F466493
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 302 | 585 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0000604|Ga0496104_0000604_2428_3090 |
| Length | 220 |
| Sequence | LRREGQSGLFIAAPEDYLLFIPSPALNRMISEACMFIQTESTPNPATLKFLPGGPVLENGSRDMPSVEDAKVSPLASALFTIEGVSGVFLGPDFISVTKSSGEWQHLKPAILGTIMEHFMSGGPILSPDAAEPDARHQEFFAPEHAETVVAIKELLENQVRPAVASDGGDIVFRGFKDGVVYLHMKGACSGCPSSTATLKRGIQNLLCHFLPDVKSVEQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 82 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 96 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 148 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 151 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 162 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 163 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 189 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.09 |
| Metatranscriptomes | 2.91 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 7.18 |
| Rhizosphere | 90.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10033212 | 3300002244 | Bacteria | 906 |
| 2 | Ga0058860_12142977 | 3300004801 | Bacteria | 709 |
| 3 | Ga0070683_100092767 | 3300005329 | Bacteria | 2836 |
| 4 | Ga0070690_100099288 | 3300005330 | Bacteria | 1928 |
| 5 | Ga0070670_100071032 | 3300005331 | Bacteria | 2989 |
| 6 | Ga0070666_10423636 | 3300005335 | Bacteria | 959 |
| 7 | Ga0070680_100027016 | 3300005336 | Bacteria | 4595 |
| 8 | Ga0070680_100196424 | 3300005336 | Bacteria | 1701 |
| 9 | Ga0070680_101118606 | 3300005336 | Bacteria | 681 |
| 10 | Ga0070682_100059360 | 3300005337 | Bacteria | 2416 |
| 11 | Ga0068868_100419097 | 3300005338 | Bacteria | 1159 |
| 12 | Ga0068868_100465471 | 3300005338 | Bacteria | 1102 |
| 13 | Ga0068868_100684949 | 3300005338 | Bacteria | 916 |
| 14 | Ga0070691_10069787 | 3300005341 | Bacteria | 1704 |
| 15 | Ga0070692_10188542 | 3300005345 | Bacteria | 1200 |
| 16 | Ga0070668_100009939 | 3300005347 | Bacteria | 7048 |
| 17 | Ga0070669_100429563 | 3300005353 | Bacteria | 1085 |
| 18 | Ga0070671_100489895 | 3300005355 | Bacteria | 1057 |
| 19 | Ga0070688_100212269 | 3300005365 | Bacteria | 1360 |
| 20 | Ga0070659_100221370 | 3300005366 | Bacteria | 1562 |
| 21 | Ga0070659_100294522 | 3300005366 | Bacteria | 1352 |
| 22 | Ga0070667_100025204 | 3300005367 | Bacteria | 4943 |
| 23 | Ga0070667_100421644 | 3300005367 | Bacteria | 1216 |
| 24 | Ga0070703_10003324 | 3300005406 | Bacteria | 4587 |
| 25 | Ga0070703_10029443 | 3300005406 | Bacteria | 1648 |
| 26 | Ga0070709_10034824 | 3300005434 | Bacteria | 3056 |
| 27 | Ga0070709_10127644 | 3300005434 | Bacteria | 1732 |
| 28 | Ga0070714_100012825 | 3300005435 | Bacteria | 6698 |
| 29 | Ga0070701_10021326 | 3300005438 | Bacteria | 3089 |
| 30 | Ga0070705_100000427 | 3300005440 | Bacteria | 24212 |
| 31 | Ga0070700_100002813 | 3300005441 | Bacteria | 8923 |
| 32 | Ga0070700_100278443 | 3300005441 | Bacteria | 1212 |
| 33 | Ga0070700_100543961 | 3300005441 | Bacteria | 901 |
| 34 | Ga0070694_100017214 | 3300005444 | Bacteria | 4564 |
| 35 | Ga0070694_100026501 | 3300005444 | Bacteria | 3757 |
| 36 | Ga0070708_100128672 | 3300005445 | Bacteria | 2342 |
| 37 | Ga0070663_100054771 | 3300005455 | Bacteria | 2852 |
| 38 | Ga0070678_100083070 | 3300005456 | Bacteria | 2434 |
| 39 | Ga0070681_10020054 | 3300005458 | Bacteria | 6698 |
| 40 | Ga0068867_100388729 | 3300005459 | Bacteria | 1174 |
| 41 | Ga0068867_100831630 | 3300005459 | Bacteria | 826 |
| 42 | Ga0068867_101041423 | 3300005459 | Bacteria | 744 |
| 43 | Ga0070699_100059429 | 3300005518 | Bacteria | 3311 |
| 44 | Ga0070679_100063548 | 3300005530 | Bacteria | 3679 |
| 45 | Ga0070684_100260037 | 3300005535 | Bacteria | 1588 |
| 46 | Ga0070684_101102611 | 3300005535 | Bacteria | 746 |
| 47 | Ga0070697_100170871 | 3300005536 | Bacteria | 1840 |
| 48 | Ga0068853_100340218 | 3300005539 | Bacteria | 1394 |
| 49 | Ga0070695_100004704 | 3300005545 | Bacteria | 8031 |
| 50 | Ga0070695_100185385 | 3300005545 | Bacteria | 1477 |
| 51 | Ga0070696_100029690 | 3300005546 | Bacteria | 3740 |
| 52 | Ga0070693_100004150 | 3300005547 | Bacteria | 6830 |
| 53 | Ga0070704_100025023 | 3300005549 | Bacteria | 3925 |
| 54 | Ga0070704_100032866 | 3300005549 | Bacteria | 3503 |
| 55 | Ga0070704_100373503 | 3300005549 | Bacteria | 1209 |
| 56 | Ga0068855_100116551 | 3300005563 | Bacteria | 3061 |
| 57 | Ga0070664_101183177 | 3300005564 | Bacteria | 721 |
| 58 | Ga0068857_100049678 | 3300005577 | Bacteria | 3721 |
| 59 | Ga0068857_100075950 | 3300005577 | Bacteria | 2995 |
| 60 | Ga0068854_100035896 | 3300005578 | Bacteria | 3473 |
| 61 | Ga0068859_100001914 | 3300005617 | Bacteria | 21237 |
| 62 | Ga0068859_100088096 | 3300005617 | Bacteria | 3153 |
| 63 | Ga0068859_101271702 | 3300005617 | Bacteria | 811 |
| 64 | Ga0068864_100031959 | 3300005618 | Bacteria | 4469 |
| 65 | Ga0068864_100122993 | 3300005618 | Bacteria | 2322 |
| 66 | Ga0068861_100207844 | 3300005719 | Bacteria | 1647 |
| 67 | Ga0068861_100295139 | 3300005719 | Bacteria | 1401 |
| 68 | Ga0068861_100300315 | 3300005719 | Bacteria | 1390 |
| 69 | Ga0068861_100356974 | 3300005719 | Bacteria | 1284 |
| 70 | Ga0068863_100041278 | 3300005841 | Bacteria | 4386 |
| 71 | Ga0068863_100656824 | 3300005841 | Bacteria | 1040 |
| 72 | Ga0068858_100492058 | 3300005842 | Bacteria | 1184 |
| 73 | Ga0068858_100641361 | 3300005842 | Bacteria | 1032 |
| 74 | Ga0068860_100046332 | 3300005843 | Bacteria | 4146 |
| 75 | Ga0068860_100055488 | 3300005843 | Bacteria | 3767 |
| 76 | Ga0068862_100047782 | 3300005844 | Bacteria | 3653 |
| 77 | Ga0068862_100263674 | 3300005844 | Bacteria | 1574 |
| 78 | Ga0081455_10001595 | 3300005937 | Bacteria | 27705 |
| 79 | Ga0081540_1002918 | 3300005983 | Bacteria | 13763 |
| 80 | Ga0081539_10087706 | 3300005985 | Bacteria | 1616 |
| 81 | Ga0075365_10404486 | 3300006038 | Bacteria | 963 |
| 82 | Ga0075365_10432964 | 3300006038 | Bacteria | 929 |
| 83 | Ga0075363_100020834 | 3300006048 | Bacteria | 3293 |
| 84 | Ga0070715_10114509 | 3300006163 | Bacteria | 1277 |
| 85 | Ga0070712_100677485 | 3300006175 | Bacteria | 878 |
| 86 | Ga0075370_10052509 | 3300006353 | Bacteria | 2313 |
| 87 | Ga0075428_100260089 | 3300006844 | Bacteria | 1869 |
| 88 | Ga0075428_100268461 | 3300006844 | Bacteria | 1836 |
| 89 | Ga0075430_100040569 | 3300006846 | Bacteria | 3940 |
| 90 | Ga0075431_100031680 | 3300006847 | Bacteria | 5446 |
| 91 | Ga0075433_10000150 | 3300006852 | Bacteria | 37277 |
| 92 | Ga0075433_10192144 | 3300006852 | Bacteria | 1816 |
| 93 | Ga0075434_100002118 | 3300006871 | Bacteria | 17265 |
| 94 | Ga0075434_100035347 | 3300006871 | Bacteria | 4940 |
| 95 | Ga0068865_100120057 | 3300006881 | Bacteria | 1953 |
| 96 | Ga0097620_100001914 | 3300006931 | Bacteria | 21237 |
| 97 | Ga0097620_100088091 | 3300006931 | Bacteria | 3153 |
| 98 | Ga0097620_101271635 | 3300006931 | Bacteria | 811 |
| 99 | Ga0075435_100022930 | 3300007076 | Bacteria | 4819 |
| 100 | Ga0099794_10025198 | 3300007265 | Bacteria | 2737 |
| 101 | Ga0099795_10041163 | 3300007788 | Bacteria | 1644 |
| 102 | Ga0105250_10134442 | 3300009092 | Bacteria | 1022 |
| 103 | Ga0105240_10117882 | 3300009093 | Bacteria | 3200 |
| 104 | Ga0111539_10003908 | 3300009094 | Bacteria | 19597 |
| 105 | Ga0111539_10033514 | 3300009094 | Bacteria | 6236 |
| 106 | Ga0111539_10058388 | 3300009094 | Bacteria | 4577 |
| 107 | Ga0111539_10279852 | 3300009094 | Bacteria | 1941 |
| 108 | Ga0105245_10057667 | 3300009098 | Bacteria | 3493 |
| 109 | Ga0105245_10596627 | 3300009098 | Bacteria | 1130 |
| 110 | Ga0105247_10008332 | 3300009101 | Bacteria | 6323 |
| 111 | Ga0114129_10057811 | 3300009147 | Bacteria | 5426 |
| 112 | Ga0114129_10414064 | 3300009147 | Bacteria | 1774 |
| 113 | Ga0114129_11210630 | 3300009147 | Bacteria | 940 |
| 114 | Ga0105243_10059012 | 3300009148 | Bacteria | 3060 |
| 115 | Ga0105243_10080683 | 3300009148 | Bacteria | 2654 |
| 116 | Ga0105242_11234092 | 3300009176 | Bacteria | 768 |
| 117 | Ga0105248_10180829 | 3300009177 | Bacteria | 2376 |
| 118 | Ga0105248_10482465 | 3300009177 | Bacteria | 1397 |
| 119 | Ga0105249_10006173 | 3300009553 | Bacteria | 10397 |
| 120 | Ga0105249_10835081 | 3300009553 | Bacteria | 986 |
| 121 | Ga0099796_10102444 | 3300010159 | Bacteria | 1079 |
| 122 | Ga0105239_10012676 | 3300010375 | Bacteria | 9380 |
| 123 | Ga0105239_10312975 | 3300010375 | Bacteria | 1770 |
| 124 | Ga0105246_10307679 | 3300011119 | Bacteria | 1282 |
| 125 | Ga0105246_10361220 | 3300011119 | Bacteria | 1193 |
| 126 | Ga0105246_10455011 | 3300011119 | Bacteria | 1077 |
| 127 | Ga0105246_10680369 | 3300011119 | Bacteria | 899 |
| 128 | Ga0157341_1006900 | 3300012494 | Bacteria | 890 |
| 129 | Ga0157342_1005900 | 3300012507 | Bacteria | 1141 |
| 130 | Ga0157370_10313437 | 3300013104 | Bacteria | 1447 |
| 131 | Ga0157374_10740647 | 3300013296 | Eukaryota | 997 |
| 132 | Ga0163162_10115057 | 3300013306 | Bacteria | 2789 |
| 133 | Ga0157372_10017628 | 3300013307 | Eukaryota | 7664 |
| 134 | Ga0157372_11095122 | 3300013307 | Bacteria | 922 |
| 135 | Ga0157375_10027698 | 3300013308 | Bacteria | 5301 |
| 136 | Ga0157375_10264513 | 3300013308 | Bacteria | 1881 |
| 137 | Ga0163163_10048919 | 3300014325 | Bacteria | 4160 |
| 138 | Ga0157380_10007714 | 3300014326 | Bacteria | 7657 |
| 139 | Ga0157380_10203842 | 3300014326 | Bacteria | 1757 |
| 140 | Ga0182008_10131340 | 3300014497 | Bacteria | 1248 |
| 141 | Ga0157379_10119206 | 3300014968 | Bacteria | 2374 |
| 142 | Ga0157379_10667469 | 3300014968 | Bacteria | 974 |
| 143 | Ga0157376_10357844 | 3300014969 | Bacteria | 1399 |
| 144 | Ga0163161_10295416 | 3300017792 | Bacteria | 1275 |
| 145 | Ga0163161_10435914 | 3300017792 | Bacteria | 1057 |
| 146 | Ga0206356_11534066 | 3300020070 | Bacteria | 1114 |
| 147 | Ga0206355_1452686 | 3300020076 | Bacteria | 884 |
| 148 | Ga0206352_11101380 | 3300020078 | Bacteria | 1230 |
| 149 | Ga0206353_11194519 | 3300020082 | Bacteria | 1587 |
| 150 | Ga0206353_11592444 | 3300020082 | Bacteria | 748 |
| 151 | Ga0224712_10240290 | 3300022467 | Bacteria | 834 |
| 152 | Ga0207653_10000631 | 3300025885 | Bacteria | 12123 |
| 153 | Ga0207692_10377362 | 3300025898 | Bacteria | 879 |
| 154 | Ga0207642_10326661 | 3300025899 | Bacteria | 897 |
| 155 | Ga0207710_10079885 | 3300025900 | Bacteria | 1515 |
| 156 | Ga0207699_10123355 | 3300025906 | Bacteria | 1679 |
| 157 | Ga0207645_10285035 | 3300025907 | Bacteria | 1097 |
| 158 | Ga0207645_10622737 | 3300025907 | Bacteria | 733 |
| 159 | Ga0207707_10141612 | 3300025912 | Bacteria | 2102 |
| 160 | Ga0207695_10478271 | 3300025913 | Bacteria | 1128 |
| 161 | Ga0207693_10004273 | 3300025915 | Bacteria | 12116 |
| 162 | Ga0207693_10578233 | 3300025915 | Bacteria | 875 |
| 163 | Ga0207660_10275089 | 3300025917 | Bacteria | 1335 |
| 164 | Ga0207681_10055329 | 3300025923 | Bacteria | 2702 |
| 165 | Ga0207681_10489942 | 3300025923 | Bacteria | 1005 |
| 166 | Ga0207694_10599782 | 3300025924 | Bacteria | 926 |
| 167 | Ga0207650_10046419 | 3300025925 | Bacteria | 3199 |
| 168 | Ga0207664_10101638 | 3300025929 | Bacteria | 2376 |
| 169 | Ga0207664_10130698 | 3300025929 | Bacteria | 2113 |
| 170 | Ga0207644_10250096 | 3300025931 | Bacteria | 1414 |
| 171 | Ga0207690_10386696 | 3300025932 | Bacteria | 1113 |
| 172 | Ga0207709_10221030 | 3300025935 | Bacteria | 1366 |
| 173 | Ga0207709_10315818 | 3300025935 | Bacteria | 1167 |
| 174 | Ga0207709_10855492 | 3300025935 | Bacteria | 737 |
| 175 | Ga0207669_10107533 | 3300025937 | Bacteria | 1861 |
| 176 | Ga0207704_10322339 | 3300025938 | Bacteria | 1192 |
| 177 | Ga0207665_10052047 | 3300025939 | Bacteria | 2758 |
| 178 | Ga0207691_10008893 | 3300025940 | Bacteria | 9642 |
| 179 | Ga0207711_10347328 | 3300025941 | Bacteria | 1373 |
| 180 | Ga0207711_10899970 | 3300025941 | Bacteria | 823 |
| 181 | Ga0207689_10133770 | 3300025942 | Bacteria | 2041 |
| 182 | Ga0207661_10215818 | 3300025944 | Bacteria | 1693 |
| 183 | Ga0207712_10002132 | 3300025961 | Bacteria | 12932 |
| 184 | Ga0207712_10359262 | 3300025961 | Bacteria | 1213 |
| 185 | Ga0207668_10004553 | 3300025972 | Bacteria | 8156 |
| 186 | Ga0207668_10028368 | 3300025972 | Bacteria | 3660 |
| 187 | Ga0207668_10351450 | 3300025972 | Bacteria | 1233 |
| 188 | Ga0207640_10298176 | 3300025981 | Bacteria | 1274 |
| 189 | Ga0207658_10493671 | 3300025986 | Bacteria | 1089 |
| 190 | Ga0207677_10392464 | 3300026023 | Bacteria | 1175 |
| 191 | Ga0207677_10765587 | 3300026023 | Bacteria | 862 |
| 192 | Ga0207703_10272229 | 3300026035 | Bacteria | 1534 |
| 193 | Ga0207703_10828746 | 3300026035 | Bacteria | 884 |
| 194 | Ga0207639_10250301 | 3300026041 | Bacteria | 1545 |
| 195 | Ga0207678_10031190 | 3300026067 | Bacteria | 4650 |
| 196 | Ga0207708_10007125 | 3300026075 | Bacteria | 8263 |
| 197 | Ga0207708_10081805 | 3300026075 | Bacteria | 2482 |
| 198 | Ga0207708_10251638 | 3300026075 | Bacteria | 1424 |
| 199 | Ga0207708_10349141 | 3300026075 | Bacteria | 1213 |
| 200 | Ga0207708_11025579 | 3300026075 | Bacteria | 717 |
| 201 | Ga0207702_10039530 | 3300026078 | Bacteria | 3953 |
| 202 | Ga0207641_10096129 | 3300026088 | Bacteria | 2601 |
| 203 | Ga0207641_10170614 | 3300026088 | Bacteria | 1985 |
| 204 | Ga0207648_10165779 | 3300026089 | Bacteria | 1952 |
| 205 | Ga0207648_10186433 | 3300026089 | Bacteria | 1838 |
| 206 | Ga0207676_10059277 | 3300026095 | Bacteria | 3022 |
| 207 | Ga0207674_10093506 | 3300026116 | Bacteria | 2995 |
| 208 | Ga0207674_10446173 | 3300026116 | Bacteria | 1250 |
| 209 | Ga0207675_100027412 | 3300026118 | Bacteria | 5306 |
| 210 | Ga0207675_100099440 | 3300026118 | Bacteria | 2740 |
| 211 | Ga0207675_100151694 | 3300026118 | Bacteria | 2206 |
| 212 | Ga0207675_100223009 | 3300026118 | Bacteria | 1817 |
| 213 | Ga0207675_100266573 | 3300026118 | Bacteria | 1661 |
| 214 | Ga0207675_101544140 | 3300026118 | Bacteria | 684 |
| 215 | Ga0207683_11484418 | 3300026121 | Bacteria | 626 |
| 216 | Ga0207698_10063130 | 3300026142 | Bacteria | 2897 |
| 217 | Ga0209179_1043289 | 3300027512 | Bacteria | 952 |
| 218 | Ga0209588_1037538 | 3300027671 | Bacteria | 1559 |
| 219 | Ga0209974_10022748 | 3300027876 | Bacteria | 2076 |
| 220 | Ga0207428_10056772 | 3300027907 | Bacteria | 3110 |
| 221 | Ga0207428_10307965 | 3300027907 | Bacteria | 1171 |
| 222 | Ga0268266_10785094 | 3300028379 | Bacteria | 920 |
| 223 | Ga0268265_10007612 | 3300028380 | Bacteria | 7306 |
| 224 | Ga0268265_10281366 | 3300028380 | Bacteria | 1488 |
| 225 | Ga0268264_10018306 | 3300028381 | Bacteria | 5728 |
| 226 | Ga0268264_10066519 | 3300028381 | Bacteria | 3039 |
| 227 | Ga0268264_10317754 | 3300028381 | Bacteria | 1471 |
| 228 | Ga0307515_10527144 | 3300028794 | Bacteria | 791 |
| 229 | Ga0265331_10007887 | 3300031250 | Bacteria | 6104 |
| 230 | Ga0307408_100781470 | 3300031548 | Bacteria | 865 |
| 231 | Ga0316575_10104976 | 3300031665 | Bacteria | 1150 |
| 232 | Ga0316575_10177277 | 3300031665 | Bacteria | 884 |
| 233 | Ga0316579_10038651 | 3300031691 | Bacteria | 2207 |
| 234 | Ga0265314_10082530 | 3300031711 | Bacteria | 2114 |
| 235 | Ga0316576_10256736 | 3300031727 | Bacteria | 1311 |
| 236 | Ga0316576_10308249 | 3300031727 | Bacteria | 1182 |
| 237 | Ga0307405_10664587 | 3300031731 | Bacteria | 859 |
| 238 | Ga0316577_10313979 | 3300031733 | Bacteria | 888 |
| 239 | Ga0307410_11015312 | 3300031852 | Bacteria | 716 |
| 240 | Ga0307406_10922324 | 3300031901 | Bacteria | 745 |
| 241 | Ga0307407_10077389 | 3300031903 | Bacteria | 2001 |
| 242 | Ga0307409_100191294 | 3300031995 | Bacteria | 1822 |
| 243 | Ga0307411_10765261 | 3300032005 | Bacteria | 847 |
| 244 | Ga0307411_11126675 | 3300032005 | Bacteria | 708 |
| 245 | Ga0316583_10002462 | 3300032133 | Bacteria | 6429 |
| 246 | Ga0316585_10032885 | 3300032137 | Bacteria | 1634 |
| 247 | Ga0316588_1105129 | 3300033528 | Bacteria | 708 |
| 248 | Ga0316587_1009123 | 3300033529 | Bacteria | 1570 |
| 249 | Ga0373959_0041208 | 3300034820 | Bacteria | 969 |
| 250 | Ga0373938_0021927 | 3300034957 | Bacteria | 1300 |
| 251 | Ga0373928_0020631 | 3300035084 | Bacteria | 1383 |
| 252 | Ga0373949_0021681 | 3300035090 | Bacteria | 1476 |
| 253 | Ga0373932_0017521 | 3300035112 | Bacteria | 1840 |
| 254 | Ga0373939_0005250 | 3300035114 | Bacteria | 3080 |
| 255 | Ga0373939_0009445 | 3300035114 | Bacteria | 2418 |
| 256 | Ga0373941_0016896 | 3300035115 | Bacteria | 1991 |
| 257 | Ga0373941_0167521 | 3300035115 | Bacteria | 817 |
| 258 | Ga0373960_0087699 | 3300035121 | Bacteria | 990 |
| 259 | Ga0373960_0110611 | 3300035121 | Bacteria | 901 |
| 260 | Ga0373943_0063196 | 3300035170 | Bacteria | 1855 |
| 261 | Ga0373942_0016883 | 3300035207 | Bacteria | 1795 |
| 262 | Ga0373962_0013944 | 3300035242 | Bacteria | 2042 |
| 263 | Ga0373962_0020488 | 3300035242 | Bacteria | 1737 |
| 264 | Ga0316574_0253326 | 3300035398 | Bacteria | 1124 |
| 265 | Ga0373924_0171808 | 3300035410 | Bacteria | 953 |
| 266 | Ga0373931_0000951 | 3300035691 | Bacteria | 12183 |
| 267 | Ga0373931_0014099 | 3300035691 | Bacteria | 3902 |
| 268 | Ga0373931_0038925 | 3300035691 | Bacteria | 2490 |
| 269 | Ga0373931_0227711 | 3300035691 | Bacteria | 1125 |
| 270 | Ga0373935_0086886 | 3300035692 | Bacteria | 2041 |
| 271 | Ga0373927_0016229 | 3300035695 | Bacteria | 4914 |
| 272 | Ga0373927_0053183 | 3300035695 | Bacteria | 2619 |
| 273 | Ga0373927_0382013 | 3300035695 | Bacteria | 929 |
| 274 | Ga0373947_0000526 | 3300035725 | Bacteria | 22356 |
| 275 | Ga0373937_0216682 | 3300036401 | Bacteria | 1802 |
| 276 | Ga0316582_0233004 | 3300036647 | Bacteria | 1260 |
| 277 | Ga0316582_0243369 | 3300036647 | Bacteria | 1232 |
| 278 | Ga0316584_0622372 | 3300036712 | Bacteria | 746 |
| 279 | Ga0373925_0017928 | 3300037068 | Bacteria | 5139 |
| 280 | Ga0316581_0002304 | 3300037588 | Bacteria | 4532 |
| 281 | Ga0436364_0574354 | 3300037853 | Bacteria | 3151 |
| 282 | Ga0439456_092791 | 3300042013 | Bacteria | 680 |
| 283 | Ga0439435_0025306 | 3300042436 | Bacteria | 1573 |
| 284 | Ga0466967_0568650 | 3300045976 | Bacteria | 1117 |
| 285 | Ga0495603_0001765 | 3300046455 | Bacteria | 12743 |
| 286 | Ga0495629_0168672 | 3300046459 | Bacteria | 1520 |
| 287 | Ga0495641_0025115 | 3300046461 | Bacteria | 2927 |
| 288 | Ga0495651_0149179 | 3300046462 | Bacteria | 1688 |
| 289 | Ga0495580_0007608 | 3300046472 | Bacteria | 8693 |
| 290 | Ga0495580_0394589 | 3300046472 | Bacteria | 934 |
| 291 | Ga0495582_0003623 | 3300046473 | Bacteria | 8698 |
| 292 | Ga0495639_0001758 | 3300046475 | Bacteria | 9612 |
| 293 | Ga0495664_0232673 | 3300046477 | Bacteria | 1115 |
| 294 | Ga0495594_0000569 | 3300046499 | Bacteria | 18955 |
| 295 | Ga0495608_0361500 | 3300046511 | Bacteria | 892 |
| 296 | Ga0495618_0447886 | 3300046514 | Bacteria | 784 |
| 297 | Ga0495630_0222723 | 3300046517 | Bacteria | 1440 |
| 298 | Ga0495637_0117934 | 3300046520 | Bacteria | 1024 |
| 299 | Ga0495666_0021187 | 3300046526 | Bacteria | 3218 |
| 300 | Ga0495652_0118734 | 3300046529 | Bacteria | 2113 |
| 301 | Ga0495640_0310595 | 3300046533 | Bacteria | 978 |
| 302 | Ga0495640_0474783 | 3300046533 | Bacteria | 762 |
| 303 | Ga0495609_0204208 | 3300046538 | Bacteria | 825 |
| 304 | Ga0495667_0152501 | 3300046559 | Bacteria | 1487 |
| 305 | Ga0495667_0192738 | 3300046559 | Bacteria | 1306 |
| 306 | Ga0495668_0206745 | 3300046616 | Bacteria | 1075 |
| 307 | Ga0495634_0017885 | 3300046642 | Bacteria | 5052 |
| 308 | Ga0495625_0104593 | 3300046660 | Bacteria | 1941 |
| 309 | Ga0495635_0037618 | 3300046663 | Bacteria | 3350 |
| 310 | Ga0495659_0093706 | 3300046664 | Bacteria | 1156 |
| 311 | Ga0495647_0007853 | 3300046681 | Bacteria | 3582 |
| 312 | Ga0495658_0010713 | 3300046683 | Bacteria | 4590 |
| 313 | Ga0495613_0014993 | 3300046689 | Bacteria | 5752 |
| 314 | Ga0495624_0032941 | 3300046690 | Bacteria | 3358 |
| 315 | Ga0495604_0219644 | 3300047317 | Bacteria | 1309 |
| 316 | Ga0495636_0052293 | 3300047318 | Bacteria | 1713 |
| 317 | Ga0495676_0037971 | 3300047321 | Bacteria | 4004 |
| 318 | Ga0495680_0008364 | 3300047322 | Bacteria | 9409 |
| 319 | Ga0495680_0149684 | 3300047322 | Bacteria | 1703 |
| 320 | Ga0495675_0299491 | 3300047444 | Bacteria | 955 |
| 321 | Ga0495675_0504691 | 3300047444 | Bacteria | 694 |
| 322 | Ga0495602_0113278 | 3300048088 | Bacteria | 2199 |
| 323 | Ga0495614_0006753 | 3300048089 | Bacteria | 5135 |
| 324 | Ga0496100_0440359 | 3300048903 | Bacteria | 998 |
| 325 | Ga0496100_0650307 | 3300048903 | Bacteria | 821 |
| 326 | Ga0496101_0337197 | 3300048904 | Bacteria | 1184 |
| 327 | Ga0496102_0037218 | 3300048905 | Bacteria | 4388 |
| 328 | Ga0496102_0159345 | 3300048905 | Bacteria | 2122 |
| 329 | Ga0496102_0227949 | 3300048905 | Bacteria | 1757 |
| 330 | Ga0496102_0884741 | 3300048905 | Bacteria | 815 |
| 331 | Ga0496102_1102462 | 3300048905 | Bacteria | 714 |
| 332 | Ga0496102_1250597 | 3300048905 | Bacteria | 662 |
| 333 | Ga0496103_0064387 | 3300048906 | Bacteria | 2285 |
| 334 | Ga0496103_0198957 | 3300048906 | Bacteria | 1289 |
| 335 | Ga0496104_0000604 | 3300048907 | Bacteria | 30841 |
| 336 | Ga0496104_0049381 | 3300048907 | Bacteria | 3968 |
| 337 | Ga0496104_0057638 | 3300048907 | Bacteria | 3675 |
| 338 | Ga0496105_0000132 | 3300048908 | Bacteria | 50105 |
| 339 | Ga0496105_0001618 | 3300048908 | Bacteria | 15993 |
| 340 | Ga0496105_0036117 | 3300048908 | Bacteria | 4070 |
| 341 | Ga0496105_0718580 | 3300048908 | Bacteria | 765 |
| 342 | Ga0496106_0021711 | 3300048909 | Bacteria | 4767 |
| 343 | Ga0496107_0119810 | 3300048910 | Bacteria | 1938 |
| 344 | Ga0496107_0321122 | 3300048910 | Bacteria | 1152 |
| 345 | Ga0496107_0582589 | 3300048910 | Bacteria | 828 |
| 346 | Ga0496108_0266852 | 3300048911 | Bacteria | 1490 |
| 347 | Ga0496108_0411241 | 3300048911 | Bacteria | 1182 |
| 348 | Ga0496109_0328391 | 3300048912 | Bacteria | 1444 |
| 349 | Ga0496109_0836687 | 3300048912 | Bacteria | 858 |
| 350 | Ga0496109_1096035 | 3300048912 | Bacteria | 733 |
| 351 | Ga0496110_0004787 | 3300048913 | Bacteria | 10541 |
| 352 | Ga0496110_0021047 | 3300048913 | Bacteria | 5513 |
| 353 | Ga0496110_0040100 | 3300048913 | Bacteria | 4081 |
| 354 | Ga0496111_0019160 | 3300048914 | Bacteria | 4748 |
| 355 | Ga0496111_0025412 | 3300048914 | Bacteria | 4179 |
| 356 | Ga0496112_0004042 | 3300048915 | Bacteria | 12307 |
| 357 | Ga0496112_0242141 | 3300048915 | Bacteria | 1756 |
| 358 | Ga0496112_0501855 | 3300048915 | Bacteria | 1149 |
| 359 | Ga0496113_0387829 | 3300048916 | Bacteria | 1121 |
| 360 | Ga0496113_0909090 | 3300048916 | Bacteria | 696 |
| 361 | Ga0496114_0084706 | 3300048917 | Bacteria | 2684 |
| 362 | Ga0496114_0514263 | 3300048917 | Bacteria | 1059 |
| 363 | Ga0496114_0514832 | 3300048917 | Bacteria | 1058 |
| 364 | Ga0496115_0003665 | 3300048918 | Bacteria | 11054 |
| 365 | Ga0496115_0759646 | 3300048918 | Unclassified | 757 |
| 366 | Ga0496119_0005517 | 3300048922 | Bacteria | 12070 |
| 367 | Ga0496125_0050432 | 3300048928 | Bacteria | 3446 |
| 368 | Ga0496126_0670721 | 3300048929 | Bacteria | 809 |
| 369 | Ga0501031_0015973 | 3300049568 | Bacteria | 4874 |
| 370 | Ga0501031_0056236 | 3300049568 | Bacteria | 2563 |
| 371 | Ga0501031_0147877 | 3300049568 | Bacteria | 1535 |
| 372 | Ga0501031_0207761 | 3300049568 | Bacteria | 1276 |
| 373 | Ga0501031_0542288 | 3300049568 | Bacteria | 749 |
| 374 | Ga0501032_0074934 | 3300049569 | Bacteria | 2254 |
| 375 | Ga0501032_0309942 | 3300049569 | Bacteria | 1020 |
| 376 | Ga0501032_0314249 | 3300049569 | Bacteria | 1012 |
| 377 | Ga0501032_0415028 | 3300049569 | Bacteria | 864 |
| 378 | Ga0501032_0582371 | 3300049569 | Bacteria | 712 |
| 379 | Ga0501032_0648435 | 3300049569 | Bacteria | 671 |
| 380 | Ga0501033_0044731 | 3300049570 | Bacteria | 3295 |
| 381 | Ga0501033_0131243 | 3300049570 | Unclassified | 1815 |
| 382 | Ga0501034_0066171 | 3300049571 | Bacteria | 3627 |
| 383 | Ga0501034_0114692 | 3300049571 | Bacteria | 2683 |
| 384 | Ga0501034_0161885 | 3300049571 | Bacteria | 2208 |
| 385 | Ga0501034_0178882 | 3300049571 | Bacteria | 2086 |
| 386 | Ga0501034_0335640 | 3300049571 | Bacteria | 1442 |
| 387 | Ga0501034_0364913 | 3300049571 | Bacteria | 1371 |
| 388 | Ga0501034_0877219 | 3300049571 | Bacteria | 786 |
| 389 | Ga0501036_0045297 | 3300049572 | Bacteria | 3727 |
| 390 | Ga0501036_0047831 | 3300049572 | Bacteria | 3621 |
| 391 | Ga0501036_0065677 | 3300049572 | Bacteria | 3070 |
| 392 | Ga0501037_0048534 | 3300049573 | Bacteria | 3110 |
| 393 | Ga0501037_0075360 | 3300049573 | Bacteria | 2450 |
| 394 | Ga0501037_0204903 | 3300049573 | Bacteria | 1393 |
| 395 | Ga0501037_0214902 | 3300049573 | Bacteria | 1355 |
| 396 | Ga0501038_0047290 | 3300049574 | Bacteria | 3727 |
| 397 | Ga0501038_0098147 | 3300049574 | Bacteria | 2443 |
| 398 | Ga0501038_0119994 | 3300049574 | Bacteria | 2170 |
| 399 | Ga0501038_0173411 | 3300049574 | Bacteria | 1744 |
| 400 | Ga0501038_0193912 | 3300049574 | Bacteria | 1633 |
| 401 | Ga0501038_0463318 | 3300049574 | Bacteria | 973 |
| 402 | Ga0501039_0016425 | 3300049575 | Bacteria | 5669 |
| 403 | Ga0501039_0018685 | 3300049575 | Bacteria | 5321 |
| 404 | Ga0501039_0125605 | 3300049575 | Bacteria | 2012 |
| 405 | Ga0501039_0389808 | 3300049575 | Bacteria | 1094 |
| 406 | Ga0501039_0727563 | 3300049575 | Bacteria | 775 |
| 407 | Ga0501040_0002823 | 3300049576 | Bacteria | 11209 |
| 408 | Ga0501040_0033743 | 3300049576 | Bacteria | 3469 |
| 409 | Ga0501040_0061120 | 3300049576 | Bacteria | 2590 |
| 410 | Ga0501040_0108073 | 3300049576 | Bacteria | 1944 |
| 411 | Ga0501040_0159017 | 3300049576 | Bacteria | 1597 |
| 412 | Ga0501041_0011754 | 3300049577 | Bacteria | 5181 |
| 413 | Ga0501041_0013809 | 3300049577 | Bacteria | 4788 |
| 414 | Ga0501041_0053592 | 3300049577 | Bacteria | 2460 |
| 415 | Ga0501041_0237868 | 3300049577 | Bacteria | 1144 |
| 416 | Ga0501041_0396132 | 3300049577 | Bacteria | 874 |
| 417 | Ga0501041_0740425 | 3300049577 | Bacteria | 630 |
| 418 | Ga0501042_0265719 | 3300049578 | Bacteria | 1239 |
| 419 | Ga0501042_0338580 | 3300049578 | Bacteria | 1087 |
| 420 | Ga0501043_0057267 | 3300049579 | Bacteria | 3061 |
| 421 | Ga0501043_0109254 | 3300049579 | Bacteria | 2172 |
| 422 | Ga0501043_0111488 | 3300049579 | Bacteria | 2148 |
| 423 | Ga0501043_0205162 | 3300049579 | Bacteria | 1529 |
| 424 | Ga0501043_0619828 | 3300049579 | Bacteria | 797 |
| 425 | Ga0501046_0000108 | 3300049580 | Bacteria | 87513 |
| 426 | Ga0501046_0029709 | 3300049580 | Bacteria | 4442 |
| 427 | Ga0501046_0041897 | 3300049580 | Bacteria | 3651 |
| 428 | Ga0501046_0091415 | 3300049580 | Bacteria | 2341 |
| 429 | Ga0501046_0129665 | 3300049580 | Bacteria | 1913 |
| 430 | Ga0501046_0138795 | 3300049580 | Bacteria | 1841 |
| 431 | Ga0501047_0064690 | 3300049581 | Bacteria | 3527 |
| 432 | Ga0501047_0073352 | 3300049581 | Bacteria | 3295 |
| 433 | Ga0501047_0074681 | 3300049581 | Bacteria | 3264 |
| 434 | Ga0501047_0591766 | 3300049581 | Bacteria | 931 |
| 435 | Ga0501048_0040036 | 3300049582 | Bacteria | 3359 |
| 436 | Ga0501048_0073962 | 3300049582 | Bacteria | 2404 |
| 437 | Ga0501048_0284058 | 3300049582 | Bacteria | 1177 |
| 438 | Ga0501048_0443362 | 3300049582 | Bacteria | 929 |
| 439 | Ga0501067_0123076 | 3300049583 | Bacteria | 1443 |
| 440 | Ga0501068_0022313 | 3300049584 | Bacteria | 3701 |
| 441 | Ga0501068_0067514 | 3300049584 | Bacteria | 2179 |
| 442 | Ga0501068_0145346 | 3300049584 | Bacteria | 1488 |
| 443 | Ga0501068_0181535 | 3300049584 | Bacteria | 1331 |
| 444 | Ga0501069_0107833 | 3300049585 | Bacteria | 1584 |
| 445 | Ga0501069_0110352 | 3300049585 | Bacteria | 1566 |
| 446 | Ga0501070_0013195 | 3300049586 | Bacteria | 6965 |
| 447 | Ga0501070_0081241 | 3300049586 | Bacteria | 2681 |
| 448 | Ga0501070_0239452 | 3300049586 | Bacteria | 1485 |
| 449 | Ga0501070_0446085 | 3300049586 | Bacteria | 1043 |
| 450 | Ga0501071_0006779 | 3300049587 | Bacteria | 7457 |
| 451 | Ga0501071_0039409 | 3300049587 | Bacteria | 3380 |
| 452 | Ga0501071_0052424 | 3300049587 | Bacteria | 2942 |
| 453 | Ga0501071_0081679 | 3300049587 | Bacteria | 2366 |
| 454 | Ga0501071_0106938 | 3300049587 | Bacteria | 2065 |
| 455 | Ga0501071_0114038 | 3300049587 | Bacteria | 1999 |
| 456 | Ga0501071_0242477 | 3300049587 | Bacteria | 1359 |
| 457 | Ga0501071_0543386 | 3300049587 | Bacteria | 892 |
| 458 | Ga0501071_1028207 | 3300049587 | Bacteria | 636 |
| 459 | Ga0501072_0003579 | 3300049588 | Bacteria | 11688 |
| 460 | Ga0501072_0018544 | 3300049588 | Bacteria | 5362 |
| 461 | Ga0501072_0023345 | 3300049588 | Bacteria | 4804 |
| 462 | Ga0501072_0146530 | 3300049588 | Bacteria | 1882 |
| 463 | Ga0501072_0325896 | 3300049588 | Bacteria | 1220 |
| 464 | Ga0501072_0530405 | 3300049588 | Bacteria | 930 |
| 465 | Ga0501073_0043755 | 3300049589 | Bacteria | 3157 |
| 466 | Ga0501073_0239273 | 3300049589 | Bacteria | 1254 |
| 467 | Ga0501074_0024951 | 3300049590 | Bacteria | 4343 |
| 468 | Ga0501074_0072284 | 3300049590 | Bacteria | 2478 |
| 469 | Ga0501074_0091851 | 3300049590 | Bacteria | 2174 |
| 470 | Ga0501075_0033033 | 3300049591 | Bacteria | 3848 |
| 471 | Ga0501075_0060350 | 3300049591 | Bacteria | 2857 |
| 472 | Ga0501075_0069371 | 3300049591 | Bacteria | 2664 |
| 473 | Ga0501075_0132289 | 3300049591 | Bacteria | 1900 |
| 474 | Ga0501075_0217185 | 3300049591 | Bacteria | 1458 |
| 475 | Ga0501076_0010887 | 3300049592 | Bacteria | 6765 |
| 476 | Ga0501076_0027798 | 3300049592 | Bacteria | 4386 |
| 477 | Ga0501076_0045416 | 3300049592 | Bacteria | 3468 |
| 478 | Ga0501076_0057250 | 3300049592 | Bacteria | 3095 |
| 479 | Ga0501076_0072069 | 3300049592 | Bacteria | 2764 |
| 480 | Ga0501076_0204125 | 3300049592 | Bacteria | 1614 |
| 481 | Ga0501076_0264888 | 3300049592 | Bacteria | 1407 |
| 482 | Ga0501077_0003781 | 3300049593 | Bacteria | 9111 |
| 483 | Ga0501077_0014463 | 3300049593 | Bacteria | 4959 |
| 484 | Ga0501077_0016838 | 3300049593 | Bacteria | 4611 |
| 485 | Ga0501077_0041653 | 3300049593 | Bacteria | 2922 |
| 486 | Ga0501077_0213105 | 3300049593 | Bacteria | 1227 |
| 487 | Ga0501079_0013945 | 3300049741 | Bacteria | 6130 |
| 488 | Ga0501079_0016914 | 3300049741 | Bacteria | 5570 |
| 489 | Ga0501079_0243390 | 3300049741 | Bacteria | 1405 |
| 490 | Ga0501079_0288304 | 3300049741 | Bacteria | 1284 |
| 491 | Ga0501080_0064676 | 3300049742 | Bacteria | 3402 |
| 492 | Ga0501080_0151453 | 3300049742 | Bacteria | 2143 |
| 493 | Ga0501080_0975474 | 3300049742 | Bacteria | 736 |
| 494 | Ga0501080_1035120 | 3300049742 | Bacteria | 711 |
| 495 | Ga0501081_0001225 | 3300049743 | Bacteria | 15621 |
| 496 | Ga0501081_0024073 | 3300049743 | Bacteria | 4087 |
| 497 | Ga0501081_0065866 | 3300049743 | Bacteria | 2519 |
| 498 | Ga0501081_0066641 | 3300049743 | Bacteria | 2504 |
| 499 | Ga0501081_0068052 | 3300049743 | Bacteria | 2478 |
| 500 | Ga0501081_0142070 | 3300049743 | Bacteria | 1721 |
| 501 | Ga0501081_0178971 | 3300049743 | Bacteria | 1533 |
| 502 | Ga0501081_0403929 | 3300049743 | Bacteria | 1011 |
| 503 | Ga0501083_0013422 | 3300049744 | Bacteria | 5727 |
| 504 | Ga0501083_0022280 | 3300049744 | Bacteria | 4396 |
| 505 | Ga0501083_0097745 | 3300049744 | Bacteria | 1937 |
| 506 | Ga0501083_0216791 | 3300049744 | Bacteria | 1247 |
| 507 | Ga0501083_0288195 | 3300049744 | Bacteria | 1068 |
| 508 | Ga0501035_0043235 | 3300049822 | Bacteria | 4061 |
| 509 | Ga0501035_0044668 | 3300049822 | Bacteria | 3989 |
| 510 | Ga0501035_0114738 | 3300049822 | Bacteria | 2358 |
| 511 | Ga0501035_0234018 | 3300049822 | Bacteria | 1565 |
| 512 | Ga0501044_0065512 | 3300049823 | Bacteria | 3705 |
| 513 | Ga0501044_0081989 | 3300049823 | Bacteria | 3264 |
| 514 | Ga0501044_0291132 | 3300049823 | Bacteria | 1564 |
| 515 | Ga0501044_0389363 | 3300049823 | Bacteria | 1308 |
| 516 | Ga0501045_0003878 | 3300049824 | Bacteria | 10286 |
| 517 | Ga0501045_0010207 | 3300049824 | Bacteria | 6574 |
| 518 | Ga0501045_0018012 | 3300049824 | Bacteria | 5015 |
| 519 | Ga0501045_0047550 | 3300049824 | Bacteria | 3126 |
| 520 | Ga0501045_0057144 | 3300049824 | Bacteria | 2855 |
| 521 | Ga0501045_0249109 | 3300049824 | Bacteria | 1322 |
| 522 | Ga0501045_0896782 | 3300049824 | Bacteria | 651 |
| 523 | nmdc:mga0yw44_289763_c1 | 3300050492 | Bacteria | 1095 |
| 524 | nmdc:mga07m45_126110_c1 | 3300050496 | Bacteria | 1480 |
| 525 | nmdc:mga05p37_339187_c1 | 3300050507 | Bacteria | 1773 |
| 526 | nmdc:mga05p37_34272_c1 | 3300050507 | Bacteria | 6217 |
| 527 | nmdc:mga05p37_616556_c1 | 3300050507 | Bacteria | 1222 |
| 528 | nmdc:mga09592_36292_c1 | 3300050508 | Bacteria | 4128 |
| 529 | nmdc:mga0qj67_203921_c1 | 3300050509 | Bacteria | 1606 |
| 530 | nmdc:mga0qj67_446420_c1 | 3300050509 | Bacteria | 1042 |
| 531 | nmdc:mga0qj67_642713_c1 | 3300050509 | Bacteria | 847 |
| 532 | nmdc:mga06r32_122233_c1 | 3300050510 | Bacteria | 2569 |
| 533 | nmdc:mga06r32_389353_c1 | 3300050510 | Bacteria | 1376 |
| 534 | nmdc:mga06r32_64132_c1 | 3300050510 | Bacteria | 3542 |
| 535 | nmdc:mga06r32_648382_c1 | 3300050510 | Bacteria | 1024 |
| 536 | nmdc:mga06r32_782936_c1 | 3300050510 | Bacteria | 915 |
| 537 | nmdc:mga08y16_136588_c1 | 3300050511 | Bacteria | 2549 |
| 538 | nmdc:mga08y16_167447_c1 | 3300050511 | Bacteria | 2283 |
| 539 | nmdc:mga08y16_61416_c1 | 3300050511 | Bacteria | 3924 |
| 540 | nmdc:mga08y16_82714_c1 | 3300050511 | Bacteria | 3347 |
| 541 | nmdc:mga0n895_13375_c1 | 3300050512 | Bacteria | 7400 |
| 542 | nmdc:mga0n895_23388_c1 | 3300050512 | Bacteria | 5808 |
| 543 | nmdc:mga0n895_256121_c1 | 3300050512 | Bacteria | 1776 |
| 544 | nmdc:mga0rr50_16598_c1 | 3300050513 | Bacteria | 4896 |
| 545 | nmdc:mga0rr50_291892_c1 | 3300050513 | Bacteria | 1363 |
| 546 | nmdc:mga0rr50_82340_c1 | 3300050513 | Bacteria | 2485 |
| 547 | nmdc:mga0a205_120276_c1 | 3300050515 | Bacteria | 2525 |
| 548 | nmdc:mga0a205_2229_c1 | 3300050515 | Bacteria | 17057 |
| 549 | nmdc:mga0a205_290241_c1 | 3300050515 | Bacteria | 1510 |
| 550 | nmdc:mga0a205_36738_c1 | 3300050515 | Bacteria | 4708 |
| 551 | nmdc:mga0a205_637464_c1 | 3300050515 | Bacteria | 917 |
| 552 | Ga0495655_0132288 | 3300053083 | Bacteria | 769 |
| 553 | Ga0495619_0001221 | 3300053085 | Bacteria | 16842 |
| 554 | Ga0495619_0164199 | 3300053085 | Bacteria | 1534 |
| 555 | Ga0495619_0180870 | 3300053085 | Bacteria | 1459 |
| 556 | Ga0500644_0157867 | 3300053088 | Bacteria | 915 |
| 557 | Ga0500556_0000054 | 3300053104 | Bacteria | 115949 |
| 558 | Ga0500616_0002525 | 3300053153 | Bacteria | 15140 |
| 559 | Ga0501084_0078994 | 3300054114 | Bacteria | 2758 |
| 560 | Ga0501084_0090135 | 3300054114 | Bacteria | 2574 |
| 561 | Ga0501084_0164758 | 3300054114 | Bacteria | 1871 |
| 562 | Ga0501084_0190632 | 3300054114 | Bacteria | 1729 |
| 563 | Ga0501084_0231167 | 3300054114 | Bacteria | 1561 |
| 564 | Ga0501084_0392923 | 3300054114 | Bacteria | 1172 |
| 565 | Ga0587082_105958 | 3300059504 | Bacteria | 619 |
| 566 | Ga0587085_094958 | 3300059506 | Bacteria | 621 |
| 567 | Ga0587088_077657 | 3300059508 | Bacteria | 705 |
| 568 | Ga0587095_020453 | 3300059514 | Bacteria | 633 |
| 569 | Ga0587128_090805 | 3300059630 | Bacteria | 626 |
| 570 | Ga0587076_074995 | 3300059645 | Bacteria | 710 |
| 571 | Ga0587078_047969 | 3300059646 | Bacteria | 620 |
| 572 | Ga0587079_138277 | 3300059647 | Bacteria | 619 |
| 573 | Ga0501082_0006604 | 3300060353 | Bacteria | 10036 |
| 574 | Ga0501082_0056485 | 3300060353 | Bacteria | 3382 |
| 575 | Ga0501082_0257776 | 3300060353 | Bacteria | 1517 |
| 576 | Ga0501082_0276894 | 3300060353 | Bacteria | 1461 |
| 577 | Ga0501082_0371262 | 3300060353 | Bacteria | 1248 |
| 578 | Ga0501082_0957387 | 3300060353 | Bacteria | 748 |
| 579 | Ga0501082_1165599 | 3300060353 | Bacteria | 673 |
| 580 | Ga0530510_0003947 | 3300061734 | Bacteria | 10228 |
| 581 | Ga0530510_0042834 | 3300061734 | Bacteria | 3270 |
| 582 | Ga0530510_0139876 | 3300061734 | Bacteria | 1783 |
| 583 | Ga0530510_0260967 | 3300061734 | Bacteria | 1292 |
| 584 | Ga0530510_0413650 | 3300061734 | Bacteria | 1017 |
| 585 | Ga0530510_0538752 | 3300061734 | Bacteria | 886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031250 | Ga0265331_10007887 | Ga0265331_100078875 | 178 |
| 2 | 3300049570 | Ga0501033_0131243 | Ga0501033_0131243_360_917 | 178 |
| 3 | 3300049571 | Ga0501034_0114692 | Ga0501034_0114692_1658_2215 | 178 |
| 4 | 3300031711 | Ga0265314_10082530 | Ga0265314_100825302 | 180 |
| 5 | 3300047318 | Ga0495636_0052293 | Ga0495636_0052293_718_1278 | 181 |
| 6 | 3300004801 | Ga0058860_12142977 | Ga0058860_121429771 | 182 |
| 7 | 3300005435 | Ga0070714_100012825 | Ga0070714_1000128255 | 182 |
| 8 | 3300005842 | Ga0068858_100492058 | Ga0068858_1004920582 | 182 |
| 9 | 3300013296 | Ga0157374_10740647 | Ga0157374_107406471 | 182 |
| 10 | 3300013307 | Ga0157372_10017628 | Ga0157372_100176281 | 182 |
| 11 | 3300020078 | Ga0206352_11101380 | Ga0206352_111013802 | 182 |
| 12 | 3300020082 | Ga0206353_11592444 | Ga0206353_115924441 | 182 |
| 13 | 3300025929 | Ga0207664_10130698 | Ga0207664_101306983 | 182 |
| 14 | 3300049571 | Ga0501034_0066171 | Ga0501034_0066171_1722_2285 | 182 |
| 15 | 3300049823 | Ga0501044_0389363 | Ga0501044_0389363_366_929 | 182 |
| 16 | 3300050509 | nmdc:mga0qj67_446420_c1 | nmdc:mga0qj67_446420_c1_381_938 | 182 |
| 17 | 3300050510 | nmdc:mga06r32_782936_c1 | nmdc:mga06r32_782936_c1_11_568 | 182 |
| 18 | 3300006163 | Ga0070715_10114509 | Ga0070715_101145092 | 183 |
| 19 | 3300031731 | Ga0307405_10664587 | Ga0307405_106645872 | 183 |
| 20 | 3300031903 | Ga0307407_10077389 | Ga0307407_100773892 | 183 |
| 21 | 3300032005 | Ga0307411_10765261 | Ga0307411_107652611 | 183 |
| 22 | 3300035410 | Ga0373924_0171808 | Ga0373924_0171808_253_804 | 183 |
| 23 | 3300037853 | Ga0436364_0574354 | Ga0436364_0574354_2334_2912 | 183 |
| 24 | 3300046462 | Ga0495651_0149179 | Ga0495651_0149179_1055_1606 | 183 |
| 25 | 3300046529 | Ga0495652_0118734 | Ga0495652_0118734_179_730 | 183 |
| 26 | 3300046559 | Ga0495667_0192738 | Ga0495667_0192738_694_1245 | 183 |
| 27 | 3300047317 | Ga0495604_0219644 | Ga0495604_0219644_112_663 | 183 |
| 28 | 3300047444 | Ga0495675_0504691 | Ga0495675_0504691_101_652 | 183 |
| 29 | 3300048088 | Ga0495602_0113278 | Ga0495602_0113278_212_763 | 183 |
| 30 | 3300053085 | Ga0495619_0164199 | Ga0495619_0164199_313_864 | 183 |
| 31 | 3300005331 | Ga0070670_100071032 | Ga0070670_1000710324 | 184 |
| 32 | 3300005335 | Ga0070666_10423636 | Ga0070666_104236362 | 184 |
| 33 | 3300005336 | Ga0070680_100027016 | Ga0070680_1000270162 | 184 |
| 34 | 3300005336 | Ga0070680_101118606 | Ga0070680_1011186061 | 184 |
| 35 | 3300005338 | Ga0068868_100684949 | Ga0068868_1006849492 | 184 |
| 36 | 3300005341 | Ga0070691_10069787 | Ga0070691_100697871 | 184 |
| 37 | 3300005347 | Ga0070668_100009939 | Ga0070668_1000099394 | 184 |
| 38 | 3300005355 | Ga0070671_100489895 | Ga0070671_1004898952 | 184 |
| 39 | 3300005367 | Ga0070667_100025204 | Ga0070667_1000252045 | 184 |
| 40 | 3300005406 | Ga0070703_10003324 | Ga0070703_100033246 | 184 |
| 41 | 3300005438 | Ga0070701_10021326 | Ga0070701_100213263 | 184 |
| 42 | 3300005440 | Ga0070705_100000427 | Ga0070705_1000004272 | 184 |
| 43 | 3300005441 | Ga0070700_100002813 | Ga0070700_10000281311 | 184 |
| 44 | 3300005441 | Ga0070700_100278443 | Ga0070700_1002784431 | 184 |
| 45 | 3300005445 | Ga0070708_100128672 | Ga0070708_1001286722 | 184 |
| 46 | 3300005455 | Ga0070663_100054771 | Ga0070663_1000547713 | 184 |
| 47 | 3300005458 | Ga0070681_10020054 | Ga0070681_100200542 | 184 |
| 48 | 3300005459 | Ga0068867_100831630 | Ga0068867_1008316301 | 184 |
| 49 | 3300005459 | Ga0068867_101041423 | Ga0068867_1010414231 | 184 |
| 50 | 3300005518 | Ga0070699_100059429 | Ga0070699_1000594292 | 184 |
| 51 | 3300005535 | Ga0070684_101102611 | Ga0070684_1011026111 | 184 |
| 52 | 3300005536 | Ga0070697_100170871 | Ga0070697_1001708712 | 184 |
| 53 | 3300005539 | Ga0068853_100340218 | Ga0068853_1003402182 | 184 |
| 54 | 3300005545 | Ga0070695_100185385 | Ga0070695_1001853852 | 184 |
| 55 | 3300005547 | Ga0070693_100004150 | Ga0070693_1000041502 | 184 |
| 56 | 3300005549 | Ga0070704_100025023 | Ga0070704_1000250232 | 184 |
| 57 | 3300005564 | Ga0070664_101183177 | Ga0070664_1011831771 | 184 |
| 58 | 3300005577 | Ga0068857_100075950 | Ga0068857_1000759504 | 184 |
| 59 | 3300005617 | Ga0068859_100001914 | Ga0068859_1000019142 | 184 |
| 60 | 3300005618 | Ga0068864_100031959 | Ga0068864_1000319594 | 184 |
| 61 | 3300005618 | Ga0068864_100122993 | Ga0068864_1001229932 | 184 |
| 62 | 3300005719 | Ga0068861_100295139 | Ga0068861_1002951392 | 184 |
| 63 | 3300005719 | Ga0068861_100300315 | Ga0068861_1003003152 | 184 |
| 64 | 3300005841 | Ga0068863_100041278 | Ga0068863_1000412786 | 184 |
| 65 | 3300005841 | Ga0068863_100656824 | Ga0068863_1006568242 | 184 |
| 66 | 3300005843 | Ga0068860_100046332 | Ga0068860_1000463325 | 184 |
| 67 | 3300005844 | Ga0068862_100047782 | Ga0068862_1000477822 | 184 |
| 68 | 3300005844 | Ga0068862_100263674 | Ga0068862_1002636742 | 184 |
| 69 | 3300006038 | Ga0075365_10404486 | Ga0075365_104044861 | 184 |
| 70 | 3300006038 | Ga0075365_10432964 | Ga0075365_104329642 | 184 |
| 71 | 3300006847 | Ga0075431_100031680 | Ga0075431_1000316806 | 184 |
| 72 | 3300006931 | Ga0097620_100001914 | Ga0097620_10000191427 | 184 |
| 73 | 3300007265 | Ga0099794_10025198 | Ga0099794_100251983 | 184 |
| 74 | 3300007788 | Ga0099795_10041163 | Ga0099795_100411633 | 184 |
| 75 | 3300009092 | Ga0105250_10134442 | Ga0105250_101344422 | 184 |
| 76 | 3300009094 | Ga0111539_10279852 | Ga0111539_102798523 | 184 |
| 77 | 3300009098 | Ga0105245_10596627 | Ga0105245_105966271 | 184 |
| 78 | 3300009147 | Ga0114129_10057811 | Ga0114129_100578117 | 184 |
| 79 | 3300009148 | Ga0105243_10059012 | Ga0105243_100590123 | 184 |
| 80 | 3300009553 | Ga0105249_10006173 | Ga0105249_100061732 | 184 |
| 81 | 3300010159 | Ga0099796_10102444 | Ga0099796_101024441 | 184 |
| 82 | 3300011119 | Ga0105246_10361220 | Ga0105246_103612201 | 184 |
| 83 | 3300011119 | Ga0105246_10680369 | Ga0105246_106803692 | 184 |
| 84 | 3300014326 | Ga0157380_10203842 | Ga0157380_102038422 | 184 |
| 85 | 3300025885 | Ga0207653_10000631 | Ga0207653_100006312 | 184 |
| 86 | 3300025907 | Ga0207645_10622737 | Ga0207645_106227371 | 184 |
| 87 | 3300025912 | Ga0207707_10141612 | Ga0207707_101416122 | 184 |
| 88 | 3300025923 | Ga0207681_10055329 | Ga0207681_100553293 | 184 |
| 89 | 3300025925 | Ga0207650_10046419 | Ga0207650_100464194 | 184 |
| 90 | 3300025931 | Ga0207644_10250096 | Ga0207644_102500962 | 184 |
| 91 | 3300025935 | Ga0207709_10315818 | Ga0207709_103158182 | 184 |
| 92 | 3300025942 | Ga0207689_10133770 | Ga0207689_101337703 | 184 |
| 93 | 3300025961 | Ga0207712_10002132 | Ga0207712_100021322 | 184 |
| 94 | 3300025972 | Ga0207668_10004553 | Ga0207668_100045535 | 184 |
| 95 | 3300025972 | Ga0207668_10351450 | Ga0207668_103514502 | 184 |
| 96 | 3300025986 | Ga0207658_10493671 | Ga0207658_104936711 | 184 |
| 97 | 3300026023 | Ga0207677_10765587 | Ga0207677_107655871 | 184 |
| 98 | 3300026041 | Ga0207639_10250301 | Ga0207639_102503012 | 184 |
| 99 | 3300026067 | Ga0207678_10031190 | Ga0207678_100311905 | 184 |
| 100 | 3300026075 | Ga0207708_10007125 | Ga0207708_100071259 | 184 |
| 101 | 3300026075 | Ga0207708_10251638 | Ga0207708_102516381 | 184 |
| 102 | 3300026088 | Ga0207641_10096129 | Ga0207641_100961295 | 184 |
| 103 | 3300026088 | Ga0207641_10170614 | Ga0207641_101706141 | 184 |
| 104 | 3300026089 | Ga0207648_10186433 | Ga0207648_101864333 | 184 |
| 105 | 3300026095 | Ga0207676_10059277 | Ga0207676_100592774 | 184 |
| 106 | 3300026116 | Ga0207674_10093506 | Ga0207674_100935063 | 184 |
| 107 | 3300026118 | Ga0207675_100151694 | Ga0207675_1001516943 | 184 |
| 108 | 3300026118 | Ga0207675_101544140 | Ga0207675_1015441401 | 184 |
| 109 | 3300027512 | Ga0209179_1043289 | Ga0209179_10432892 | 184 |
| 110 | 3300027671 | Ga0209588_1037538 | Ga0209588_10375382 | 184 |
| 111 | 3300027907 | Ga0207428_10307965 | Ga0207428_103079652 | 184 |
| 112 | 3300028379 | Ga0268266_10785094 | Ga0268266_107850942 | 184 |
| 113 | 3300028380 | Ga0268265_10007612 | Ga0268265_100076125 | 184 |
| 114 | 3300028380 | Ga0268265_10281366 | Ga0268265_102813662 | 184 |
| 115 | 3300028381 | Ga0268264_10018306 | Ga0268264_100183062 | 184 |
| 116 | 3300028381 | Ga0268264_10317754 | Ga0268264_103177541 | 184 |
| 117 | 3300042436 | Ga0439435_0025306 | Ga0439435_0025306_198_752 | 184 |
| 118 | 3300046533 | Ga0495640_0474783 | Ga0495640_0474783_74_628 | 184 |
| 119 | 3300048905 | Ga0496102_0159345 | Ga0496102_0159345_780_1334 | 184 |
| 120 | 3300048905 | Ga0496102_0227949 | Ga0496102_0227949_1119_1673 | 184 |
| 121 | 3300048906 | Ga0496103_0064387 | Ga0496103_0064387_748_1302 | 184 |
| 122 | 3300048906 | Ga0496103_0198957 | Ga0496103_0198957_66_620 | 184 |
| 123 | 3300048909 | Ga0496106_0021711 | Ga0496106_0021711_808_1362 | 184 |
| 124 | 3300048910 | Ga0496107_0119810 | Ga0496107_0119810_529_1083 | 184 |
| 125 | 3300048910 | Ga0496107_0582589 | Ga0496107_0582589_34_588 | 184 |
| 126 | 3300048911 | Ga0496108_0411241 | Ga0496108_0411241_467_1021 | 184 |
| 127 | 3300048912 | Ga0496109_0328391 | Ga0496109_0328391_81_635 | 184 |
| 128 | 3300048917 | Ga0496114_0514263 | Ga0496114_0514263_474_1028 | 184 |
| 129 | 3300049568 | Ga0501031_0542288 | Ga0501031_0542288_65_646 | 184 |
| 130 | 3300049571 | Ga0501034_0335640 | Ga0501034_0335640_769_1323 | 184 |
| 131 | 3300049571 | Ga0501034_0364913 | Ga0501034_0364913_697_1308 | 184 |
| 132 | 3300049571 | Ga0501034_0877219 | Ga0501034_0877219_138_692 | 184 |
| 133 | 3300049574 | Ga0501038_0463318 | Ga0501038_0463318_56_610 | 184 |
| 134 | 3300049577 | Ga0501041_0740425 | Ga0501041_0740425_42_596 | 184 |
| 135 | 3300049580 | Ga0501046_0000108 | Ga0501046_0000108_12086_12640 | 184 |
| 136 | 3300049580 | Ga0501046_0091415 | Ga0501046_0091415_1066_1620 | 184 |
| 137 | 3300049580 | Ga0501046_0138795 | Ga0501046_0138795_289_843 | 184 |
| 138 | 3300049581 | Ga0501047_0073352 | Ga0501047_0073352_2420_2974 | 184 |
| 139 | 3300049582 | Ga0501048_0284058 | Ga0501048_0284058_587_1141 | 184 |
| 140 | 3300049583 | Ga0501067_0123076 | Ga0501067_0123076_374_928 | 184 |
| 141 | 3300049585 | Ga0501069_0110352 | Ga0501069_0110352_613_1167 | 184 |
| 142 | 3300049586 | Ga0501070_0239452 | Ga0501070_0239452_400_954 | 184 |
| 143 | 3300049587 | Ga0501071_0543386 | Ga0501071_0543386_206_760 | 184 |
| 144 | 3300049589 | Ga0501073_0043755 | Ga0501073_0043755_2247_2801 | 184 |
| 145 | 3300049590 | Ga0501074_0091851 | Ga0501074_0091851_16_570 | 184 |
| 146 | 3300049593 | Ga0501077_0213105 | Ga0501077_0213105_64_618 | 184 |
| 147 | 3300049741 | Ga0501079_0288304 | Ga0501079_0288304_262_816 | 184 |
| 148 | 3300049742 | Ga0501080_0151453 | Ga0501080_0151453_795_1349 | 184 |
| 149 | 3300049742 | Ga0501080_0975474 | Ga0501080_0975474_146_700 | 184 |
| 150 | 3300049743 | Ga0501081_0142070 | Ga0501081_0142070_1089_1643 | 184 |
| 151 | 3300049743 | Ga0501081_0178971 | Ga0501081_0178971_259_813 | 184 |
| 152 | 3300049823 | Ga0501044_0291132 | Ga0501044_0291132_550_1104 | 184 |
| 153 | 3300049824 | Ga0501045_0010207 | Ga0501045_0010207_4022_4576 | 184 |
| 154 | 3300049824 | Ga0501045_0047550 | Ga0501045_0047550_980_1534 | 184 |
| 155 | 3300050492 | nmdc:mga0yw44_289763_c1 | nmdc:mga0yw44_289763_c1_73_627 | 184 |
| 156 | 3300050507 | nmdc:mga05p37_34272_c1 | nmdc:mga05p37_34272_c1_2050_2604 | 184 |
| 157 | 3300050510 | nmdc:mga06r32_64132_c1 | nmdc:mga06r32_64132_c1_2931_3485 | 184 |
| 158 | 3300053104 | Ga0500556_0000054 | Ga0500556_0000054_58154_58708 | 184 |
| 159 | 3300053153 | Ga0500616_0002525 | Ga0500616_0002525_6234_6788 | 184 |
| 160 | 3300054114 | Ga0501084_0078994 | Ga0501084_0078994_275_829 | 184 |
| 161 | 3300054114 | Ga0501084_0164758 | Ga0501084_0164758_871_1425 | 184 |
| 162 | 3300054114 | Ga0501084_0231167 | Ga0501084_0231167_972_1526 | 184 |
| 163 | 3300059504 | Ga0587082_105958 | Ga0587082_105958_25_579 | 184 |
| 164 | 3300059506 | Ga0587085_094958 | Ga0587085_094958_22_576 | 184 |
| 165 | 3300059508 | Ga0587088_077657 | Ga0587088_077657_128_682 | 184 |
| 166 | 3300059514 | Ga0587095_020453 | Ga0587095_020453_40_594 | 184 |
| 167 | 3300059630 | Ga0587128_090805 | Ga0587128_090805_27_581 | 184 |
| 168 | 3300059645 | Ga0587076_074995 | Ga0587076_074995_25_579 | 184 |
| 169 | 3300059646 | Ga0587078_047969 | Ga0587078_047969_26_580 | 184 |
| 170 | 3300059647 | Ga0587079_138277 | Ga0587079_138277_25_579 | 184 |
| 171 | 3300060353 | Ga0501082_0257776 | Ga0501082_0257776_131_685 | 184 |
| 172 | 3300060353 | Ga0501082_0371262 | Ga0501082_0371262_205_759 | 184 |
| 173 | 3300061734 | Ga0530510_0042834 | Ga0530510_0042834_1309_1863 | 184 |
| 174 | 3300005330 | Ga0070690_100099288 | Ga0070690_1000992883 | 185 |
| 175 | 3300005338 | Ga0068868_100419097 | Ga0068868_1004190972 | 185 |
| 176 | 3300005353 | Ga0070669_100429563 | Ga0070669_1004295631 | 185 |
| 177 | 3300005406 | Ga0070703_10029443 | Ga0070703_100294432 | 185 |
| 178 | 3300005434 | Ga0070709_10127644 | Ga0070709_101276441 | 185 |
| 179 | 3300005441 | Ga0070700_100543961 | Ga0070700_1005439611 | 185 |
| 180 | 3300005444 | Ga0070694_100026501 | Ga0070694_1000265014 | 185 |
| 181 | 3300005545 | Ga0070695_100004704 | Ga0070695_1000047046 | 185 |
| 182 | 3300005549 | Ga0070704_100373503 | Ga0070704_1003735032 | 185 |
| 183 | 3300005617 | Ga0068859_101271702 | Ga0068859_1012717021 | 185 |
| 184 | 3300005719 | Ga0068861_100207844 | Ga0068861_1002078441 | 185 |
| 185 | 3300005842 | Ga0068858_100641361 | Ga0068858_1006413612 | 185 |
| 186 | 3300005983 | Ga0081540_1002918 | Ga0081540_10029186 | 185 |
| 187 | 3300005985 | Ga0081539_10087706 | Ga0081539_100877062 | 185 |
| 188 | 3300006353 | Ga0075370_10052509 | Ga0075370_100525092 | 185 |
| 189 | 3300006844 | Ga0075428_100260089 | Ga0075428_1002600893 | 185 |
| 190 | 3300006852 | Ga0075433_10000150 | Ga0075433_1000015025 | 185 |
| 191 | 3300006871 | Ga0075434_100002118 | Ga0075434_1000021182 | 185 |
| 192 | 3300006871 | Ga0075434_100035347 | Ga0075434_1000353473 | 185 |
| 193 | 3300006931 | Ga0097620_101271635 | Ga0097620_1012716352 | 185 |
| 194 | 3300007076 | Ga0075435_100022930 | Ga0075435_1000229302 | 185 |
| 195 | 3300009094 | Ga0111539_10003908 | Ga0111539_1000390812 | 185 |
| 196 | 3300009094 | Ga0111539_10033514 | Ga0111539_100335147 | 185 |
| 197 | 3300009098 | Ga0105245_10057667 | Ga0105245_100576674 | 185 |
| 198 | 3300009147 | Ga0114129_10414064 | Ga0114129_104140641 | 185 |
| 199 | 3300009147 | Ga0114129_11210630 | Ga0114129_112106302 | 185 |
| 200 | 3300009176 | Ga0105242_11234092 | Ga0105242_112340921 | 185 |
| 201 | 3300009177 | Ga0105248_10180829 | Ga0105248_101808294 | 185 |
| 202 | 3300009553 | Ga0105249_10835081 | Ga0105249_108350812 | 185 |
| 203 | 3300010375 | Ga0105239_10312975 | Ga0105239_103129752 | 185 |
| 204 | 3300011119 | Ga0105246_10307679 | Ga0105246_103076792 | 185 |
| 205 | 3300011119 | Ga0105246_10455011 | Ga0105246_104550111 | 185 |
| 206 | 3300013308 | Ga0157375_10027698 | Ga0157375_100276984 | 185 |
| 207 | 3300013308 | Ga0157375_10264513 | Ga0157375_102645133 | 185 |
| 208 | 3300014325 | Ga0163163_10048919 | Ga0163163_100489196 | 185 |
| 209 | 3300014497 | Ga0182008_10131340 | Ga0182008_101313402 | 185 |
| 210 | 3300014968 | Ga0157379_10119206 | Ga0157379_101192062 | 185 |
| 211 | 3300014969 | Ga0157376_10357844 | Ga0157376_103578442 | 185 |
| 212 | 3300017792 | Ga0163161_10295416 | Ga0163161_102954162 | 185 |
| 213 | 3300025906 | Ga0207699_10123355 | Ga0207699_101233552 | 185 |
| 214 | 3300025923 | Ga0207681_10489942 | Ga0207681_104899422 | 185 |
| 215 | 3300025935 | Ga0207709_10855492 | Ga0207709_108554921 | 185 |
| 216 | 3300025941 | Ga0207711_10347328 | Ga0207711_103473282 | 185 |
| 217 | 3300025981 | Ga0207640_10298176 | Ga0207640_102981761 | 185 |
| 218 | 3300026023 | Ga0207677_10392464 | Ga0207677_103924642 | 185 |
| 219 | 3300026035 | Ga0207703_10272229 | Ga0207703_102722292 | 185 |
| 220 | 3300026035 | Ga0207703_10828746 | Ga0207703_108287461 | 185 |
| 221 | 3300026075 | Ga0207708_10081805 | Ga0207708_100818054 | 185 |
| 222 | 3300026075 | Ga0207708_11025579 | Ga0207708_110255791 | 185 |
| 223 | 3300026089 | Ga0207648_10165779 | Ga0207648_101657795 | 185 |
| 224 | 3300026118 | Ga0207675_100099440 | Ga0207675_1000994402 | 185 |
| 225 | 3300026118 | Ga0207675_100266573 | Ga0207675_1002665733 | 185 |
| 226 | 3300027907 | Ga0207428_10056772 | Ga0207428_100567724 | 185 |
| 227 | 3300028794 | Ga0307515_10527144 | Ga0307515_105271442 | 185 |
| 228 | 3300031665 | Ga0316575_10104976 | Ga0316575_101049762 | 185 |
| 229 | 3300031665 | Ga0316575_10177277 | Ga0316575_101772772 | 185 |
| 230 | 3300031691 | Ga0316579_10038651 | Ga0316579_100386513 | 185 |
| 231 | 3300031727 | Ga0316576_10256736 | Ga0316576_102567362 | 185 |
| 232 | 3300031727 | Ga0316576_10308249 | Ga0316576_103082491 | 185 |
| 233 | 3300031733 | Ga0316577_10313979 | Ga0316577_103139792 | 185 |
| 234 | 3300031852 | Ga0307410_11015312 | Ga0307410_110153121 | 185 |
| 235 | 3300032133 | Ga0316583_10002462 | Ga0316583_100024628 | 185 |
| 236 | 3300032137 | Ga0316585_10032885 | Ga0316585_100328852 | 185 |
| 237 | 3300033528 | Ga0316588_1105129 | Ga0316588_11051292 | 185 |
| 238 | 3300033529 | Ga0316587_1009123 | Ga0316587_10091233 | 185 |
| 239 | 3300034820 | Ga0373959_0041208 | Ga0373959_0041208_68_628 | 185 |
| 240 | 3300035084 | Ga0373928_0020631 | Ga0373928_0020631_401_961 | 185 |
| 241 | 3300035112 | Ga0373932_0017521 | Ga0373932_0017521_849_1409 | 185 |
| 242 | 3300035114 | Ga0373939_0005250 | Ga0373939_0005250_246_806 | 185 |
| 243 | 3300035114 | Ga0373939_0009445 | Ga0373939_0009445_1413_1973 | 185 |
| 244 | 3300035115 | Ga0373941_0016896 | Ga0373941_0016896_1097_1657 | 185 |
| 245 | 3300035115 | Ga0373941_0167521 | Ga0373941_0167521_44_604 | 185 |
| 246 | 3300035121 | Ga0373960_0087699 | Ga0373960_0087699_335_895 | 185 |
| 247 | 3300035207 | Ga0373942_0016883 | Ga0373942_0016883_347_907 | 185 |
| 248 | 3300035242 | Ga0373962_0013944 | Ga0373962_0013944_1035_1595 | 185 |
| 249 | 3300035242 | Ga0373962_0020488 | Ga0373962_0020488_691_1251 | 185 |
| 250 | 3300035398 | Ga0316574_0253326 | Ga0316574_0253326_357_917 | 185 |
| 251 | 3300035691 | Ga0373931_0000951 | Ga0373931_0000951_6841_7401 | 185 |
| 252 | 3300035691 | Ga0373931_0014099 | Ga0373931_0014099_1002_1562 | 185 |
| 253 | 3300035691 | Ga0373931_0227711 | Ga0373931_0227711_16_576 | 185 |
| 254 | 3300035695 | Ga0373927_0053183 | Ga0373927_0053183_1559_2119 | 185 |
| 255 | 3300035695 | Ga0373927_0382013 | Ga0373927_0382013_308_868 | 185 |
| 256 | 3300036647 | Ga0316582_0233004 | Ga0316582_0233004_565_1125 | 185 |
| 257 | 3300036647 | Ga0316582_0243369 | Ga0316582_0243369_515_1075 | 185 |
| 258 | 3300036712 | Ga0316584_0622372 | Ga0316584_0622372_150_710 | 185 |
| 259 | 3300037588 | Ga0316581_0002304 | Ga0316581_0002304_180_740 | 185 |
| 260 | 3300045976 | Ga0466967_0568650 | Ga0466967_0568650_103_669 | 185 |
| 261 | 3300046459 | Ga0495629_0168672 | Ga0495629_0168672_613_1173 | 185 |
| 262 | 3300046472 | Ga0495580_0394589 | Ga0495580_0394589_242_802 | 185 |
| 263 | 3300048905 | Ga0496102_0884741 | Ga0496102_0884741_55_615 | 185 |
| 264 | 3300048905 | Ga0496102_1250597 | Ga0496102_1250597_22_582 | 185 |
| 265 | 3300048910 | Ga0496107_0321122 | Ga0496107_0321122_196_756 | 185 |
| 266 | 3300048913 | Ga0496110_0021047 | Ga0496110_0021047_3667_4227 | 185 |
| 267 | 3300048914 | Ga0496111_0019160 | Ga0496111_0019160_507_1067 | 185 |
| 268 | 3300048915 | Ga0496112_0242141 | Ga0496112_0242141_405_965 | 185 |
| 269 | 3300048916 | Ga0496113_0909090 | Ga0496113_0909090_102_662 | 185 |
| 270 | 3300048918 | Ga0496115_0003665 | Ga0496115_0003665_1095_1655 | 185 |
| 271 | 3300049575 | Ga0501039_0389808 | Ga0501039_0389808_266_823 | 185 |
| 272 | 3300049577 | Ga0501041_0396132 | Ga0501041_0396132_289_846 | 185 |
| 273 | 3300049587 | Ga0501071_1028207 | Ga0501071_1028207_40_597 | 185 |
| 274 | 3300049588 | Ga0501072_0023345 | Ga0501072_0023345_2661_3218 | 185 |
| 275 | 3300049591 | Ga0501075_0217185 | Ga0501075_0217185_805_1362 | 185 |
| 276 | 3300049592 | Ga0501076_0057250 | Ga0501076_0057250_2385_2942 | 185 |
| 277 | 3300049743 | Ga0501081_0065866 | Ga0501081_0065866_699_1256 | 185 |
| 278 | 3300049824 | Ga0501045_0249109 | Ga0501045_0249109_676_1233 | 185 |
| 279 | 3300050496 | nmdc:mga07m45_126110_c1 | nmdc:mga07m45_126110_c1_731_1291 | 185 |
| 280 | 3300050507 | nmdc:mga05p37_339187_c1 | nmdc:mga05p37_339187_c1_685_1245 | 185 |
| 281 | 3300050507 | nmdc:mga05p37_616556_c1 | nmdc:mga05p37_616556_c1_567_1127 | 185 |
| 282 | 3300050508 | nmdc:mga09592_36292_c1 | nmdc:mga09592_36292_c1_2944_3504 | 185 |
| 283 | 3300050509 | nmdc:mga0qj67_203921_c1 | nmdc:mga0qj67_203921_c1_584_1144 | 185 |
| 284 | 3300050510 | nmdc:mga06r32_122233_c1 | nmdc:mga06r32_122233_c1_1925_2485 | 185 |
| 285 | 3300050510 | nmdc:mga06r32_389353_c1 | nmdc:mga06r32_389353_c1_768_1328 | 185 |
| 286 | 3300050510 | nmdc:mga06r32_648382_c1 | nmdc:mga06r32_648382_c1_414_971 | 185 |
| 287 | 3300050511 | nmdc:mga08y16_136588_c1 | nmdc:mga08y16_136588_c1_223_783 | 185 |
| 288 | 3300050511 | nmdc:mga08y16_167447_c1 | nmdc:mga08y16_167447_c1_59_619 | 185 |
| 289 | 3300050511 | nmdc:mga08y16_82714_c1 | nmdc:mga08y16_82714_c1_91_651 | 185 |
| 290 | 3300050512 | nmdc:mga0n895_13375_c1 | nmdc:mga0n895_13375_c1_37_597 | 185 |
| 291 | 3300050512 | nmdc:mga0n895_23388_c1 | nmdc:mga0n895_23388_c1_2911_3471 | 185 |
| 292 | 3300050513 | nmdc:mga0rr50_16598_c1 | nmdc:mga0rr50_16598_c1_1442_2002 | 185 |
| 293 | 3300050513 | nmdc:mga0rr50_291892_c1 | nmdc:mga0rr50_291892_c1_513_1073 | 185 |
| 294 | 3300050513 | nmdc:mga0rr50_82340_c1 | nmdc:mga0rr50_82340_c1_838_1398 | 185 |
| 295 | 3300050515 | nmdc:mga0a205_120276_c1 | nmdc:mga0a205_120276_c1_1149_1709 | 185 |
| 296 | 3300050515 | nmdc:mga0a205_2229_c1 | nmdc:mga0a205_2229_c1_10737_11297 | 185 |
| 297 | 3300050515 | nmdc:mga0a205_290241_c1 | nmdc:mga0a205_290241_c1_70_630 | 185 |
| 298 | 3300050515 | nmdc:mga0a205_637464_c1 | nmdc:mga0a205_637464_c1_191_751 | 185 |
| 299 | 3300060353 | Ga0501082_0957387 | Ga0501082_0957387_26_583 | 185 |
| 300 | 3300061734 | Ga0530510_0413650 | Ga0530510_0413650_264_821 | 185 |
| 301 | 3300061734 | Ga0530510_0538752 | Ga0530510_0538752_295_852 | 185 |
| 302 | 3300002244 | JGI24742J22300_10033212 | JGI24742J22300_100332121 | 186 |
| 303 | 3300005329 | Ga0070683_100092767 | Ga0070683_1000927675 | 186 |
| 304 | 3300005336 | Ga0070680_100196424 | Ga0070680_1001964242 | 186 |
| 305 | 3300005337 | Ga0070682_100059360 | Ga0070682_1000593601 | 186 |
| 306 | 3300005338 | Ga0068868_100465471 | Ga0068868_1004654711 | 186 |
| 307 | 3300005345 | Ga0070692_10188542 | Ga0070692_101885421 | 186 |
| 308 | 3300005365 | Ga0070688_100212269 | Ga0070688_1002122692 | 186 |
| 309 | 3300005366 | Ga0070659_100221370 | Ga0070659_1002213702 | 186 |
| 310 | 3300005366 | Ga0070659_100294522 | Ga0070659_1002945222 | 186 |
| 311 | 3300005367 | Ga0070667_100421644 | Ga0070667_1004216442 | 186 |
| 312 | 3300005434 | Ga0070709_10034824 | Ga0070709_100348243 | 186 |
| 313 | 3300005444 | Ga0070694_100017214 | Ga0070694_1000172147 | 186 |
| 314 | 3300005456 | Ga0070678_100083070 | Ga0070678_1000830702 | 186 |
| 315 | 3300005459 | Ga0068867_100388729 | Ga0068867_1003887292 | 186 |
| 316 | 3300005530 | Ga0070679_100063548 | Ga0070679_1000635485 | 186 |
| 317 | 3300005535 | Ga0070684_100260037 | Ga0070684_1002600371 | 186 |
| 318 | 3300005546 | Ga0070696_100029690 | Ga0070696_1000296901 | 186 |
| 319 | 3300005549 | Ga0070704_100032866 | Ga0070704_1000328661 | 186 |
| 320 | 3300005563 | Ga0068855_100116551 | Ga0068855_1001165513 | 186 |
| 321 | 3300005577 | Ga0068857_100049678 | Ga0068857_1000496783 | 186 |
| 322 | 3300005578 | Ga0068854_100035896 | Ga0068854_1000358963 | 186 |
| 323 | 3300005617 | Ga0068859_100088096 | Ga0068859_1000880965 | 186 |
| 324 | 3300005719 | Ga0068861_100356974 | Ga0068861_1003569741 | 186 |
| 325 | 3300005843 | Ga0068860_100055488 | Ga0068860_1000554881 | 186 |
| 326 | 3300005937 | Ga0081455_10001595 | Ga0081455_1000159522 | 186 |
| 327 | 3300006048 | Ga0075363_100020834 | Ga0075363_1000208344 | 186 |
| 328 | 3300006175 | Ga0070712_100677485 | Ga0070712_1006774851 | 186 |
| 329 | 3300006844 | Ga0075428_100268461 | Ga0075428_1002684612 | 186 |
| 330 | 3300006846 | Ga0075430_100040569 | Ga0075430_1000405692 | 186 |
| 331 | 3300006852 | Ga0075433_10192144 | Ga0075433_101921442 | 186 |
| 332 | 3300006881 | Ga0068865_100120057 | Ga0068865_1001200573 | 186 |
| 333 | 3300006931 | Ga0097620_100088091 | Ga0097620_1000880915 | 186 |
| 334 | 3300009093 | Ga0105240_10117882 | Ga0105240_101178822 | 186 |
| 335 | 3300009094 | Ga0111539_10058388 | Ga0111539_100583885 | 186 |
| 336 | 3300009101 | Ga0105247_10008332 | Ga0105247_100083329 | 186 |
| 337 | 3300009148 | Ga0105243_10080683 | Ga0105243_100806833 | 186 |
| 338 | 3300009177 | Ga0105248_10482465 | Ga0105248_104824651 | 186 |
| 339 | 3300010375 | Ga0105239_10012676 | Ga0105239_1001267615 | 186 |
| 340 | 3300012494 | Ga0157341_1006900 | Ga0157341_10069001 | 186 |
| 341 | 3300012507 | Ga0157342_1005900 | Ga0157342_10059003 | 186 |
| 342 | 3300013104 | Ga0157370_10313437 | Ga0157370_103134372 | 186 |
| 343 | 3300013306 | Ga0163162_10115057 | Ga0163162_101150573 | 186 |
| 344 | 3300013307 | Ga0157372_11095122 | Ga0157372_110951222 | 186 |
| 345 | 3300014326 | Ga0157380_10007714 | Ga0157380_100077144 | 186 |
| 346 | 3300014968 | Ga0157379_10667469 | Ga0157379_106674692 | 186 |
| 347 | 3300017792 | Ga0163161_10435914 | Ga0163161_104359142 | 186 |
| 348 | 3300020070 | Ga0206356_11534066 | Ga0206356_115340662 | 186 |
| 349 | 3300020076 | Ga0206355_1452686 | Ga0206355_14526862 | 186 |
| 350 | 3300020082 | Ga0206353_11194519 | Ga0206353_111945192 | 186 |
| 351 | 3300022467 | Ga0224712_10240290 | Ga0224712_102402901 | 186 |
| 352 | 3300025898 | Ga0207692_10377362 | Ga0207692_103773621 | 186 |
| 353 | 3300025899 | Ga0207642_10326661 | Ga0207642_103266612 | 186 |
| 354 | 3300025900 | Ga0207710_10079885 | Ga0207710_100798852 | 186 |
| 355 | 3300025907 | Ga0207645_10285035 | Ga0207645_102850351 | 186 |
| 356 | 3300025913 | Ga0207695_10478271 | Ga0207695_104782711 | 186 |
| 357 | 3300025915 | Ga0207693_10004273 | Ga0207693_100042734 | 186 |
| 358 | 3300025915 | Ga0207693_10578233 | Ga0207693_105782331 | 186 |
| 359 | 3300025917 | Ga0207660_10275089 | Ga0207660_102750891 | 186 |
| 360 | 3300025924 | Ga0207694_10599782 | Ga0207694_105997821 | 186 |
| 361 | 3300025929 | Ga0207664_10101638 | Ga0207664_101016382 | 186 |
| 362 | 3300025932 | Ga0207690_10386696 | Ga0207690_103866962 | 186 |
| 363 | 3300025935 | Ga0207709_10221030 | Ga0207709_102210301 | 186 |
| 364 | 3300025937 | Ga0207669_10107533 | Ga0207669_101075333 | 186 |
| 365 | 3300025938 | Ga0207704_10322339 | Ga0207704_103223392 | 186 |
| 366 | 3300025939 | Ga0207665_10052047 | Ga0207665_100520471 | 186 |
| 367 | 3300025940 | Ga0207691_10008893 | Ga0207691_1000889313 | 186 |
| 368 | 3300025941 | Ga0207711_10899970 | Ga0207711_108999701 | 186 |
| 369 | 3300025944 | Ga0207661_10215818 | Ga0207661_102158181 | 186 |
| 370 | 3300025961 | Ga0207712_10359262 | Ga0207712_103592621 | 186 |
| 371 | 3300025972 | Ga0207668_10028368 | Ga0207668_100283682 | 186 |
| 372 | 3300026075 | Ga0207708_10349141 | Ga0207708_103491411 | 186 |
| 373 | 3300026078 | Ga0207702_10039530 | Ga0207702_100395303 | 186 |
| 374 | 3300026116 | Ga0207674_10446173 | Ga0207674_104461731 | 186 |
| 375 | 3300026118 | Ga0207675_100027412 | Ga0207675_1000274122 | 186 |
| 376 | 3300026118 | Ga0207675_100223009 | Ga0207675_1002230092 | 186 |
| 377 | 3300026121 | Ga0207683_11484418 | Ga0207683_114844181 | 186 |
| 378 | 3300026142 | Ga0207698_10063130 | Ga0207698_100631303 | 186 |
| 379 | 3300027876 | Ga0209974_10022748 | Ga0209974_100227482 | 186 |
| 380 | 3300028381 | Ga0268264_10066519 | Ga0268264_100665193 | 186 |
| 381 | 3300031548 | Ga0307408_100781470 | Ga0307408_1007814701 | 186 |
| 382 | 3300031901 | Ga0307406_10922324 | Ga0307406_109223241 | 186 |
| 383 | 3300031995 | Ga0307409_100191294 | Ga0307409_1001912941 | 186 |
| 384 | 3300032005 | Ga0307411_11126675 | Ga0307411_111266751 | 186 |
| 385 | 3300034957 | Ga0373938_0021927 | Ga0373938_0021927_63_623 | 186 |
| 386 | 3300035090 | Ga0373949_0021681 | Ga0373949_0021681_254_814 | 186 |
| 387 | 3300035121 | Ga0373960_0110611 | Ga0373960_0110611_229_789 | 186 |
| 388 | 3300035170 | Ga0373943_0063196 | Ga0373943_0063196_966_1526 | 186 |
| 389 | 3300035691 | Ga0373931_0038925 | Ga0373931_0038925_203_763 | 186 |
| 390 | 3300035692 | Ga0373935_0086886 | Ga0373935_0086886_850_1410 | 186 |
| 391 | 3300035695 | Ga0373927_0016229 | Ga0373927_0016229_2652_3212 | 186 |
| 392 | 3300035725 | Ga0373947_0000526 | Ga0373947_0000526_4932_5492 | 186 |
| 393 | 3300036401 | Ga0373937_0216682 | Ga0373937_0216682_170_730 | 186 |
| 394 | 3300037068 | Ga0373925_0017928 | Ga0373925_0017928_4334_4894 | 186 |
| 395 | 3300042013 | Ga0439456_092791 | Ga0439456_092791_33_593 | 186 |
| 396 | 3300046455 | Ga0495603_0001765 | Ga0495603_0001765_5322_5882 | 186 |
| 397 | 3300046461 | Ga0495641_0025115 | Ga0495641_0025115_2273_2833 | 186 |
| 398 | 3300046472 | Ga0495580_0007608 | Ga0495580_0007608_2322_2882 | 186 |
| 399 | 3300046473 | Ga0495582_0003623 | Ga0495582_0003623_5683_6243 | 186 |
| 400 | 3300046475 | Ga0495639_0001758 | Ga0495639_0001758_5707_6267 | 186 |
| 401 | 3300046477 | Ga0495664_0232673 | Ga0495664_0232673_389_967 | 186 |
| 402 | 3300046499 | Ga0495594_0000569 | Ga0495594_0000569_13147_13707 | 186 |
| 403 | 3300046511 | Ga0495608_0361500 | Ga0495608_0361500_259_819 | 186 |
| 404 | 3300046514 | Ga0495618_0447886 | Ga0495618_0447886_191_769 | 186 |
| 405 | 3300046517 | Ga0495630_0222723 | Ga0495630_0222723_225_788 | 186 |
| 406 | 3300046520 | Ga0495637_0117934 | Ga0495637_0117934_268_828 | 186 |
| 407 | 3300046526 | Ga0495666_0021187 | Ga0495666_0021187_2511_3071 | 186 |
| 408 | 3300046533 | Ga0495640_0310595 | Ga0495640_0310595_376_954 | 186 |
| 409 | 3300046538 | Ga0495609_0204208 | Ga0495609_0204208_110_670 | 186 |
| 410 | 3300046559 | Ga0495667_0152501 | Ga0495667_0152501_213_773 | 186 |
| 411 | 3300046616 | Ga0495668_0206745 | Ga0495668_0206745_36_599 | 186 |
| 412 | 3300046642 | Ga0495634_0017885 | Ga0495634_0017885_4099_4659 | 186 |
| 413 | 3300046660 | Ga0495625_0104593 | Ga0495625_0104593_1132_1692 | 186 |
| 414 | 3300046663 | Ga0495635_0037618 | Ga0495635_0037618_2615_3175 | 186 |
| 415 | 3300046664 | Ga0495659_0093706 | Ga0495659_0093706_432_992 | 186 |
| 416 | 3300046681 | Ga0495647_0007853 | Ga0495647_0007853_2393_2953 | 186 |
| 417 | 3300046683 | Ga0495658_0010713 | Ga0495658_0010713_2576_3136 | 186 |
| 418 | 3300046689 | Ga0495613_0014993 | Ga0495613_0014993_3595_4155 | 186 |
| 419 | 3300046690 | Ga0495624_0032941 | Ga0495624_0032941_2406_2966 | 186 |
| 420 | 3300047321 | Ga0495676_0037971 | Ga0495676_0037971_846_1406 | 186 |
| 421 | 3300047322 | Ga0495680_0008364 | Ga0495680_0008364_594_1154 | 186 |
| 422 | 3300047322 | Ga0495680_0149684 | Ga0495680_0149684_920_1498 | 186 |
| 423 | 3300047444 | Ga0495675_0299491 | Ga0495675_0299491_27_605 | 186 |
| 424 | 3300048089 | Ga0495614_0006753 | Ga0495614_0006753_1032_1592 | 186 |
| 425 | 3300048903 | Ga0496100_0440359 | Ga0496100_0440359_410_970 | 186 |
| 426 | 3300048903 | Ga0496100_0650307 | Ga0496100_0650307_45_605 | 186 |
| 427 | 3300048904 | Ga0496101_0337197 | Ga0496101_0337197_557_1117 | 186 |
| 428 | 3300048905 | Ga0496102_0037218 | Ga0496102_0037218_785_1345 | 186 |
| 429 | 3300048905 | Ga0496102_1102462 | Ga0496102_1102462_80_640 | 186 |
| 430 | 3300048907 | Ga0496104_0000604 | Ga0496104_0000604_2428_3090 | 186 |
| 431 | 3300048907 | Ga0496104_0049381 | Ga0496104_0049381_1625_2185 | 186 |
| 432 | 3300048907 | Ga0496104_0057638 | Ga0496104_0057638_57_617 | 186 |
| 433 | 3300048908 | Ga0496105_0000132 | Ga0496105_0000132_27405_28067 | 186 |
| 434 | 3300048908 | Ga0496105_0001618 | Ga0496105_0001618_12621_13199 | 186 |
| 435 | 3300048908 | Ga0496105_0036117 | Ga0496105_0036117_1086_1646 | 186 |
| 436 | 3300048908 | Ga0496105_0718580 | Ga0496105_0718580_195_755 | 186 |
| 437 | 3300048911 | Ga0496108_0266852 | Ga0496108_0266852_274_852 | 186 |
| 438 | 3300048912 | Ga0496109_0836687 | Ga0496109_0836687_219_779 | 186 |
| 439 | 3300048912 | Ga0496109_1096035 | Ga0496109_1096035_150_710 | 186 |
| 440 | 3300048913 | Ga0496110_0004787 | Ga0496110_0004787_5964_6542 | 186 |
| 441 | 3300048913 | Ga0496110_0040100 | Ga0496110_0040100_2387_2947 | 186 |
| 442 | 3300048914 | Ga0496111_0025412 | Ga0496111_0025412_34_594 | 186 |
| 443 | 3300048915 | Ga0496112_0004042 | Ga0496112_0004042_8444_9022 | 186 |
| 444 | 3300048915 | Ga0496112_0501855 | Ga0496112_0501855_544_1104 | 186 |
| 445 | 3300048916 | Ga0496113_0387829 | Ga0496113_0387829_177_737 | 186 |
| 446 | 3300048917 | Ga0496114_0084706 | Ga0496114_0084706_1472_2032 | 186 |
| 447 | 3300048917 | Ga0496114_0514832 | Ga0496114_0514832_108_668 | 186 |
| 448 | 3300048918 | Ga0496115_0759646 | Ga0496115_0759646_41_619 | 186 |
| 449 | 3300048922 | Ga0496119_0005517 | Ga0496119_0005517_9269_9829 | 186 |
| 450 | 3300048928 | Ga0496125_0050432 | Ga0496125_0050432_2400_2978 | 186 |
| 451 | 3300048929 | Ga0496126_0670721 | Ga0496126_0670721_213_773 | 186 |
| 452 | 3300049568 | Ga0501031_0015973 | Ga0501031_0015973_1617_2177 | 186 |
| 453 | 3300049568 | Ga0501031_0056236 | Ga0501031_0056236_211_771 | 186 |
| 454 | 3300049568 | Ga0501031_0147877 | Ga0501031_0147877_792_1352 | 186 |
| 455 | 3300049568 | Ga0501031_0207761 | Ga0501031_0207761_578_1138 | 186 |
| 456 | 3300049569 | Ga0501032_0074934 | Ga0501032_0074934_456_1016 | 186 |
| 457 | 3300049569 | Ga0501032_0309942 | Ga0501032_0309942_55_615 | 186 |
| 458 | 3300049569 | Ga0501032_0314249 | Ga0501032_0314249_349_909 | 186 |
| 459 | 3300049569 | Ga0501032_0415028 | Ga0501032_0415028_204_764 | 186 |
| 460 | 3300049569 | Ga0501032_0582371 | Ga0501032_0582371_81_641 | 186 |
| 461 | 3300049569 | Ga0501032_0648435 | Ga0501032_0648435_88_648 | 186 |
| 462 | 3300049570 | Ga0501033_0044731 | Ga0501033_0044731_1120_1680 | 186 |
| 463 | 3300049571 | Ga0501034_0161885 | Ga0501034_0161885_755_1315 | 186 |
| 464 | 3300049571 | Ga0501034_0178882 | Ga0501034_0178882_924_1484 | 186 |
| 465 | 3300049572 | Ga0501036_0045297 | Ga0501036_0045297_2338_2898 | 186 |
| 466 | 3300049572 | Ga0501036_0047831 | Ga0501036_0047831_2620_3180 | 186 |
| 467 | 3300049572 | Ga0501036_0065677 | Ga0501036_0065677_711_1271 | 186 |
| 468 | 3300049573 | Ga0501037_0048534 | Ga0501037_0048534_1378_1938 | 186 |
| 469 | 3300049573 | Ga0501037_0075360 | Ga0501037_0075360_169_729 | 186 |
| 470 | 3300049573 | Ga0501037_0204903 | Ga0501037_0204903_729_1289 | 186 |
| 471 | 3300049573 | Ga0501037_0214902 | Ga0501037_0214902_242_802 | 186 |
| 472 | 3300049574 | Ga0501038_0047290 | Ga0501038_0047290_1340_1900 | 186 |
| 473 | 3300049574 | Ga0501038_0098147 | Ga0501038_0098147_1314_1874 | 186 |
| 474 | 3300049574 | Ga0501038_0119994 | Ga0501038_0119994_194_754 | 186 |
| 475 | 3300049574 | Ga0501038_0173411 | Ga0501038_0173411_630_1190 | 186 |
| 476 | 3300049574 | Ga0501038_0193912 | Ga0501038_0193912_613_1173 | 186 |
| 477 | 3300049575 | Ga0501039_0016425 | Ga0501039_0016425_1451_2011 | 186 |
| 478 | 3300049575 | Ga0501039_0018685 | Ga0501039_0018685_3264_3824 | 186 |
| 479 | 3300049575 | Ga0501039_0125605 | Ga0501039_0125605_1140_1700 | 186 |
| 480 | 3300049575 | Ga0501039_0727563 | Ga0501039_0727563_74_634 | 186 |
| 481 | 3300049576 | Ga0501040_0002823 | Ga0501040_0002823_3064_3624 | 186 |
| 482 | 3300049576 | Ga0501040_0033743 | Ga0501040_0033743_1701_2261 | 186 |
| 483 | 3300049576 | Ga0501040_0061120 | Ga0501040_0061120_717_1277 | 186 |
| 484 | 3300049576 | Ga0501040_0108073 | Ga0501040_0108073_275_835 | 186 |
| 485 | 3300049576 | Ga0501040_0159017 | Ga0501040_0159017_765_1325 | 186 |
| 486 | 3300049577 | Ga0501041_0011754 | Ga0501041_0011754_4611_5171 | 186 |
| 487 | 3300049577 | Ga0501041_0013809 | Ga0501041_0013809_2592_3152 | 186 |
| 488 | 3300049577 | Ga0501041_0053592 | Ga0501041_0053592_1525_2085 | 186 |
| 489 | 3300049577 | Ga0501041_0237868 | Ga0501041_0237868_445_1005 | 186 |
| 490 | 3300049578 | Ga0501042_0265719 | Ga0501042_0265719_203_763 | 186 |
| 491 | 3300049578 | Ga0501042_0338580 | Ga0501042_0338580_383_943 | 186 |
| 492 | 3300049579 | Ga0501043_0057267 | Ga0501043_0057267_328_888 | 186 |
| 493 | 3300049579 | Ga0501043_0109254 | Ga0501043_0109254_153_713 | 186 |
| 494 | 3300049579 | Ga0501043_0111488 | Ga0501043_0111488_595_1155 | 186 |
| 495 | 3300049579 | Ga0501043_0205162 | Ga0501043_0205162_707_1267 | 186 |
| 496 | 3300049579 | Ga0501043_0619828 | Ga0501043_0619828_56_616 | 186 |
| 497 | 3300049580 | Ga0501046_0029709 | Ga0501046_0029709_3245_3805 | 186 |
| 498 | 3300049580 | Ga0501046_0041897 | Ga0501046_0041897_279_839 | 186 |
| 499 | 3300049580 | Ga0501046_0129665 | Ga0501046_0129665_74_634 | 186 |
| 500 | 3300049581 | Ga0501047_0064690 | Ga0501047_0064690_252_812 | 186 |
| 501 | 3300049581 | Ga0501047_0074681 | Ga0501047_0074681_1793_2353 | 186 |
| 502 | 3300049581 | Ga0501047_0591766 | Ga0501047_0591766_341_901 | 186 |
| 503 | 3300049582 | Ga0501048_0040036 | Ga0501048_0040036_244_804 | 186 |
| 504 | 3300049582 | Ga0501048_0073962 | Ga0501048_0073962_775_1335 | 186 |
| 505 | 3300049582 | Ga0501048_0443362 | Ga0501048_0443362_243_803 | 186 |
| 506 | 3300049584 | Ga0501068_0022313 | Ga0501068_0022313_514_1074 | 186 |
| 507 | 3300049584 | Ga0501068_0067514 | Ga0501068_0067514_145_705 | 186 |
| 508 | 3300049584 | Ga0501068_0145346 | Ga0501068_0145346_724_1284 | 186 |
| 509 | 3300049584 | Ga0501068_0181535 | Ga0501068_0181535_588_1148 | 186 |
| 510 | 3300049585 | Ga0501069_0107833 | Ga0501069_0107833_547_1107 | 186 |
| 511 | 3300049586 | Ga0501070_0013195 | Ga0501070_0013195_2016_2576 | 186 |
| 512 | 3300049586 | Ga0501070_0081241 | Ga0501070_0081241_774_1334 | 186 |
| 513 | 3300049586 | Ga0501070_0446085 | Ga0501070_0446085_270_830 | 186 |
| 514 | 3300049587 | Ga0501071_0006779 | Ga0501071_0006779_2884_3444 | 186 |
| 515 | 3300049587 | Ga0501071_0039409 | Ga0501071_0039409_2540_3100 | 186 |
| 516 | 3300049587 | Ga0501071_0052424 | Ga0501071_0052424_1180_1740 | 186 |
| 517 | 3300049587 | Ga0501071_0081679 | Ga0501071_0081679_792_1352 | 186 |
| 518 | 3300049587 | Ga0501071_0106938 | Ga0501071_0106938_1480_2040 | 186 |
| 519 | 3300049587 | Ga0501071_0114038 | Ga0501071_0114038_849_1409 | 186 |
| 520 | 3300049587 | Ga0501071_0242477 | Ga0501071_0242477_702_1262 | 186 |
| 521 | 3300049588 | Ga0501072_0003579 | Ga0501072_0003579_4506_5066 | 186 |
| 522 | 3300049588 | Ga0501072_0018544 | Ga0501072_0018544_1499_2059 | 186 |
| 523 | 3300049588 | Ga0501072_0146530 | Ga0501072_0146530_32_637 | 186 |
| 524 | 3300049588 | Ga0501072_0325896 | Ga0501072_0325896_637_1197 | 186 |
| 525 | 3300049588 | Ga0501072_0530405 | Ga0501072_0530405_98_658 | 186 |
| 526 | 3300049589 | Ga0501073_0239273 | Ga0501073_0239273_616_1176 | 186 |
| 527 | 3300049590 | Ga0501074_0024951 | Ga0501074_0024951_793_1353 | 186 |
| 528 | 3300049590 | Ga0501074_0072284 | Ga0501074_0072284_1173_1733 | 186 |
| 529 | 3300049591 | Ga0501075_0033033 | Ga0501075_0033033_2842_3402 | 186 |
| 530 | 3300049591 | Ga0501075_0060350 | Ga0501075_0060350_941_1501 | 186 |
| 531 | 3300049591 | Ga0501075_0069371 | Ga0501075_0069371_1918_2478 | 186 |
| 532 | 3300049591 | Ga0501075_0132289 | Ga0501075_0132289_519_1079 | 186 |
| 533 | 3300049592 | Ga0501076_0010887 | Ga0501076_0010887_576_1136 | 186 |
| 534 | 3300049592 | Ga0501076_0027798 | Ga0501076_0027798_3022_3582 | 186 |
| 535 | 3300049592 | Ga0501076_0045416 | Ga0501076_0045416_1795_2355 | 186 |
| 536 | 3300049592 | Ga0501076_0072069 | Ga0501076_0072069_1285_1845 | 186 |
| 537 | 3300049592 | Ga0501076_0204125 | Ga0501076_0204125_392_952 | 186 |
| 538 | 3300049592 | Ga0501076_0264888 | Ga0501076_0264888_291_851 | 186 |
| 539 | 3300049593 | Ga0501077_0003781 | Ga0501077_0003781_4225_4785 | 186 |
| 540 | 3300049593 | Ga0501077_0014463 | Ga0501077_0014463_4323_4883 | 186 |
| 541 | 3300049593 | Ga0501077_0016838 | Ga0501077_0016838_1333_1893 | 186 |
| 542 | 3300049593 | Ga0501077_0041653 | Ga0501077_0041653_1901_2461 | 186 |
| 543 | 3300049741 | Ga0501079_0013945 | Ga0501079_0013945_4315_4875 | 186 |
| 544 | 3300049741 | Ga0501079_0016914 | Ga0501079_0016914_3747_4352 | 186 |
| 545 | 3300049741 | Ga0501079_0243390 | Ga0501079_0243390_118_678 | 186 |
| 546 | 3300049742 | Ga0501080_0064676 | Ga0501080_0064676_2700_3260 | 186 |
| 547 | 3300049742 | Ga0501080_1035120 | Ga0501080_1035120_85_645 | 186 |
| 548 | 3300049743 | Ga0501081_0001225 | Ga0501081_0001225_7485_8045 | 186 |
| 549 | 3300049743 | Ga0501081_0024073 | Ga0501081_0024073_3003_3563 | 186 |
| 550 | 3300049743 | Ga0501081_0066641 | Ga0501081_0066641_485_1045 | 186 |
| 551 | 3300049743 | Ga0501081_0068052 | Ga0501081_0068052_699_1259 | 186 |
| 552 | 3300049743 | Ga0501081_0403929 | Ga0501081_0403929_86_646 | 186 |
| 553 | 3300049744 | Ga0501083_0013422 | Ga0501083_0013422_4979_5539 | 186 |
| 554 | 3300049744 | Ga0501083_0022280 | Ga0501083_0022280_2203_2763 | 186 |
| 555 | 3300049744 | Ga0501083_0097745 | Ga0501083_0097745_1042_1602 | 186 |
| 556 | 3300049744 | Ga0501083_0216791 | Ga0501083_0216791_591_1151 | 186 |
| 557 | 3300049744 | Ga0501083_0288195 | Ga0501083_0288195_474_1034 | 186 |
| 558 | 3300049822 | Ga0501035_0043235 | Ga0501035_0043235_642_1202 | 186 |
| 559 | 3300049822 | Ga0501035_0044668 | Ga0501035_0044668_272_832 | 186 |
| 560 | 3300049822 | Ga0501035_0114738 | Ga0501035_0114738_412_972 | 186 |
| 561 | 3300049822 | Ga0501035_0234018 | Ga0501035_0234018_824_1384 | 186 |
| 562 | 3300049823 | Ga0501044_0065512 | Ga0501044_0065512_867_1427 | 186 |
| 563 | 3300049823 | Ga0501044_0081989 | Ga0501044_0081989_2092_2652 | 186 |
| 564 | 3300049824 | Ga0501045_0003878 | Ga0501045_0003878_1783_2343 | 186 |
| 565 | 3300049824 | Ga0501045_0018012 | Ga0501045_0018012_3625_4185 | 186 |
| 566 | 3300049824 | Ga0501045_0057144 | Ga0501045_0057144_279_839 | 186 |
| 567 | 3300049824 | Ga0501045_0896782 | Ga0501045_0896782_16_576 | 186 |
| 568 | 3300050509 | nmdc:mga0qj67_642713_c1 | nmdc:mga0qj67_642713_c1_109_669 | 186 |
| 569 | 3300050511 | nmdc:mga08y16_61416_c1 | nmdc:mga08y16_61416_c1_2059_2619 | 186 |
| 570 | 3300050512 | nmdc:mga0n895_256121_c1 | nmdc:mga0n895_256121_c1_1206_1766 | 186 |
| 571 | 3300050515 | nmdc:mga0a205_36738_c1 | nmdc:mga0a205_36738_c1_3074_3634 | 186 |
| 572 | 3300053083 | Ga0495655_0132288 | Ga0495655_0132288_40_600 | 186 |
| 573 | 3300053085 | Ga0495619_0001221 | Ga0495619_0001221_14710_15270 | 186 |
| 574 | 3300053085 | Ga0495619_0180870 | Ga0495619_0180870_149_727 | 186 |
| 575 | 3300053088 | Ga0500644_0157867 | Ga0500644_0157867_164_727 | 186 |
| 576 | 3300054114 | Ga0501084_0090135 | Ga0501084_0090135_201_761 | 186 |
| 577 | 3300054114 | Ga0501084_0190632 | Ga0501084_0190632_665_1225 | 186 |
| 578 | 3300054114 | Ga0501084_0392923 | Ga0501084_0392923_100_660 | 186 |
| 579 | 3300060353 | Ga0501082_0006604 | Ga0501082_0006604_8215_8775 | 186 |
| 580 | 3300060353 | Ga0501082_0056485 | Ga0501082_0056485_1003_1563 | 186 |
| 581 | 3300060353 | Ga0501082_0276894 | Ga0501082_0276894_232_792 | 186 |
| 582 | 3300060353 | Ga0501082_1165599 | Ga0501082_1165599_98_658 | 186 |
| 583 | 3300061734 | Ga0530510_0003947 | Ga0530510_0003947_7666_8226 | 186 |
| 584 | 3300061734 | Ga0530510_0139876 | Ga0530510_0139876_935_1495 | 186 |
| 585 | 3300061734 | Ga0530510_0260967 | Ga0530510_0260967_522_1082 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ltm-assembly1.cif.gz_A | solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b | 0.9628 | 1 | 92 |
| 2m5o-assembly1.cif.gz_A | solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c | 0.8474 | 95 | 183 |
| 2jnv-assembly1.cif.gz_A | solution structure of c-terminal domain of nifu-like protein from oryza sativa | 0.838 | 113 | 183 |
| 4rvn-assembly2.cif.gz_D | crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution | 0.8366 | 143 | 183 |
| 2ffm-assembly1.cif.gz_A | x-ray crystal structure of protein sav1430 from staphylococcus aureus. northeast structural genomics consortium target zr18. | 0.8319 | 1 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54MZ7_83_193_3.30.1370.70 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain | 0.9801 | 2 | 92 | 3.30.1370.70 |
| 2m5oA01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9727 | 113 | 183 | 3.30.300.130 |
| af_Q4DZR1_314_387_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9726 | 110 | 181 | 3.30.300.130 |
| af_Q59N44_19_128_3.30.1370.70 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain | 0.9707 | 2 | 93 | 3.30.1370.70 |
| af_Q4DVM2_55_159_3.30.1370.70 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;Scaffold protein Nfu/NifU, N-terminal domain | 0.9636 | 2 | 93 | 3.30.1370.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S2Q8G2-F1-model_v4 | deleted | 0.9999 | 102 | 183 |
|
| AF-A0A3D2F7G1-F1-model_v4 | NifU family protein | 0.9995 | 112 | 183 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7X6EQG8-F1-model_v4 | deleted | 0.9982 | 1 | 85 |
|
| AF-A0A833G2M5-F1-model_v4 | NifU family protein | 0.9982 | 118 | 183 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A0C2WQN0-F1-model_v4 | NIF system FeS cluster assembly NifU C-terminal domain-containing protein | 0.9967 | 115 | 183 |
GO:0005506
GO:0005739 GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar