3300049568 Ga0501031_0015973 Ga0501031_0015973_1617_2177 186
453 3300049568 Ga0501031_0056236 Ga0501031_0056236_211_771 186
454 3300049568 Ga0501031_0147877 Ga0501031_0147877_792_1352 186
455 3300049568 Ga0501031_0207761 Ga0501031_0207761_578_1138 186
456 3300049569 Ga0501032_0074934 Ga0501032_0074934_456_1016 186
457 3300049569 Ga0501032_0309942 Ga0501032_0309942_55_615 186
458 3300049569 Ga0501032_0314249 Ga0501032_0314249_349_909 186
459 3300049569 Ga0501032_0415028 Ga0501032_0415028_204_764 186
460 3300049569 Ga0501032_0582371 Ga0501032_0582371_81_641 186
461 3300049569 Ga0501032_0648435 Ga0501032_0648435_88_648 186
462 3300049570 Ga0501033_0044731 Ga0501033_0044731_1120_1680 186
463 3300049571 Ga0501034_0161885 Ga0501034_0161885_755_1315 186
464 3300049571 Ga0501034_0178882 Ga0501034_0178882_924_1484 186
465 3300049572 Ga0501036_0045297 Ga0501036_0045297_2338_2898 186
466 3300049572 Ga0501036_0047831 Ga0501036_0047831_2620_3180 186
467 3300049572 Ga0501036_0065677 Ga0501036_0065677_711_1271 186
468 3300049573 Ga0501037_0048534 Ga0501037_0048534_1378_1938 186
469 3300049573 Ga0501037_0075360 Ga0501037_0075360_169_729 186
470 3300049573 Ga0501037_0204903 Ga0501037_0204903_729_1289 186
471 3300049573 Ga0501037_0214902 Ga0501037_0214902_242_802 186
472 3300049574 Ga0501038_0047290 Ga0501038_0047290_1340_1900 186
473 3300049574 Ga0501038_0098147 Ga0501038_0098147_1314_1874 186
474 3300049574 Ga0501038_0119994 Ga0501038_0119994_194_754 186
475 3300049574 Ga0501038_0173411 Ga0501038_0173411_630_1190 186
476 3300049574 Ga0501038_0193912 Ga0501038_0193912_613_1173 186
477 3300049575 Ga0501039_0016425 Ga0501039_0016425_1451_2011 186
478 3300049575 Ga0501039_0018685 Ga0501039_0018685_3264_3824 186
479 3300049575 Ga0501039_0125605 Ga0501039_0125605_1140_1700 186
480 3300049575 Ga0501039_0727563 Ga0501039_0727563_74_634 186
481 3300049576 Ga0501040_0002823 Ga0501040_0002823_3064_3624 186
482 3300049576 Ga0501040_0033743 Ga0501040_0033743_1701_2261 186
483 3300049576 Ga0501040_0061120 Ga0501040_0061120_717_1277 186
484 3300049576 Ga0501040_0108073 Ga0501040_0108073_275_835 186
485 3300049576 Ga0501040_0159017 Ga0501040_0159017_765_1325 186
486 3300049577 Ga0501041_0011754 Ga0501041_0011754_4611_5171 186
487 3300049577 Ga0501041_0013809 Ga0501041_0013809_2592_3152 186
488 3300049577 Ga0501041_0053592 Ga0501041_0053592_1525_2085 186
489 3300049577 Ga0501041_0237868 Ga0501041_0237868_445_1005 186
490 3300049578 Ga0501042_0265719 Ga0501042_0265719_203_763 186
491 3300049578 Ga0501042_0338580 Ga0501042_0338580_383_943 186
492 3300049579 Ga0501043_0057267 Ga0501043_0057267_328_888 186
493 3300049579 Ga0501043_0109254 Ga0501043_0109254_153_713 186
494 3300049579 Ga0501043_0111488 Ga0501043_0111488_595_1155 186
495 3300049579 Ga0501043_0205162 Ga0501043_0205162_707_1267 186
496 3300049579 Ga0501043_0619828 Ga0501043_0619828_56_616 186
497 3300049580 Ga0501046_0029709 Ga0501046_0029709_3245_3805 186
498 3300049580 Ga0501046_0041897 Ga0501046_0041897_279_839 186
499 3300049580 Ga0501046_0129665 Ga0501046_0129665_74_634 186
500 3300049581 Ga0501047_0064690 Ga0501047_0064690_252_812 186
501 3300049581 Ga0501047_0074681 Ga0501047_0074681_1793_2353 186
502 3300049581 Ga0501047_0591766 Ga0501047_0591766_341_901 186
503 3300049582 Ga0501048_0040036 Ga0501048_0040036_244_804 186
504 3300049582 Ga0501048_0073962 Ga0501048_0073962_775_1335 186
505 3300049582 Ga0501048_0443362 Ga0501048_0443362_243_803 186
506 3300049584 Ga0501068_0022313 Ga0501068_0022313_514_1074 186
507 3300049584 Ga0501068_0067514 Ga0501068_0067514_145_705 186
508 3300049584 Ga0501068_0145346 Ga0501068_0145346_724_1284 186
509 3300049584 Ga0501068_0181535 Ga0501068_0181535_588_1148 186
510 3300049585 Ga0501069_0107833 Ga0501069_0107833_547_1107 186
511 3300049586 Ga0501070_0013195 Ga0501070_0013195_2016_2576 186
512 3300049586 Ga0501070_0081241 Ga0501070_0081241_774_1334 186
513 3300049586 Ga0501070_0446085 Ga0501070_0446085_270_830 186
514 3300049587 Ga0501071_0006779 Ga0501071_0006779_2884_3444 186
515 3300049587 Ga0501071_0039409 Ga0501071_0039409_2540_3100 186
516 3300049587 Ga0501071_0052424 Ga0501071_0052424_1180_1740 186
517 3300049587 Ga0501071_0081679 Ga0501071_0081679_792_1352 186
518 3300049587 Ga0501071_0106938 Ga0501071_0106938_1480_2040 186
519 3300049587 Ga0501071_0114038 Ga0501071_0114038_849_1409 186
520 3300049587 Ga0501071_0242477 Ga0501071_0242477_702_1262 186
521 3300049588 Ga0501072_0003579 Ga0501072_0003579_4506_5066 186
522 3300049588 Ga0501072_0018544 Ga0501072_0018544_1499_2059 186
523 3300049588 Ga0501072_0146530 Ga0501072_0146530_32_637 186
524 3300049588 Ga0501072_0325896 Ga0501072_0325896_637_1197 186
525 3300049588 Ga0501072_0530405 Ga0501072_0530405_98_658 186
526 3300049589 Ga0501073_0239273 Ga0501073_0239273_616_1176 186
527 3300049590 Ga0501074_0024951 Ga0501074_0024951_793_1353 186
528 3300049590 Ga0501074_0072284 Ga0501074_0072284_1173_1733 186
529 3300049591 Ga0501075_0033033 Ga0501075_0033033_2842_3402 186
530 3300049591 Ga0501075_0060350 Ga0501075_0060350_941_1501 186
531 3300049591 Ga0501075_0069371 Ga0501075_0069371_1918_2478 186
532 3300049591 Ga0501075_0132289 Ga0501075_0132289_519_1079 186
533 3300049592 Ga0501076_0010887 Ga0501076_0010887_576_1136 186
534 3300049592 Ga0501076_0027798 Ga0501076_0027798_3022_3582 186
535 3300049592 Ga0501076_0045416 Ga0501076_0045416_1795_2355 186
536 3300049592 Ga0501076_0072069 Ga0501076_0072069_1285_1845 186
537 3300049592 Ga0501076_0204125 Ga0501076_0204125_392_952 186
538 3300049592 Ga0501076_0264888 Ga0501076_0264888_291_851 186
539 3300049593 Ga0501077_0003781 Ga0501077_0003781_4225_4785 186
540 3300049593 Ga0501077_0014463 Ga0501077_0014463_4323_4883 186
541 3300049593 Ga0501077_0016838 Ga0501077_0016838_1333_1893 186
542 3300049593 Ga0501077_0041653 Ga0501077_0041653_1901_2461 186
543 3300049741 Ga0501079_0013945 Ga0501079_0013945_4315_4875 186
544 3300049741 Ga0501079_0016914 Ga0501079_0016914_3747_4352 186
545 3300049741 Ga0501079_0243390 Ga0501079_0243390_118_678 186
546 3300049742 Ga0501080_0064676 Ga0501080_0064676_2700_3260 186
547 3300049742 Ga0501080_1035120 Ga0501080_1035120_85_645 186
548 3300049743 Ga0501081_0001225 Ga0501081_0001225_7485_8045 186
549 3300049743 Ga0501081_0024073 Ga0501081_0024073_3003_3563 186
550 3300049743 Ga0501081_0066641 Ga0501081_0066641_485_1045 186
551 3300049743 Ga0501081_0068052 Ga0501081_0068052_699_1259 186
552 3300049743 Ga0501081_0403929 Ga0501081_0403929_86_646 186
553 3300049744 Ga0501083_0013422 Ga0501083_0013422_4979_5539 186
554 3300049744 Ga0501083_0022280 Ga0501083_0022280_2203_2763 186
555 3300049744 Ga0501083_0097745 Ga0501083_0097745_1042_1602 186
556 3300049744 Ga0501083_0216791 Ga0501083_0216791_591_1151 186
557 3300049744 Ga0501083_0288195 Ga0501083_0288195_474_1034 186
558 3300049822 Ga0501035_0043235 Ga0501035_0043235_642_1202 186
559 3300049822 Ga0501035_0044668 Ga0501035_0044668_272_832 186
560 3300049822 Ga0501035_0114738 Ga0501035_0114738_412_972 186
561 3300049822 Ga0501035_0234018 Ga0501035_0234018_824_1384 186
562 3300049823 Ga0501044_0065512 Ga0501044_0065512_867_1427 186
563 3300049823 Ga0501044_0081989 Ga0501044_0081989_2092_2652 186
564 3300049824 Ga0501045_0003878 Ga0501045_0003878_1783_2343 186
565 3300049824 Ga0501045_0018012 Ga0501045_0018012_3625_4185 186
566 3300049824 Ga0501045_0057144 Ga0501045_0057144_279_839 186
567 3300049824 Ga0501045_0896782 Ga0501045_0896782_16_576 186
568 3300050509 nmdc:mga0qj67_642713_c1 nmdc:mga0qj67_642713_c1_109_669 186
569 3300050511 nmdc:mga08y16_61416_c1 nmdc:mga08y16_61416_c1_2059_2619 186
570 3300050512 nmdc:mga0n895_256121_c1 nmdc:mga0n895_256121_c1_1206_1766 186
571 3300050515 nmdc:mga0a205_36738_c1 nmdc:mga0a205_36738_c1_3074_3634 186
572 3300053083 Ga0495655_0132288 Ga0495655_0132288_40_600 186
573 3300053085 Ga0495619_0001221 Ga0495619_0001221_14710_15270 186
574 3300053085 Ga0495619_0180870 Ga0495619_0180870_149_727 186
575 3300053088 Ga0500644_0157867 Ga0500644_0157867_164_727 186
576 3300054114 Ga0501084_0090135 Ga0501084_0090135_201_761 186
577 3300054114 Ga0501084_0190632 Ga0501084_0190632_665_1225 186
578 3300054114 Ga0501084_0392923 Ga0501084_0392923_100_660 186
579 3300060353 Ga0501082_0006604 Ga0501082_0006604_8215_8775 186
580 3300060353 Ga0501082_0056485 Ga0501082_0056485_1003_1563 186
581 3300060353 Ga0501082_0276894 Ga0501082_0276894_232_792 186
582 3300060353 Ga0501082_1165599 Ga0501082_1165599_98_658 186
583 3300061734 Ga0530510_0003947 Ga0530510_0003947_7666_8226 186
584 3300061734 Ga0530510_0139876 Ga0530510_0139876_935_1495 186
585 3300061734 Ga0530510_0260967 Ga0530510_0260967_522_1082 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01106

NifU

NifU-like domain

152

218

0.99

PF08712

Nfu_N

Scaffold protein Nfu/NifU N terminal

37

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ltm-assembly1.cif.gz_A solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b 0.9628 1 92
2m5o-assembly1.cif.gz_A solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c 0.8474 95 183
2jnv-assembly1.cif.gz_A solution structure of c-terminal domain of nifu-like protein from oryza sativa 0.838 113 183
4rvn-assembly2.cif.gz_D crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution 0.8366 143 183
2ffm-assembly1.cif.gz_A x-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18. 0.8319 1 81
ID Description Score Start End Superfamily
af_Q54MZ7_83_193_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9801 2 92 3.30.1370.70
2m5oA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9727 113 183 3.30.300.130
af_Q4DZR1_314_387_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9726 110 181 3.30.300.130
af_Q59N44_19_128_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9707 2 93 3.30.1370.70
af_Q4DVM2_55_159_3.30.1370.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain 0.9636 2 93 3.30.1370.70
ID Description Score Start End GO Terms
AF-A0A3S2Q8G2-F1-model_v4 deleted 0.9999 102 183
AF-A0A3D2F7G1-F1-model_v4 NifU family protein 0.9995 112 183 GO:0005506
GO:0016226
GO:0051536
AF-A0A7X6EQG8-F1-model_v4 deleted 0.9982 1 85
AF-A0A833G2M5-F1-model_v4 NifU family protein 0.9982 118 183 GO:0005506
GO:0016226
GO:0051536
AF-A0A0C2WQN0-F1-model_v4 NIF system FeS cluster assembly NifU C-terminal domain-containing protein 0.9967 115 183 GO:0005506
GO:0005739
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
92.6 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map