F466397

General Info

Members Datasets Scaffolds Average Seq Length
584 385 527 292

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0025032|Ga0495686_0025032_1957_2913
Length 318
Sequence MAFCGPVGLPCKDRHHRMSWLSKLMPSGIRTDNTPSKKRSVPEGLWEKCSNCGAVLYRPELEENLEVCPKCGHHMAIRARARLASLFDPGSSSEIAAHLGPVDVLKFRDQKKYADRIKSTQKATGEFDALVAMRGLLKGNPLVASSFDFAFMGGSMGSVVGERFARAAEVALEWGCPYVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVSASFAMLGDINIAEPQALIGFAGPRVIEQTVREKLPEGFQRSEFLVEHGAIDQICDRREMRDRIADLTAMMMRQPRPTADDAPVTSPTAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221695 Lysobacter sp. Root494 Isolate Unclassified
13 2643221720 Lysobacter sp. Root916 Isolate Unclassified
14 2643221727 Lysobacter sp. Root96 Isolate Unclassified
15 2643221728 Lysobacter sp. Root983 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
26 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
27 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
30 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
31 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
32 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
33 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
34 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
35 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
36 2919513703 Luteimonas sp. 3794 Isolate Unclassified
37 2919675420 Luteimonas terrae 4099 Isolate Unclassified
38 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
39 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
40 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
41 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
42 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
43 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
44 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
45 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
46 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
47 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
48 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
49 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
50 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
51 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
52 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
53 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
54 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
55 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
56 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
57 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
58 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
59 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
63 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
64 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
73 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
74 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
76 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
98 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
105 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
108 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
109 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
110 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
149 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
152 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
169 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
170 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
171 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
254 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
255 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
256 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
257 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
258 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
259 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
260 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
261 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
262 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
263 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
264 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
265 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
266 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
267 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
268 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
271 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
274 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
275 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
276 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
277 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
278 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
279 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
295 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
298 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
299 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
300 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
303 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
304 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
305 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
306 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
307 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
308 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
309 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
310 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
311 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
312 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
313 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
314 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
315 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
316 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
325 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
326 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
327 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
372 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
373 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
374 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
375 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
381 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
382 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
383 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
384 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
385 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.24
Metatranscriptomes 0
Isolates 9.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 13.18
Nodule 0.17
Rhizoplane 3.08
Rhizosphere 69.01
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_314363 2162886007 Bacteria 1254
2 SwRhRL2b_contig_3426700 2162886007 Bacteria 2356
3 JGI24748J21848_1001571 3300002074 Bacteria 2537
4 JGI24034J26672_10010741 3300002239 Bacteria 1366
5 JGI24751J29686_10013157 3300002459 Bacteria 1707
6 JGI25152J39213_1000548 3300002773 Bacteria 20669
7 JGI25150J39212_1000114 3300002774 Bacteria 45745
8 JGI25151J46595_10000100 3300003187 Bacteria 116522
9 JGI25151J46595_10000128 3300003187 Bacteria 102514
10 JGI25153J46596_10000071 3300003215 Bacteria 116950
11 rootL2_10284264 3300003322 Bacteria 2489
12 JGI26145J50221_1001698 3300003371 Bacteria 1728
13 JGI25404J52841_10001389 3300003659 Bacteria 4240
14 JGI25404J52841_10001494 3300003659 Bacteria 4131
15 Ga0055526_1000021 3300003771 Bacteria 180007
16 Ga0055526_1033149 3300003771 Bacteria 1440
17 Ga0055537_1000141 3300003773 Bacteria 54030
18 Ga0055537_1000215 3300003773 Bacteria 42710
19 Ga0055524_1000128 3300003775 Bacteria 88986
20 Ga0055524_1014005 3300003775 Bacteria 2994
21 Ga0055524_1036672 3300003775 Bacteria 1313
22 Ga0055536_1032767 3300003781 Bacteria 1338
23 Ga0055534_1000054 3300003784 Bacteria 88986
24 Ga0055534_1000086 3300003784 Bacteria 72299
25 Ga0055534_1002749 3300003784 Bacteria 5898
26 Ga0055534_1008954 3300003784 Bacteria 2218
27 Ga0055528_1000009 3300003790 Bacteria 224150
28 Ga0055528_1000761 3300003790 Bacteria 22501
29 Ga0055530_10001109 3300003791 Bacteria 21055
30 Ga0055530_10001882 3300003791 Bacteria 14399
31 Ga0055530_10002002 3300003791 Bacteria 13806
32 Ga0055531_10003842 3300003794 Bacteria 9406
33 Ga0055531_10016573 3300003794 Bacteria 3169
34 Ga0055531_10024914 3300003794 Bacteria 2191
35 Ga0058692_1000011 3300003856 Bacteria 321321
36 Ga0058692_1000024 3300003856 Bacteria 219702
37 Ga0065714_10009016 3300005288 Bacteria 4227
38 Ga0065704_10083971 3300005289 Bacteria 3393
39 Ga0065715_10230468 3300005293 Bacteria 1236
40 Ga0070658_10003169 3300005327 Bacteria 13581
41 Ga0070676_10000823 3300005328 Bacteria 15347
42 Ga0070683_100601705 3300005329 Bacteria 1052
43 Ga0070690_100001047 3300005330 Bacteria 14161
44 Ga0070670_100235742 3300005331 Bacteria 1593
45 Ga0070670_100351385 3300005331 Bacteria 1295
46 Ga0068869_100001783 3300005334 Bacteria 12898
47 Ga0070666_10006883 3300005335 Bacteria 7004
48 Ga0068868_100008917 3300005338 Bacteria 7192
49 Ga0070660_100003148 3300005339 Bacteria 11336
50 Ga0070689_100002391 3300005340 Bacteria 12238
51 Ga0070687_100000482 3300005343 Bacteria 13313
52 Ga0070661_100002001 3300005344 Bacteria 14102
53 Ga0070668_100101898 3300005347 Bacteria 2276
54 Ga0070669_100001422 3300005353 Bacteria 17301
55 Ga0070669_100133535 3300005353 Bacteria 1907
56 Ga0070675_100125530 3300005354 Bacteria 2183
57 Ga0070671_100003509 3300005355 Bacteria 12254
58 Ga0070671_100028192 3300005355 Bacteria 4623
59 Ga0070671_100171422 3300005355 Bacteria 1835
60 Ga0070671_100379399 3300005355 Bacteria 1208
61 Ga0070674_100001692 3300005356 Bacteria 11936
62 Ga0070673_100001060 3300005364 Bacteria 15669
63 Ga0070688_100001262 3300005365 Bacteria 12614
64 Ga0070659_100002780 3300005366 Bacteria 12456
65 Ga0070667_100024566 3300005367 Bacteria 5006
66 Ga0070701_10001351 3300005438 Bacteria 9039
67 Ga0070711_100176182 3300005439 Bacteria 1634
68 Ga0070705_100002638 3300005440 Bacteria 8976
69 Ga0070663_100133435 3300005455 Bacteria 1888
70 Ga0070678_100001920 3300005456 Bacteria 11205
71 Ga0070678_100128413 3300005456 Bacteria 2010
72 Ga0070662_100001874 3300005457 Bacteria 12883
73 Ga0070685_10001698 3300005466 Bacteria 11571
74 Ga0070707_100420902 3300005468 Bacteria 1296
75 Ga0070679_100023473 3300005530 Bacteria 6038
76 Ga0068853_100000493 3300005539 Bacteria 26977
77 Ga0070672_100002883 3300005543 Bacteria 11058
78 Ga0070672_100004233 3300005543 Bacteria 9382
79 Ga0070672_100006280 3300005543 Bacteria 7965
80 Ga0070686_100003027 3300005544 Bacteria 9214
81 Ga0070696_100014261 3300005546 Bacteria 5332
82 Ga0070693_100000733 3300005547 Bacteria 14439
83 Ga0070665_100163191 3300005548 Bacteria 2230
84 Ga0070704_100033595 3300005549 Bacteria 3470
85 Ga0068855_100006770 3300005563 Bacteria 13901
86 Ga0070664_100004932 3300005564 Bacteria 10689
87 Ga0070664_100005223 3300005564 Bacteria 10415
88 Ga0068857_100009400 3300005577 Bacteria 8485
89 Ga0068857_100027014 3300005577 Bacteria 5064
90 Ga0068854_100001701 3300005578 Bacteria 13390
91 Ga0068856_100004173 3300005614 Bacteria 14429
92 Ga0068852_100002227 3300005616 Bacteria 13300
93 Ga0068859_100007196 3300005617 Bacteria 11296
94 Ga0068864_100002312 3300005618 Bacteria 15766
95 Ga0068861_100001305 3300005719 Bacteria 15610
96 Ga0068851_10000877 3300005834 Bacteria 12968
97 Ga0068870_10000916 3300005840 Bacteria 11544
98 Ga0068863_100013509 3300005841 Bacteria 7877
99 Ga0068860_100005121 3300005843 Bacteria 13330
100 Ga0081540_1000988 3300005983 Bacteria 25634
101 Ga0075364_10000020 3300006051 Bacteria 54215
102 Ga0075364_10305274 3300006051 Bacteria 1083
103 Ga0097621_100004336 3300006237 Bacteria 9858
104 Ga0097621_100038064 3300006237 Bacteria 3859
105 Ga0068871_100030519 3300006358 Bacteria 4245
106 Ga0068871_100045248 3300006358 Bacteria 3542
107 Ga0075428_100145594 3300006844 Bacteria 2575
108 Ga0068865_100001849 3300006881 Bacteria 12426
109 Ga0097620_100007195 3300006931 Bacteria 11296
110 Ga0075435_100047690 3300007076 Bacteria 3440
111 Ga0105251_10003611 3300009011 Bacteria 11123
112 Ga0105244_10073322 3300009036 Bacteria 1704
113 Ga0105244_10101697 3300009036 Bacteria 1405
114 Ga0105240_10003240 3300009093 Bacteria 25471
115 Ga0111539_10055715 3300009094 Bacteria 4700
116 Ga0111539_10337812 3300009094 Bacteria 1753
117 Ga0111539_10554299 3300009094 Bacteria 1339
118 Ga0105245_10004441 3300009098 Bacteria 12406
119 Ga0105247_10001559 3300009101 Bacteria 16324
120 Ga0105247_10003375 3300009101 Bacteria 10443
121 Ga0105243_10004714 3300009148 Bacteria 10737
122 Ga0105241_10092460 3300009174 Bacteria 2389
123 Ga0105242_10000383 3300009176 Bacteria 35192
124 Ga0105242_10061274 3300009176 Bacteria 3094
125 Ga0105248_10001684 3300009177 Bacteria 24603
126 Ga0105248_10480713 3300009177 Bacteria 1400
127 Ga0105237_10001653 3300009545 Bacteria 28941
128 Ga0105238_10006399 3300009551 Bacteria 11718
129 Ga0105249_10000236 3300009553 Bacteria 62582
130 Ga0105032_104247 3300009979 Bacteria 1228
131 Ga0105028_104662 3300009993 Bacteria 1428
132 Ga0105239_10005084 3300010375 Bacteria 15527
133 Ga0105239_10663386 3300010375 Bacteria 1191
134 Ga0157316_1000157 3300012510 Bacteria 3258
135 Ga0157327_1001218 3300012512 Bacteria 1569
136 Ga0157373_10005972 3300013100 Bacteria 9106
137 Ga0157371_10000154 3300013102 Bacteria 100237
138 Ga0157371_10000875 3300013102 Bacteria 34150
139 Ga0157371_10002975 3300013102 Bacteria 15728
140 Ga0157371_10243859 3300013102 Bacteria 1293
141 Ga0157370_10006946 3300013104 Bacteria 12369
142 Ga0157369_10000652 3300013105 Bacteria 44858
143 Ga0157369_10022183 3300013105 Bacteria 7092
144 Ga0157374_10001223 3300013296 Bacteria 21944
145 Ga0157374_10341588 3300013296 Bacteria 1486
146 Ga0157378_10000522 3300013297 Bacteria 36590
147 Ga0163162_10001916 3300013306 Bacteria 19589
148 Ga0157372_10010891 3300013307 Bacteria 9679
149 Ga0157372_10019180 3300013307 Bacteria 7364
150 Ga0157375_10000635 3300013308 Bacteria 31214
151 Ga0157375_10049459 3300013308 Bacteria 4119
152 Ga0163163_10003411 3300014325 Bacteria 13499
153 Ga0157380_10035235 3300014326 Bacteria 3865
154 Ga0157380_10347957 3300014326 Bacteria 1386
155 Ga0182008_10000142 3300014497 Bacteria 55320
156 Ga0182008_10042134 3300014497 Bacteria 2275
157 Ga0157377_10000157 3300014745 Bacteria 41711
158 Ga0157379_10000177 3300014968 Bacteria 48021
159 Ga0157376_10391798 3300014969 Bacteria 1341
160 Ga0182007_10000287 3300015262 Bacteria 33403
161 Ga0182005_1000388 3300015265 Bacteria 24055
162 Ga0182005_1038803 3300015265 Bacteria 1296
163 Ga0183360_10001 3300015689 Bacteria 3943671
164 Ga0183361_12046 3300016635 Bacteria 1076
165 Ga0163161_10001350 3300017792 Bacteria 18251
166 Ga0207425_1000030 3300025245 Bacteria 268200
167 Ga0209129_1000063 3300025258 Bacteria 240205
168 Ga0209565_1000022 3300025263 Bacteria 390888
169 Ga0209565_1000048 3300025263 Bacteria 224961
170 Ga0209673_1000001 3300025273 Bacteria 3176258
171 Ga0209673_1000104 3300025273 Bacteria 186569
172 Ga0209673_1006793 3300025273 Bacteria 5435
173 Ga0209130_1012894 3300025284 Bacteria 2164
174 Ga0209130_1013338 3300025284 Bacteria 2108
175 Ga0209675_1000045 3300025291 Bacteria 225750
176 Ga0209675_1000048 3300025291 Bacteria 221457
177 Ga0209675_1012113 3300025291 Bacteria 2802
178 Ga0209676_1000024 3300025292 Bacteria 578839
179 Ga0209676_1000091 3300025292 Bacteria 251328
180 Ga0209676_1000117 3300025292 Bacteria 203251
181 Ga0209676_1001624 3300025292 Bacteria 19895
182 Ga0209676_1002128 3300025292 Bacteria 15135
183 Ga0209676_1002569 3300025292 Bacteria 12546
184 Ga0209676_1003631 3300025292 Bacteria 9275
185 Ga0209025_1000005 3300025294 Bacteria 1272149
186 Ga0209025_1000013 3300025294 Bacteria 871757
187 Ga0209025_1004696 3300025294 Bacteria 11657
188 Ga0209025_1005156 3300025294 Bacteria 10822
189 Ga0209564_1000001 3300025295 Bacteria 3176258
190 Ga0209564_1000213 3300025295 Bacteria 132985
191 Ga0209758_1000014 3300025297 Bacteria 871757
192 Ga0209758_1022517 3300025297 Bacteria 2884
193 Ga0209050_1000603 3300025298 Bacteria 57120
194 Ga0209050_1001495 3300025298 Bacteria 24789
195 Ga0209050_1001888 3300025298 Bacteria 20105
196 Ga0209050_1026023 3300025298 Bacteria 1970
197 Ga0209256_1000002 3300025299 Bacteria 1906740
198 Ga0209256_1002292 3300025299 Bacteria 16094
199 Ga0209256_1004498 3300025299 Bacteria 8709
200 Ga0209256_1007996 3300025299 Bacteria 5028
201 Ga0209256_1040932 3300025299 Bacteria 1180
202 Ga0207426_1054761 3300025302 Bacteria 1172
203 Ga0209051_1001112 3300025303 Bacteria 24636
204 Ga0209051_1008525 3300025303 Bacteria 5416
205 Ga0209257_1000062 3300025304 Bacteria 362413
206 Ga0209257_1000122 3300025304 Bacteria 219678
207 Ga0209257_1000217 3300025304 Bacteria 136049
208 Ga0209257_1000243 3300025304 Bacteria 126291
209 Ga0209257_1001409 3300025304 Bacteria 28685
210 Ga0209257_1001747 3300025304 Bacteria 24118
211 Ga0209257_1002061 3300025304 Bacteria 21277
212 Ga0207697_10001596 3300025315 Bacteria 12238
213 Ga0207656_10000282 3300025321 Bacteria 17537
214 Ga0207655_1049487 3300025728 Bacteria 1715
215 Ga0207713_1000327 3300025735 Bacteria 53351
216 Ga0207642_10010727 3300025899 Bacteria 3243
217 Ga0207710_10002180 3300025900 Bacteria 9204
218 Ga0207710_10005312 3300025900 Bacteria 5559
219 Ga0207688_10001775 3300025901 Bacteria 11449
220 Ga0207680_10000618 3300025903 Bacteria 16764
221 Ga0207647_10000971 3300025904 Bacteria 22177
222 Ga0207645_10000048 3300025907 Bacteria 84942
223 Ga0207643_10000122 3300025908 Bacteria 53121
224 Ga0207705_10002690 3300025909 Bacteria 13611
225 Ga0207705_10091151 3300025909 Bacteria 2232
226 Ga0207695_10070094 3300025913 Bacteria 3585
227 Ga0207671_10002485 3300025914 Bacteria 19695
228 Ga0207663_10046160 3300025916 Bacteria 2683
229 Ga0207660_10454099 3300025917 Bacteria 1037
230 Ga0207662_10000265 3300025918 Bacteria 24159
231 Ga0207657_10000091 3300025919 Bacteria 86419
232 Ga0207649_10001088 3300025920 Bacteria 16515
233 Ga0207646_10088847 3300025922 Bacteria 2766
234 Ga0207681_10000696 3300025923 Bacteria 22068
235 Ga0207681_10129243 3300025923 Bacteria 1865
236 Ga0207681_10253784 3300025923 Bacteria 1374
237 Ga0207650_10000831 3300025925 Bacteria 23640
238 Ga0207650_10004381 3300025925 Bacteria 9643
239 Ga0207650_10158098 3300025925 Bacteria 1794
240 Ga0207650_10218226 3300025925 Bacteria 1534
241 Ga0207650_10246237 3300025925 Bacteria 1446
242 Ga0207659_10000335 3300025926 Bacteria 28308
243 Ga0207687_10108946 3300025927 Bacteria 2052
244 Ga0207664_10207997 3300025929 Bacteria 1692
245 Ga0207644_10000651 3300025931 Bacteria 21967
246 Ga0207644_10001250 3300025931 Bacteria 16343
247 Ga0207644_10372624 3300025931 Bacteria 1163
248 Ga0207690_10001654 3300025932 Bacteria 13774
249 Ga0207706_10000753 3300025933 Bacteria 33684
250 Ga0207706_10321204 3300025933 Bacteria 1347
251 Ga0207686_10005878 3300025934 Bacteria 6584
252 Ga0207709_10000562 3300025935 Bacteria 31535
253 Ga0207709_10013019 3300025935 Bacteria 4586
254 Ga0207709_10040468 3300025935 Bacteria 2790
255 Ga0207670_10000412 3300025936 Bacteria 24343
256 Ga0207669_10000372 3300025937 Bacteria 20153
257 Ga0207704_10000994 3300025938 Bacteria 12575
258 Ga0207691_10000058 3300025940 Bacteria 87937
259 Ga0207691_10001348 3300025940 Bacteria 24480
260 Ga0207691_10001351 3300025940 Bacteria 24456
261 Ga0207691_10280120 3300025940 Bacteria 1435
262 Ga0207711_10000401 3300025941 Bacteria 45756
263 Ga0207689_10000636 3300025942 Bacteria 33492
264 Ga0207679_10005224 3300025945 Bacteria 8140
265 Ga0207679_10008833 3300025945 Bacteria 6423
266 Ga0207679_10135097 3300025945 Bacteria 1985
267 Ga0207667_10008470 3300025949 Bacteria 12213
268 Ga0207651_10000315 3300025960 Bacteria 20714
269 Ga0207712_10000518 3300025961 Bacteria 31766
270 Ga0207668_10000761 3300025972 Bacteria 19674
271 Ga0207668_10020163 3300025972 Bacteria 4230
272 Ga0207640_10001807 3300025981 Bacteria 11479
273 Ga0207658_10001028 3300025986 Bacteria 22711
274 Ga0207677_10000116 3300026023 Bacteria 65208
275 Ga0207677_10030917 3300026023 Bacteria 3424
276 Ga0207703_10000226 3300026035 Bacteria 64851
277 Ga0207639_10003726 3300026041 Bacteria 10258
278 Ga0207678_10003479 3300026067 Bacteria 14174
279 Ga0207702_10007041 3300026078 Bacteria 9623
280 Ga0207641_10001536 3300026088 Bacteria 22584
281 Ga0207641_10018128 3300026088 Bacteria 5769
282 Ga0207648_10000769 3300026089 Bacteria 36104
283 Ga0207676_10000570 3300026095 Bacteria 30527
284 Ga0207674_10003927 3300026116 Bacteria 18099
285 Ga0207674_10007691 3300026116 Bacteria 12547
286 Ga0207675_100000045 3300026118 Bacteria 87487
287 Ga0207683_10002376 3300026121 Bacteria 16434
288 Ga0207683_10155613 3300026121 Bacteria 2064
289 Ga0207683_10232195 3300026121 Bacteria 1683
290 Ga0207698_10000612 3300026142 Bacteria 20810
291 Ga0209371_1000007 3300027312 Bacteria 1050654
292 Ga0209371_1000016 3300027312 Bacteria 646301
293 Ga0209984_1012835 3300027424 Bacteria 1095
294 Ga0209999_1001293 3300027543 Bacteria 4291
295 Ga0209982_1002155 3300027552 Bacteria 2740
296 Ga0209983_1007591 3300027665 Bacteria 2222
297 Ga0209971_1001898 3300027682 Bacteria 5116
298 Ga0207428_10161778 3300027907 Bacteria 1699
299 Ga0268266_10000240 3300028379 Bacteria 93100
300 Ga0268266_10152633 3300028379 Bacteria 2083
301 Ga0268265_10001030 3300028380 Bacteria 25149
302 Ga0268264_10000769 3300028381 Bacteria 35484
303 Ga0265319_1000259 3300028563 Bacteria 40074
304 Ga0265318_10000150 3300028577 Bacteria 63092
305 Ga0265318_10002234 3300028577 Bacteria 10439
306 Ga0265338_10047622 3300028800 Bacteria 3913
307 Ga0268256_1000008 3300030500 Bacteria 1050654
308 Ga0268256_1000015 3300030500 Bacteria 646300
309 Ga0316176_1170776 3300030732 Bacteria 2355
310 Ga0314311_1188486 3300030733 Bacteria 7455
311 Ga0316178_1121146 3300030735 Bacteria 2036
312 Ga0316181_1232513 3300030744 Bacteria 2551
313 Ga0316181_1257729 3300030744 Bacteria 2963
314 Ga0265330_10000166 3300031235 Bacteria 52307
315 Ga0265328_10098130 3300031239 Bacteria 1084
316 Ga0265320_10000381 3300031240 Bacteria 35971
317 Ga0265325_10001158 3300031241 Bacteria 18894
318 Ga0265329_10000352 3300031242 Bacteria 24264
319 Ga0265340_10000302 3300031247 Bacteria 25964
320 Ga0265340_10009220 3300031247 Bacteria 5302
321 Ga0265339_10002278 3300031249 Bacteria 13836
322 Ga0265331_10000709 3300031250 Bacteria 28371
323 Ga0265316_10002784 3300031344 Bacteria 17920
324 Ga0265316_10004280 3300031344 Bacteria 14247
325 Ga0307513_10039653 3300031456 Bacteria 5219
326 Ga0307509_10115061 3300031507 Bacteria 2683
327 Ga0307408_100017474 3300031548 Bacteria 4801
328 Ga0307408_100164128 3300031548 Bacteria 1767
329 Ga0307408_100337554 3300031548 Bacteria 1274
330 Ga0265313_10000378 3300031595 Bacteria 48043
331 Ga0265313_10001920 3300031595 Bacteria 18868
332 Ga0265314_10001502 3300031711 Bacteria 25850
333 Ga0265314_10012431 3300031711 Bacteria 6946
334 Ga0265342_10000725 3300031712 Bacteria 34013
335 Ga0316576_10064429 3300031727 Bacteria 2692
336 Ga0316578_10020283 3300031728 Bacteria 3670
337 Ga0307413_10006930 3300031824 Bacteria 5218
338 Ga0307413_10056758 3300031824 Bacteria 2390
339 Ga0307410_10236641 3300031852 Bacteria 1413
340 Ga0307406_10021651 3300031901 Bacteria 3806
341 Ga0307406_10063847 3300031901 Bacteria 2387
342 Ga0307406_10072049 3300031901 Bacteria 2267
343 Ga0307407_10057750 3300031903 Bacteria 2253
344 Ga0307412_10330483 3300031911 Bacteria 1216
345 Ga0307414_10004276 3300032004 Bacteria 7747
346 Ga0307414_10019038 3300032004 Bacteria 4245
347 Ga0307414_10025290 3300032004 Bacteria 3800
348 Ga0307414_10048036 3300032004 Bacteria 2941
349 Ga0307414_10084626 3300032004 Bacteria 2333
350 Ga0307414_10095010 3300032004 Bacteria 2226
351 Ga0307414_10124056 3300032004 Bacteria 1991
352 Ga0307414_10154948 3300032004 Bacteria 1812
353 Ga0307414_10205568 3300032004 Bacteria 1605
354 Ga0307414_10466962 3300032004 Bacteria 1110
355 Ga0307411_10037849 3300032005 Bacteria 3037
356 Ga0307411_10075655 3300032005 Bacteria 2299
357 Ga0307415_100162164 3300032126 Bacteria 1734
358 Ga0373947_0187718 3300035725 Bacteria 1348
359 Ga0373937_0119341 3300036401 Bacteria 2457
360 Ga0373937_0229305 3300036401 Bacteria 1749
361 Ga0395899_0090607 3300037312 Bacteria 2217
362 Ga0395900_0321630 3300037418 Bacteria 1527
363 Ga0395900_0589056 3300037418 Bacteria 1053
364 Ga0395898_0547308 3300037466 Bacteria 1099
365 Ga0395905_0000306 3300037471 Bacteria 71299
366 Ga0395905_0017994 3300037471 Bacteria 6709
367 Ga0395905_0338561 3300037471 Bacteria 1395
368 Ga0395905_0345517 3300037471 Bacteria 1379
369 Ga0436364_1010390 3300037853 Bacteria 973
370 Ga0395901_0002348 3300038443 Bacteria 19240
371 Ga0237819_00617 3300038705 Bacteria 11655
372 Ga0237816_00655 3300039145 Bacteria 2916
373 Ga0436365_1765442 3300039437 Bacteria 1843
374 Ga0436360_1082159 3300039438 Bacteria 1155
375 Ga0439436_0018848 3300041404 Bacteria 2063
376 Ga0439436_0023498 3300041404 Bacteria 1823
377 Ga0439439_0005994 3300041406 Bacteria 2798
378 Ga0439439_0019516 3300041406 Bacteria 1684
379 Ga0439447_011954 3300041407 Bacteria 2513
380 Ga0439465_0001771 3300041413 Bacteria 7065
381 Ga0439465_0003673 3300041413 Bacteria 5004
382 Ga0439465_0004523 3300041413 Bacteria 4496
383 Ga0439465_0037900 3300041413 Bacteria 1551
384 Ga0439465_0090206 3300041413 Bacteria 1048
385 Ga0451797_0382392 3300041453 Bacteria 2235
386 Ga0451795_0443075 3300041456 Bacteria 2692
387 Ga0451798_0406233 3300041458 Bacteria 997
388 Ga0451800_0326958 3300041459 Bacteria 1533
389 Ga0451806_516753 3300041462 Bacteria 2838
390 Ga0451807_0785375 3300041486 Bacteria 2328
391 Ga0451837_0162876 3300041494 Bacteria 1577
392 Ga0451837_0572425 3300041494 Bacteria 1548
393 Ga0451837_0578947 3300041494 Bacteria 1728
394 Ga0451837_0713293 3300041494 Bacteria 1051
395 Ga0451837_0773876 3300041494 Bacteria 3398
396 Ga0451841_1303890 3300041498 Bacteria 3644
397 Ga0451843_1035942 3300041509 Bacteria 2951
398 Ga0439431_0018601 3300041997 Bacteria 1645
399 Ga0439432_005521 3300042006 Bacteria 4549
400 Ga0439432_016258 3300042006 Bacteria 2506
401 Ga0439449_0000156 3300042007 Bacteria 23254
402 Ga0439449_0012229 3300042007 Bacteria 3226
403 Ga0439449_0012427 3300042007 Bacteria 3200
404 Ga0439449_0016777 3300042007 Bacteria 2751
405 Ga0439449_0032165 3300042007 Bacteria 1955
406 Ga0439450_007998 3300042008 Bacteria 1959
407 Ga0439455_0001840 3300042012 Bacteria 3702
408 Ga0450901_003263 3300042533 Bacteria 1703
409 Ga0451577_0042380 3300042876 Bacteria 4083
410 Ga0466966_0059036 3300044684 Bacteria 2423
411 Ga0453684_0014277 3300044712 Bacteria 12736
412 Ga0453684_0072777 3300044712 Bacteria 4337
413 Ga0495638_0001842 3300046460 Bacteria 18352
414 Ga0495638_0051744 3300046460 Bacteria 2561
415 Ga0495606_0086909 3300046507 Bacteria 1931
416 Ga0495610_0004733 3300046512 Bacteria 9931
417 Ga0495631_0002006 3300046518 Bacteria 11866
418 Ga0495643_0001695 3300046522 Bacteria 19192
419 Ga0495663_0001507 3300046525 Bacteria 7317
420 Ga0495663_0007487 3300046525 Bacteria 3018
421 Ga0495663_0030882 3300046525 Bacteria 1589
422 Ga0495598_0000742 3300046537 Bacteria 6218
423 Ga0495621_0004671 3300046539 Bacteria 3873
424 Ga0495622_0060002 3300046557 Bacteria 1761
425 Ga0495633_0016986 3300046558 Bacteria 3733
426 Ga0495656_0009800 3300046615 Bacteria 3458
427 Ga0495656_0033683 3300046615 Bacteria 2092
428 Ga0495659_0142024 3300046664 Bacteria 959
429 Ga0495671_0010539 3300046692 Bacteria 5113
430 Ga0495636_0003452 3300047318 Bacteria 6132
431 Ga0495636_0008887 3300047318 Bacteria 3956
432 Ga0495636_0014005 3300047318 Bacteria 3187
433 Ga0495636_0044107 3300047318 Bacteria 1856
434 Ga0495672_0000073 3300047320 Bacteria 179398
435 Ga0495686_0025032 3300047472 Bacteria 3914
436 Ga0495686_0026392 3300047472 Bacteria 3800
437 Ga0496101_0087253 3300048904 Bacteria 2316
438 Ga0496101_0177725 3300048904 Bacteria 1638
439 Ga0496102_0004532 3300048905 Bacteria 11741
440 Ga0496106_0001090 3300048909 Bacteria 20066
441 Ga0496106_0030699 3300048909 Bacteria 4006
442 Ga0496107_0044662 3300048910 Bacteria 3186
443 Ga0496108_0090168 3300048911 Bacteria 2606
444 Ga0496109_0038143 3300048912 Bacteria 4343
445 Ga0496109_0090422 3300048912 Bacteria 2831
446 Ga0496112_0008685 3300048915 Bacteria 9111
447 Ga0496114_0006407 3300048917 Bacteria 9269
448 Ga0496115_0237052 3300048918 Bacteria 1504
449 Ga0496117_0002324 3300048920 Bacteria 24332
450 Ga0496117_0002722 3300048920 Bacteria 21720
451 Ga0496117_0090355 3300048920 Bacteria 1973
452 Ga0496118_0000344 3300048921 Bacteria 78989
453 Ga0496118_0001379 3300048921 Bacteria 36605
454 Ga0496118_0013072 3300048921 Bacteria 7892
455 Ga0496118_0018080 3300048921 Bacteria 6379
456 Ga0496118_0070648 3300048921 Bacteria 2519
457 Ga0496119_0003326 3300048922 Bacteria 16773
458 Ga0496119_0014839 3300048922 Bacteria 6059
459 Ga0496119_0131850 3300048922 Bacteria 1361
460 Ga0496120_0002285 3300048923 Bacteria 19880
461 Ga0496120_0003024 3300048923 Bacteria 15923
462 Ga0496121_0006284 3300048924 Bacteria 14851
463 Ga0496121_0008043 3300048924 Bacteria 12572
464 Ga0496122_0003858 3300048925 Bacteria 19242
465 Ga0496122_0005074 3300048925 Bacteria 15901
466 Ga0496122_0008107 3300048925 Bacteria 11448
467 Ga0496122_0039435 3300048925 Bacteria 3766
468 Ga0496122_0041940 3300048925 Bacteria 3608
469 Ga0496122_0042161 3300048925 Bacteria 3594
470 Ga0496122_0114519 3300048925 Bacteria 1759
471 Ga0496123_0000669 3300048926 Bacteria 56717
472 Ga0496123_0004123 3300048926 Bacteria 15561
473 Ga0496123_0009080 3300048926 Bacteria 9004
474 Ga0496123_0013609 3300048926 Bacteria 6811
475 Ga0496123_0033730 3300048926 Bacteria 3678
476 Ga0496124_0000009 3300048927 Bacteria 734820
477 Ga0496124_0003480 3300048927 Bacteria 19168
478 Ga0496124_0004112 3300048927 Bacteria 17192
479 Ga0496124_0007146 3300048927 Bacteria 11949
480 Ga0496124_0014062 3300048927 Bacteria 7763
481 Ga0496124_0014864 3300048927 Bacteria 7499
482 Ga0496124_0022002 3300048927 Bacteria 5860
483 Ga0496125_0004477 3300048928 Bacteria 16098
484 Ga0496125_0049749 3300048928 Bacteria 3478
485 Ga0496125_0053334 3300048928 Bacteria 3315
486 Ga0496126_0051425 3300048929 Bacteria 3750
487 Ga0501290_000334 3300049513 Bacteria 7750
488 Ga0501031_0015466 3300049568 Bacteria 4954
489 Ga0501031_0040249 3300049568 Bacteria 3051
490 Ga0501032_0003474 3300049569 Bacteria 12065
491 Ga0501033_0002438 3300049570 Bacteria 15799
492 Ga0501034_0000122 3300049571 Bacteria 144085
493 Ga0501034_0001021 3300049571 Bacteria 40111
494 Ga0501034_0002909 3300049571 Bacteria 19882
495 Ga0501034_0007363 3300049571 Bacteria 11724
496 Ga0501034_0087102 3300049571 Bacteria 3123
497 Ga0501036_0120311 3300049572 Bacteria 2217
498 Ga0501037_0030670 3300049573 Bacteria 3972
499 Ga0501037_0061087 3300049573 Bacteria 2748
500 Ga0501038_0005011 3300049574 Bacteria 12292
501 Ga0501038_0046025 3300049574 Bacteria 3784
502 Ga0501039_0031363 3300049575 Bacteria 4097
503 Ga0501043_0006239 3300049579 Bacteria 9571
504 Ga0501043_0026118 3300049579 Bacteria 4582
505 Ga0501047_0068457 3300049581 Bacteria 3419
506 Ga0501047_0178552 3300049581 Bacteria 1990
507 Ga0501070_0009112 3300049586 Bacteria 8394
508 Ga0501070_0138686 3300049586 Bacteria 2008
509 Ga0501071_0094032 3300049587 Bacteria 2204
510 Ga0501073_0015658 3300049589 Bacteria 5499
511 Ga0501225_0016531 3300049705 Bacteria 2052
512 Ga0501080_0105402 3300049742 Bacteria 2614
513 Ga0501241_002421 3300049758 Bacteria 3605
514 Ga0501265_001185 3300049762 Bacteria 2944
515 Ga0501266_003663 3300049763 Bacteria 1903
516 Ga0501275_000033 3300049772 Bacteria 14296
517 Ga0501035_0104849 3300049822 Bacteria 2479
518 Ga0501044_0046980 3300049823 Bacteria 4467
519 Ga0501044_0420528 3300049823 Bacteria 1246
520 nmdc:mga00v17_202_c2 3300050491 Bacteria 31082
521 nmdc:mga00v17_55844_c1 3300050491 Bacteria 2413
522 nmdc:mga08y16_277275_c1 3300050511 Bacteria 1730
523 nmdc:mga08y16_41561_c1 3300050511 Bacteria 4816
524 nmdc:mga08y16_449515_c1 3300050511 Bacteria 1314
525 nmdc:mga0rr50_155503_c1 3300050513 Bacteria 1852
526 Ga0500634_0000048 3300053161 Bacteria 55497
527 Ga0500565_002311 3300053734 Bacteria 1411

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0090206 Ga0439465_0090206_41_766 234
2 3300041997 Ga0439431_0018601 Ga0439431_0018601_906_1631 234
3 3300039438 Ga0436360_1082159 Ga0436360_1082159_13_807 250
4 3300048918 Ga0496115_0237052 Ga0496115_0237052_692_1471 259
5 3300009094 Ga0111539_10554299 Ga0111539_105542992 263
6 3300050511 nmdc:mga08y16_449515_c1 nmdc:mga08y16_449515_c1_373_1221 263
7 3300039437 Ga0436365_1765442 Ga0436365_1765442_177_1028 264
8 3300044684 Ga0466966_0059036 Ga0466966_0059036_403_1332 264
9 3300013296 Ga0157374_10341588 Ga0157374_103415882 274
10 3300037853 Ga0436364_1010390 Ga0436364_1010390_49_885 275
11 3300031711 Ga0265314_10012431 Ga0265314_100124313 276
12 3300046557 Ga0495622_0060002 Ga0495622_0060002_470_1309 276
13 3300005329 Ga0070683_100601705 Ga0070683_1006017052 277
14 3300005543 Ga0070672_100004233 Ga0070672_1000042336 277
15 3300006844 Ga0075428_100145594 Ga0075428_1001455942 277
16 3300010375 Ga0105239_10663386 Ga0105239_106633861 277
17 3300025940 Ga0207691_10001348 Ga0207691_100013486 277
18 3300031727 Ga0316576_10064429 Ga0316576_100644292 277
19 3300031728 Ga0316578_10020283 Ga0316578_100202832 277
20 3300031901 Ga0307406_10063847 Ga0307406_100638472 277
21 3300048920 Ga0496117_0090355 Ga0496117_0090355_270_1136 277
22 3300048922 Ga0496119_0014839 Ga0496119_0014839_2781_3647 277
23 3300048923 Ga0496120_0003024 Ga0496120_0003024_2336_3202 277
24 3300003322 rootL2_10284264 rootL2_102842642 278
25 3300028563 Ga0265319_1000259 Ga0265319_10002598 278
26 3300028577 Ga0265318_10000150 Ga0265318_1000015012 278
27 3300028577 Ga0265318_10002234 Ga0265318_100022346 278
28 3300028800 Ga0265338_10047622 Ga0265338_100476224 278
29 3300031235 Ga0265330_10000166 Ga0265330_1000016614 278
30 3300031239 Ga0265328_10098130 Ga0265328_100981301 278
31 3300031240 Ga0265320_10000381 Ga0265320_1000038110 278
32 3300031241 Ga0265325_10001158 Ga0265325_100011584 278
33 3300031242 Ga0265329_10000352 Ga0265329_100003527 278
34 3300031247 Ga0265340_10000302 Ga0265340_1000030210 278
35 3300031247 Ga0265340_10009220 Ga0265340_100092202 278
36 3300031249 Ga0265339_10002278 Ga0265339_1000227810 278
37 3300031250 Ga0265331_10000709 Ga0265331_100007096 278
38 3300031344 Ga0265316_10002784 Ga0265316_1000278410 278
39 3300031344 Ga0265316_10004280 Ga0265316_100042805 278
40 3300031595 Ga0265313_10000378 Ga0265313_1000037818 278
41 3300031595 Ga0265313_10001920 Ga0265313_100019205 278
42 3300031711 Ga0265314_10001502 Ga0265314_1000150221 278
43 3300031712 Ga0265342_10000725 Ga0265342_1000072518 278
44 3300037471 Ga0395905_0345517 Ga0395905_0345517_141_1004 278
45 3300049513 Ga0501290_000334 Ga0501290_000334_1722_2573 278
46 3300005331 Ga0070670_100351385 Ga0070670_1003513852 279
47 3300005338 Ga0068868_100008917 Ga0068868_1000089173 279
48 3300005468 Ga0070707_100420902 Ga0070707_1004209022 279
49 3300005841 Ga0068863_100013509 Ga0068863_1000135094 279
50 3300006237 Ga0097621_100038064 Ga0097621_1000380643 279
51 3300006358 Ga0068871_100045248 Ga0068871_1000452482 279
52 3300009176 Ga0105242_10061274 Ga0105242_100612743 279
53 3300014969 Ga0157376_10391798 Ga0157376_103917982 279
54 3300025922 Ga0207646_10088847 Ga0207646_100888472 279
55 3300025925 Ga0207650_10218226 Ga0207650_102182262 279
56 3300026023 Ga0207677_10030917 Ga0207677_100309172 279
57 3300026088 Ga0207641_10018128 Ga0207641_100181283 279
58 3300036401 Ga0373937_0119341 Ga0373937_0119341_205_1086 279
59 3300007076 Ga0075435_100047690 Ga0075435_1000476902 280
60 3300009094 Ga0111539_10055715 Ga0111539_100557154 280
61 3300048922 Ga0496119_0131850 Ga0496119_0131850_84_977 280
62 3300050511 nmdc:mga08y16_41561_c1 nmdc:mga08y16_41561_c1_2456_3346 280
63 3300050513 nmdc:mga0rr50_155503_c1 nmdc:mga0rr50_155503_c1_896_1789 280
64 3300013102 Ga0157371_10243859 Ga0157371_102438592 281
65 3300044712 Ga0453684_0014277 Ga0453684_0014277_269_1135 281
66 3300048904 Ga0496101_0177725 Ga0496101_0177725_26_877 281
67 3300048925 Ga0496122_0114519 Ga0496122_0114519_433_1323 281
68 3300049758 Ga0501241_002421 Ga0501241_002421_2210_3055 281
69 3300042007 Ga0439449_0016777 Ga0439449_0016777_1676_2539 282
70 3300002074 JGI24748J21848_1001571 JGI24748J21848_10015713 283
71 3300002239 JGI24034J26672_10010741 JGI24034J26672_100107412 283
72 3300002459 JGI24751J29686_10013157 JGI24751J29686_100131573 283
73 3300003659 JGI25404J52841_10001389 JGI25404J52841_100013893 283
74 3300003659 JGI25404J52841_10001494 JGI25404J52841_100014944 283
75 3300005327 Ga0070658_10003169 Ga0070658_1000316911 283
76 3300005328 Ga0070676_10000823 Ga0070676_100008234 283
77 3300005330 Ga0070690_100001047 Ga0070690_10000104711 283
78 3300005334 Ga0068869_100001783 Ga0068869_1000017833 283
79 3300005335 Ga0070666_10006883 Ga0070666_100068837 283
80 3300005339 Ga0070660_100003148 Ga0070660_1000031483 283
81 3300005340 Ga0070689_100002391 Ga0070689_1000023914 283
82 3300005343 Ga0070687_100000482 Ga0070687_1000004824 283
83 3300005344 Ga0070661_100002001 Ga0070661_10000200112 283
84 3300005353 Ga0070669_100001422 Ga0070669_10000142213 283
85 3300005355 Ga0070671_100003509 Ga0070671_1000035093 283
86 3300005356 Ga0070674_100001692 Ga0070674_1000016928 283
87 3300005364 Ga0070673_100001060 Ga0070673_1000010604 283
88 3300005365 Ga0070688_100001262 Ga0070688_1000012624 283
89 3300005366 Ga0070659_100002780 Ga0070659_1000027804 283
90 3300005367 Ga0070667_100024566 Ga0070667_1000245662 283
91 3300005438 Ga0070701_10001351 Ga0070701_100013518 283
92 3300005439 Ga0070711_100176182 Ga0070711_1001761822 283
93 3300005440 Ga0070705_100002638 Ga0070705_1000026384 283
94 3300005455 Ga0070663_100133435 Ga0070663_1001334351 283
95 3300005456 Ga0070678_100001920 Ga0070678_1000019203 283
96 3300005456 Ga0070678_100128413 Ga0070678_1001284133 283
97 3300005457 Ga0070662_100001874 Ga0070662_1000018744 283
98 3300005466 Ga0070685_10001698 Ga0070685_100016984 283
99 3300005530 Ga0070679_100023473 Ga0070679_1000234732 283
100 3300005539 Ga0068853_100000493 Ga0068853_10000049323 283
101 3300005543 Ga0070672_100002883 Ga0070672_10000288310 283
102 3300005544 Ga0070686_100003027 Ga0070686_1000030274 283
103 3300005546 Ga0070696_100014261 Ga0070696_1000142614 283
104 3300005547 Ga0070693_100000733 Ga0070693_1000007336 283
105 3300005549 Ga0070704_100033595 Ga0070704_1000335952 283
106 3300005563 Ga0068855_100006770 Ga0068855_1000067704 283
107 3300005564 Ga0070664_100004932 Ga0070664_1000049327 283
108 3300005564 Ga0070664_100005223 Ga0070664_1000052238 283
109 3300005577 Ga0068857_100009400 Ga0068857_1000094002 283
110 3300005577 Ga0068857_100027014 Ga0068857_1000270142 283
111 3300005578 Ga0068854_100001701 Ga0068854_10000170111 283
112 3300005614 Ga0068856_100004173 Ga0068856_1000041734 283
113 3300005616 Ga0068852_100002227 Ga0068852_1000022274 283
114 3300005617 Ga0068859_100007196 Ga0068859_1000071963 283
115 3300005618 Ga0068864_100002312 Ga0068864_1000023123 283
116 3300005719 Ga0068861_100001305 Ga0068861_10000130513 283
117 3300005834 Ga0068851_10000877 Ga0068851_100008774 283
118 3300005840 Ga0068870_10000916 Ga0068870_100009164 283
119 3300005843 Ga0068860_100005121 Ga0068860_10000512111 283
120 3300005983 Ga0081540_1000988 Ga0081540_100098815 283
121 3300006237 Ga0097621_100004336 Ga0097621_1000043366 283
122 3300006358 Ga0068871_100030519 Ga0068871_1000305193 283
123 3300006881 Ga0068865_100001849 Ga0068865_1000018493 283
124 3300006931 Ga0097620_100007195 Ga0097620_1000071953 283
125 3300009093 Ga0105240_10003240 Ga0105240_1000324017 283
126 3300009094 Ga0111539_10337812 Ga0111539_103378122 283
127 3300009098 Ga0105245_10004441 Ga0105245_100044414 283
128 3300009101 Ga0105247_10001559 Ga0105247_100015599 283
129 3300009101 Ga0105247_10003375 Ga0105247_100033753 283
130 3300009174 Ga0105241_10092460 Ga0105241_100924603 283
131 3300009176 Ga0105242_10000383 Ga0105242_100003838 283
132 3300009177 Ga0105248_10001684 Ga0105248_1000168410 283
133 3300009545 Ga0105237_10001653 Ga0105237_1000165310 283
134 3300009551 Ga0105238_10006399 Ga0105238_100063998 283
135 3300009553 Ga0105249_10000236 Ga0105249_1000023660 283
136 3300010375 Ga0105239_10005084 Ga0105239_1000508413 283
137 3300013100 Ga0157373_10005972 Ga0157373_100059727 283
138 3300013102 Ga0157371_10000875 Ga0157371_1000087526 283
139 3300013105 Ga0157369_10000652 Ga0157369_1000065211 283
140 3300013296 Ga0157374_10001223 Ga0157374_1000122311 283
141 3300013297 Ga0157378_10000522 Ga0157378_1000052211 283
142 3300013306 Ga0163162_10001916 Ga0163162_1000191610 283
143 3300013308 Ga0157375_10000635 Ga0157375_1000063523 283
144 3300014325 Ga0163163_10003411 Ga0163163_1000341110 283
145 3300014326 Ga0157380_10035235 Ga0157380_100352352 283
146 3300014745 Ga0157377_10000157 Ga0157377_100001578 283
147 3300014968 Ga0157379_10000177 Ga0157379_1000017711 283
148 3300025315 Ga0207697_10001596 Ga0207697_1000159610 283
149 3300025321 Ga0207656_10000282 Ga0207656_1000028210 283
150 3300025899 Ga0207642_10010727 Ga0207642_100107273 283
151 3300025900 Ga0207710_10002180 Ga0207710_100021808 283
152 3300025900 Ga0207710_10005312 Ga0207710_100053122 283
153 3300025901 Ga0207688_10001775 Ga0207688_100017752 283
154 3300025903 Ga0207680_10000618 Ga0207680_100006186 283
155 3300025904 Ga0207647_10000971 Ga0207647_1000097117 283
156 3300025907 Ga0207645_10000048 Ga0207645_1000004875 283
157 3300025908 Ga0207643_10000122 Ga0207643_1000012243 283
158 3300025909 Ga0207705_10002690 Ga0207705_100026905 283
159 3300025913 Ga0207695_10070094 Ga0207695_100700942 283
160 3300025914 Ga0207671_10002485 Ga0207671_1000248511 283
161 3300025916 Ga0207663_10046160 Ga0207663_100461602 283
162 3300025918 Ga0207662_10000265 Ga0207662_1000026514 283
163 3300025919 Ga0207657_10000091 Ga0207657_1000009111 283
164 3300025920 Ga0207649_10001088 Ga0207649_1000108810 283
165 3300025923 Ga0207681_10000696 Ga0207681_1000069611 283
166 3300025925 Ga0207650_10000831 Ga0207650_1000083111 283
167 3300025926 Ga0207659_10000335 Ga0207659_1000033512 283
168 3300025927 Ga0207687_10108946 Ga0207687_101089462 283
169 3300025931 Ga0207644_10000651 Ga0207644_1000065112 283
170 3300025932 Ga0207690_10001654 Ga0207690_1000165411 283
171 3300025933 Ga0207706_10000753 Ga0207706_1000075325 283
172 3300025934 Ga0207686_10005878 Ga0207686_100058785 283
173 3300025935 Ga0207709_10013019 Ga0207709_100130193 283
174 3300025936 Ga0207670_10000412 Ga0207670_1000041212 283
175 3300025937 Ga0207669_10000372 Ga0207669_1000037210 283
176 3300025938 Ga0207704_10000994 Ga0207704_1000099413 283
177 3300025940 Ga0207691_10000058 Ga0207691_1000005875 283
178 3300025941 Ga0207711_10000401 Ga0207711_1000040139 283
179 3300025942 Ga0207689_10000636 Ga0207689_1000063625 283
180 3300025945 Ga0207679_10005224 Ga0207679_100052243 283
181 3300025945 Ga0207679_10008833 Ga0207679_100088337 283
182 3300025949 Ga0207667_10008470 Ga0207667_1000847011 283
183 3300025960 Ga0207651_10000315 Ga0207651_1000031511 283
184 3300025961 Ga0207712_10000518 Ga0207712_1000051812 283
185 3300025972 Ga0207668_10000761 Ga0207668_1000076110 283
186 3300025981 Ga0207640_10001807 Ga0207640_100018072 283
187 3300025986 Ga0207658_10001028 Ga0207658_1000102818 283
188 3300026023 Ga0207677_10000116 Ga0207677_1000011613 283
189 3300026035 Ga0207703_10000226 Ga0207703_1000022657 283
190 3300026041 Ga0207639_10003726 Ga0207639_100037263 283
191 3300026067 Ga0207678_10003479 Ga0207678_1000347913 283
192 3300026078 Ga0207702_10007041 Ga0207702_100070416 283
193 3300026088 Ga0207641_10001536 Ga0207641_1000153611 283
194 3300026089 Ga0207648_10000769 Ga0207648_1000076911 283
195 3300026095 Ga0207676_10000570 Ga0207676_1000057011 283
196 3300026116 Ga0207674_10003927 Ga0207674_100039277 283
197 3300026116 Ga0207674_10007691 Ga0207674_100076914 283
198 3300026118 Ga0207675_100000045 Ga0207675_10000004512 283
199 3300026121 Ga0207683_10002376 Ga0207683_100023764 283
200 3300026121 Ga0207683_10155613 Ga0207683_101556133 283
201 3300026142 Ga0207698_10000612 Ga0207698_1000061211 283
202 3300027907 Ga0207428_10161778 Ga0207428_101617782 283
203 3300028379 Ga0268266_10000240 Ga0268266_1000024010 283
204 3300028380 Ga0268265_10001030 Ga0268265_1000103011 283
205 3300028381 Ga0268264_10000769 Ga0268264_1000076929 283
206 3300035725 Ga0373947_0187718 Ga0373947_0187718_388_1251 283
207 3300041494 Ga0451837_0713293 Ga0451837_0713293_77_931 283
208 3300042008 Ga0439450_007998 Ga0439450_007998_856_1719 283
209 3300042012 Ga0439455_0001840 Ga0439455_0001840_264_1127 283
210 3300042876 Ga0451577_0042380 Ga0451577_0042380_1113_1976 283
211 3300044712 Ga0453684_0072777 Ga0453684_0072777_3168_4061 283
212 3300048905 Ga0496102_0004532 Ga0496102_0004532_2021_2884 283
213 3300048909 Ga0496106_0001090 Ga0496106_0001090_9460_10323 283
214 3300048910 Ga0496107_0044662 Ga0496107_0044662_316_1179 283
215 3300048911 Ga0496108_0090168 Ga0496108_0090168_870_1733 283
216 3300048912 Ga0496109_0090422 Ga0496109_0090422_1653_2516 283
217 3300048915 Ga0496112_0008685 Ga0496112_0008685_1316_2179 283
218 3300048925 Ga0496122_0005074 Ga0496122_0005074_2078_2938 283
219 3300048926 Ga0496123_0004123 Ga0496123_0004123_1952_2812 283
220 3300048928 Ga0496125_0053334 Ga0496125_0053334_126_989 283
221 3300050511 nmdc:mga08y16_277275_c1 nmdc:mga08y16_277275_c1_684_1547 283
222 3300031507 Ga0307509_10115061 Ga0307509_101150613 284
223 3300038705 Ga0237819_00617 Ga0237819_00617_207_1079 284
224 3300049571 Ga0501034_0002909 Ga0501034_0002909_9846_10733 284
225 iso_pu_bacteria 2842757796 2842760618 284
226 3300031901 Ga0307406_10072049 Ga0307406_100720492 285
227 3300036401 Ga0373937_0229305 Ga0373937_0229305_371_1240 285
228 3300041462 Ga0451806_516753 Ga0451806_516753_608_1477 285
229 3300041486 Ga0451807_0785375 Ga0451807_0785375_214_1083 285
230 3300048921 Ga0496118_0070648 Ga0496118_0070648_813_1703 285
231 iso_pu_bacteria 2547132130 2547500017 285
232 iso_pu_bacteria 2747842428 2747948104 285
233 iso_pu_bacteria 2765235840 2765579889 285
234 iso_pu_bacteria 2816332141 2816519068 285
235 iso_pu_bacteria 2842391507 2842394852 285
236 iso_pu_bacteria 2874220319 2874222572 285
237 iso_pu_bacteria 2919089067 2919090513 285
238 iso_pu_bacteria 2919134579 2919137554 285
239 iso_pu_bacteria 2919513703 2919516122 285
240 iso_pu_bacteria 2919675420 2919677954 285
241 iso_pu_bacteria 2928496128 2928498348 285
242 iso_pu_bacteria 2931380184 2931383971 285
243 iso_pu_bacteria 2937610967 2937614469 285
244 iso_pu_bacteria 2939626828 2939628317 285
245 iso_pu_bacteria 2961047084 2961049337 285
246 iso_pu_bacteria 2961064222 2961065971 285
247 iso_pu_bacteria 2576861471 2578457593 286
248 iso_pu_bacteria 2852649853 2852650010 286
249 iso_pu_bacteria 2857442823 2857445550 286
250 iso_pu_bacteria 2939589442 2939591115 286
251 iso_pu_bacteria 2939622612 2939624609 286
252 iso_pu_bacteria 2941475908 2941476646 286
253 iso_pu_bacteria 2941489479 2941491140 286
254 iso_pu_bacteria 2974307012 2974308213 286
255 iso_pu_bacteria 2977247770 2977248971 286
256 iso_pu_bacteria 2984514374 2984516578 286
257 iso_pu_bacteria 2987605356 2987607370 286
258 iso_pu_bacteria 2995948881 2995952071 286
259 iso_pu_bacteria 2571042365 2572253562 287
260 iso_pu_bacteria 2643221559 2643815267 287
261 iso_pu_bacteria 2643221573 2643879306 287
262 iso_pu_bacteria 2643221579 2643908752 287
263 iso_pu_bacteria 2643221581 2643916180 287
264 iso_pu_bacteria 2643221586 2643939945 287
265 iso_pu_bacteria 2643221593 2643976192 287
266 iso_pu_bacteria 2643221612 2644077003 287
267 iso_pu_bacteria 2643221695 2644528898 287
268 iso_pu_bacteria 2643221720 2644660605 287
269 iso_pu_bacteria 2643221727 2644695317 287
270 iso_pu_bacteria 2643221728 2644697966 287
271 iso_pu_bacteria 2747842501 2748018289 287
272 iso_pu_bacteria 2842780639 2842781110 287
273 iso_pu_bacteria 2895498888 2895500817 287
274 iso_pu_bacteria 2895511927 2895516313 287
275 iso_pu_bacteria 2895522137 2895523768 287
276 iso_pu_bacteria 2895525241 2895526651 287
277 iso_pu_bacteria 2923516293 2923517962 287
278 iso_pu_bacteria 8003014200 8003014577 287
279 iso_pu_bacteria 8021622325 8021624514 287
280 iso_pu_bacteria 8021626552 8021627618 287
281 iso_pu_bacteria 8021648035 8021650741 287
282 3300012510 Ga0157316_1000157 Ga0157316_10001573 288
283 3300012512 Ga0157327_1001218 Ga0157327_10012182 288
284 3300013307 Ga0157372_10010891 Ga0157372_100108911 288
285 3300031548 Ga0307408_100164128 Ga0307408_1001641282 288
286 3300032005 Ga0307411_10075655 Ga0307411_100756553 288
287 3300032126 Ga0307415_100162164 Ga0307415_1001621642 288
288 3300042533 Ga0450901_003263 Ga0450901_003263_286_1161 288
289 3300046525 Ga0495663_0030882 Ga0495663_0030882_244_1119 288
290 3300046558 Ga0495633_0016986 Ga0495633_0016986_1101_1979 288
291 3300046615 Ga0495656_0033683 Ga0495656_0033683_843_1754 288
292 3300047318 Ga0495636_0014005 Ga0495636_0014005_2082_2993 288
293 3300048909 Ga0496106_0030699 Ga0496106_0030699_687_1598 288
294 3300049763 Ga0501266_003663 Ga0501266_003663_909_1787 288
295 3300053161 Ga0500634_0000048 Ga0500634_0000048_21358_22236 288
296 iso_pu_bacteria 2818991457 2819660075 288
297 iso_pu_bacteria 2852684882 2852685109 288
298 iso_pu_bacteria 2919130084 2919130649 288
299 iso_pu_bacteria 2929195423 2929198348 288
300 3300003856 Ga0058692_1000011 Ga0058692_10000117 289
301 3300005347 Ga0070668_100101898 Ga0070668_1001018982 289
302 3300006051 Ga0075364_10305274 Ga0075364_103052741 289
303 3300009036 Ga0105244_10101697 Ga0105244_101016971 289
304 3300009148 Ga0105243_10004714 Ga0105243_100047145 289
305 3300013102 Ga0157371_10002975 Ga0157371_100029756 289
306 3300013105 Ga0157369_10022183 Ga0157369_100221833 289
307 3300016635 Ga0183361_12046 Ga0183361_120461 289
308 3300025292 Ga0209676_1000117 Ga0209676_1000117163 289
309 3300025298 Ga0209050_1026023 Ga0209050_10260232 289
310 3300025925 Ga0207650_10246237 Ga0207650_102462372 289
311 3300025935 Ga0207709_10000562 Ga0207709_100005629 289
312 3300025972 Ga0207668_10020163 Ga0207668_100201632 289
313 3300027312 Ga0209371_1000007 Ga0209371_1000007402 289
314 3300028379 Ga0268266_10152633 Ga0268266_101526332 289
315 3300030500 Ga0268256_1000008 Ga0268256_1000008548 289
316 3300030744 Ga0316181_1232513 Ga0316181_12325131 289
317 3300031911 Ga0307412_10330483 Ga0307412_103304832 289
318 3300032004 Ga0307414_10025290 Ga0307414_100252902 289
319 3300032004 Ga0307414_10048036 Ga0307414_100480363 289
320 3300041494 Ga0451837_0572425 Ga0451837_0572425_605_1486 289
321 3300046525 Ga0495663_0007487 Ga0495663_0007487_1277_2176 289
322 3300046539 Ga0495621_0004671 Ga0495621_0004671_1272_2159 289
323 3300050491 nmdc:mga00v17_55844_c1 nmdc:mga00v17_55844_c1_340_1221 289
324 3300003771 Ga0055526_1000021 Ga0055526_100002160 290
325 3300003773 Ga0055537_1000141 Ga0055537_100014139 290
326 3300003773 Ga0055537_1000215 Ga0055537_100021519 290
327 3300003775 Ga0055524_1000128 Ga0055524_100012818 290
328 3300003775 Ga0055524_1014005 Ga0055524_10140052 290
329 3300003775 Ga0055524_1036672 Ga0055524_10366722 290
330 3300003784 Ga0055534_1000054 Ga0055534_100005418 290
331 3300003784 Ga0055534_1000086 Ga0055534_100008676 290
332 3300003784 Ga0055534_1002749 Ga0055534_10027492 290
333 3300003790 Ga0055528_1000009 Ga0055528_100000960 290
334 3300003790 Ga0055528_1000761 Ga0055528_100076114 290
335 3300003791 Ga0055530_10001109 Ga0055530_1000110912 290
336 3300003791 Ga0055530_10002002 Ga0055530_100020022 290
337 3300003794 Ga0055531_10003842 Ga0055531_100038424 290
338 3300005548 Ga0070665_100163191 Ga0070665_1001631911 290
339 3300009036 Ga0105244_10073322 Ga0105244_100733222 290
340 3300013102 Ga0157371_10000154 Ga0157371_100001549 290
341 3300013104 Ga0157370_10006946 Ga0157370_100069464 290
342 3300014497 Ga0182008_10000142 Ga0182008_1000014213 290
343 3300015262 Ga0182007_10000287 Ga0182007_1000028712 290
344 3300015265 Ga0182005_1000388 Ga0182005_100038815 290
345 3300015689 Ga0183360_10001 Ga0183360_100011168 290
346 3300017792 Ga0163161_10001350 Ga0163161_100013506 290
347 3300025263 Ga0209565_1000022 Ga0209565_1000022306 290
348 3300025263 Ga0209565_1000048 Ga0209565_100004861 290
349 3300025273 Ga0209673_1000001 Ga0209673_10000012633 290
350 3300025273 Ga0209673_1000104 Ga0209673_100010453 290
351 3300025284 Ga0209130_1013338 Ga0209130_10133381 290
352 3300025291 Ga0209675_1000045 Ga0209675_1000045105 290
353 3300025291 Ga0209675_1000048 Ga0209675_1000048191 290
354 3300025292 Ga0209676_1000091 Ga0209676_1000091176 290
355 3300025292 Ga0209676_1001624 Ga0209676_10016249 290
356 3300025295 Ga0209564_1000001 Ga0209564_100000161 290
357 3300025295 Ga0209564_1000213 Ga0209564_100021367 290
358 3300025298 Ga0209050_1001495 Ga0209050_100149512 290
359 3300025298 Ga0209050_1001888 Ga0209050_100188810 290
360 3300025299 Ga0209256_1000002 Ga0209256_10000021491 290
361 3300025299 Ga0209256_1004498 Ga0209256_10044986 290
362 3300025299 Ga0209256_1007996 Ga0209256_10079965 290
363 3300025303 Ga0209051_1001112 Ga0209051_100111211 290
364 3300025304 Ga0209257_1000062 Ga0209257_100006231 290
365 3300025304 Ga0209257_1001747 Ga0209257_100174714 290
366 3300025304 Ga0209257_1002061 Ga0209257_10020619 290
367 3300025728 Ga0207655_1049487 Ga0207655_10494872 290
368 3300025923 Ga0207681_10253784 Ga0207681_102537841 290
369 3300030732 Ga0316176_1170776 Ga0316176_11707762 290
370 3300032004 Ga0307414_10084626 Ga0307414_100846262 290
371 3300032004 Ga0307414_10124056 Ga0307414_101240563 290
372 3300041413 Ga0439465_0001771 Ga0439465_0001771_1617_2516 290
373 3300041498 Ga0451841_1303890 Ga0451841_1303890_2052_2936 290
374 3300042006 Ga0439432_016258 Ga0439432_016258_1431_2309 290
375 3300046460 Ga0495638_0001842 Ga0495638_0001842_10362_11246 290
376 3300046460 Ga0495638_0051744 Ga0495638_0051744_1353_2237 290
377 3300046512 Ga0495610_0004733 Ga0495610_0004733_8862_9740 290
378 3300046518 Ga0495631_0002006 Ga0495631_0002006_8553_9431 290
379 3300046522 Ga0495643_0001695 Ga0495643_0001695_11477_12355 290
380 3300047320 Ga0495672_0000073 Ga0495672_0000073_162960_163838 290
381 3300047472 Ga0495686_0026392 Ga0495686_0026392_2519_3397 290
382 3300048920 Ga0496117_0002324 Ga0496117_0002324_16503_17387 290
383 3300048920 Ga0496117_0002722 Ga0496117_0002722_10138_11022 290
384 3300048921 Ga0496118_0000344 Ga0496118_0000344_6858_7742 290
385 3300048921 Ga0496118_0001379 Ga0496118_0001379_12954_13838 290
386 3300048921 Ga0496118_0013072 Ga0496118_0013072_4682_5560 290
387 3300048921 Ga0496118_0018080 Ga0496118_0018080_4075_4959 290
388 3300048922 Ga0496119_0003326 Ga0496119_0003326_4261_5145 290
389 3300048923 Ga0496120_0002285 Ga0496120_0002285_11105_11989 290
390 3300048924 Ga0496121_0006284 Ga0496121_0006284_9271_10158 290
391 3300048924 Ga0496121_0008043 Ga0496121_0008043_2273_3157 290
392 3300048925 Ga0496122_0008107 Ga0496122_0008107_7457_8341 290
393 3300048925 Ga0496122_0042161 Ga0496122_0042161_430_1314 290
394 3300048926 Ga0496123_0009080 Ga0496123_0009080_2352_3230 290
395 3300048927 Ga0496124_0004112 Ga0496124_0004112_2416_3294 290
396 3300048927 Ga0496124_0007146 Ga0496124_0007146_4445_5329 290
397 3300048927 Ga0496124_0014062 Ga0496124_0014062_2648_3532 290
398 3300048927 Ga0496124_0014864 Ga0496124_0014864_6012_6890 290
399 3300048927 Ga0496124_0022002 Ga0496124_0022002_95_979 290
400 3300048928 Ga0496125_0004477 Ga0496125_0004477_4980_5864 290
401 3300048928 Ga0496125_0049749 Ga0496125_0049749_1551_2429 290
402 3300048929 Ga0496126_0051425 Ga0496126_0051425_108_992 290
403 3300053734 Ga0500565_002311 Ga0500565_002311_320_1204 290
404 iso_pu_bacteria 2894414249 2894415894 290
405 2162886007 SwRhRL2b_contig_3426700 SwRhRL2b_0030.00006760 291
406 3300002773 JGI25152J39213_1000548 JGI25152J39213_10005483 291
407 3300002774 JGI25150J39212_1000114 JGI25150J39212_100011433 291
408 3300003187 JGI25151J46595_10000100 JGI25151J46595_100001002 291
409 3300003187 JGI25151J46595_10000128 JGI25151J46595_1000012831 291
410 3300003215 JGI25153J46596_10000071 JGI25153J46596_100000712 291
411 3300003371 JGI26145J50221_1001698 JGI26145J50221_10016982 291
412 3300003771 Ga0055526_1033149 Ga0055526_10331491 291
413 3300003781 Ga0055536_1032767 Ga0055536_10327672 291
414 3300003784 Ga0055534_1008954 Ga0055534_10089543 291
415 3300003791 Ga0055530_10001882 Ga0055530_100018827 291
416 3300003794 Ga0055531_10016573 Ga0055531_100165733 291
417 3300003794 Ga0055531_10024914 Ga0055531_100249142 291
418 3300005288 Ga0065714_10009016 Ga0065714_100090161 291
419 3300005293 Ga0065715_10230468 Ga0065715_102304682 291
420 3300005353 Ga0070669_100133535 Ga0070669_1001335352 291
421 3300005354 Ga0070675_100125530 Ga0070675_1001255302 291
422 3300005355 Ga0070671_100028192 Ga0070671_1000281923 291
423 3300005355 Ga0070671_100171422 Ga0070671_1001714222 291
424 3300005355 Ga0070671_100379399 Ga0070671_1003793992 291
425 3300005543 Ga0070672_100006280 Ga0070672_1000062807 291
426 3300006051 Ga0075364_10000020 Ga0075364_1000002026 291
427 3300009177 Ga0105248_10480713 Ga0105248_104807131 291
428 3300009979 Ga0105032_104247 Ga0105032_1042471 291
429 3300009993 Ga0105028_104662 Ga0105028_1046622 291
430 3300013307 Ga0157372_10019180 Ga0157372_1001918010 291
431 3300013308 Ga0157375_10049459 Ga0157375_100494592 291
432 3300014326 Ga0157380_10347957 Ga0157380_103479572 291
433 3300014497 Ga0182008_10042134 Ga0182008_100421342 291
434 3300025245 Ga0207425_1000030 Ga0207425_1000030118 291
435 3300025258 Ga0209129_1000063 Ga0209129_1000063104 291
436 3300025273 Ga0209673_1006793 Ga0209673_10067935 291
437 3300025284 Ga0209130_1012894 Ga0209130_10128942 291
438 3300025291 Ga0209675_1012113 Ga0209675_10121133 291
439 3300025292 Ga0209676_1000024 Ga0209676_1000024274 291
440 3300025292 Ga0209676_1002128 Ga0209676_10021289 291
441 3300025292 Ga0209676_1002569 Ga0209676_10025697 291
442 3300025292 Ga0209676_1003631 Ga0209676_10036317 291
443 3300025294 Ga0209025_1000005 Ga0209025_1000005421 291
444 3300025294 Ga0209025_1000013 Ga0209025_1000013676 291
445 3300025294 Ga0209025_1004696 Ga0209025_10046963 291
446 3300025294 Ga0209025_1005156 Ga0209025_10051563 291
447 3300025297 Ga0209758_1000014 Ga0209758_1000014676 291
448 3300025297 Ga0209758_1022517 Ga0209758_10225173 291
449 3300025298 Ga0209050_1000603 Ga0209050_100060312 291
450 3300025299 Ga0209256_1002292 Ga0209256_10022928 291
451 3300025299 Ga0209256_1040932 Ga0209256_10409322 291
452 3300025302 Ga0207426_1054761 Ga0207426_10547612 291
453 3300025303 Ga0209051_1008525 Ga0209051_10085256 291
454 3300025304 Ga0209257_1000122 Ga0209257_100012279 291
455 3300025304 Ga0209257_1000217 Ga0209257_100021733 291
456 3300025304 Ga0209257_1000243 Ga0209257_10002436 291
457 3300025304 Ga0209257_1001409 Ga0209257_10014094 291
458 3300025909 Ga0207705_10091151 Ga0207705_100911512 291
459 3300025917 Ga0207660_10454099 Ga0207660_104540992 291
460 3300025923 Ga0207681_10129243 Ga0207681_101292432 291
461 3300025925 Ga0207650_10158098 Ga0207650_101580982 291
462 3300025929 Ga0207664_10207997 Ga0207664_102079972 291
463 3300025931 Ga0207644_10001250 Ga0207644_100012504 291
464 3300025931 Ga0207644_10372624 Ga0207644_103726242 291
465 3300025933 Ga0207706_10321204 Ga0207706_103212042 291
466 3300025940 Ga0207691_10001351 Ga0207691_1000135113 291
467 3300025940 Ga0207691_10280120 Ga0207691_102801202 291
468 3300025945 Ga0207679_10135097 Ga0207679_101350972 291
469 3300026121 Ga0207683_10232195 Ga0207683_102321952 291
470 3300027424 Ga0209984_1012835 Ga0209984_10128351 291
471 3300027543 Ga0209999_1001293 Ga0209999_10012933 291
472 3300027552 Ga0209982_1002155 Ga0209982_10021553 291
473 3300027665 Ga0209983_1007591 Ga0209983_10075912 291
474 3300027682 Ga0209971_1001898 Ga0209971_10018983 291
475 3300030733 Ga0314311_1188486 Ga0314311_11884862 291
476 3300030735 Ga0316178_1121146 Ga0316178_11211462 291
477 3300030744 Ga0316181_1257729 Ga0316181_12577292 291
478 3300031456 Ga0307513_10039653 Ga0307513_100396532 291
479 3300031548 Ga0307408_100017474 Ga0307408_1000174743 291
480 3300031548 Ga0307408_100337554 Ga0307408_1003375542 291
481 3300031824 Ga0307413_10006930 Ga0307413_100069304 291
482 3300031824 Ga0307413_10056758 Ga0307413_100567582 291
483 3300031852 Ga0307410_10236641 Ga0307410_102366412 291
484 3300031901 Ga0307406_10021651 Ga0307406_100216512 291
485 3300031903 Ga0307407_10057750 Ga0307407_100577502 291
486 3300032004 Ga0307414_10004276 Ga0307414_100042762 291
487 3300032004 Ga0307414_10019038 Ga0307414_100190382 291
488 3300032004 Ga0307414_10095010 Ga0307414_100950102 291
489 3300032004 Ga0307414_10154948 Ga0307414_101549482 291
490 3300032004 Ga0307414_10205568 Ga0307414_102055682 291
491 3300032004 Ga0307414_10466962 Ga0307414_104669622 291
492 3300032005 Ga0307411_10037849 Ga0307411_100378492 291
493 3300037312 Ga0395899_0090607 Ga0395899_0090607_337_1236 291
494 3300037418 Ga0395900_0321630 Ga0395900_0321630_246_1145 291
495 3300037418 Ga0395900_0589056 Ga0395900_0589056_121_1008 291
496 3300037466 Ga0395898_0547308 Ga0395898_0547308_86_973 291
497 3300037471 Ga0395905_0000306 Ga0395905_0000306_10508_11395 291
498 3300037471 Ga0395905_0017994 Ga0395905_0017994_5516_6406 291
499 3300037471 Ga0395905_0338561 Ga0395905_0338561_23_910 291
500 3300038443 Ga0395901_0002348 Ga0395901_0002348_17457_18344 291
501 3300039145 Ga0237816_00655 Ga0237816_00655_1600_2493 291
502 3300041404 Ga0439436_0018848 Ga0439436_0018848_418_1317 291
503 3300041404 Ga0439436_0023498 Ga0439436_0023498_38_928 291
504 3300041406 Ga0439439_0005994 Ga0439439_0005994_1016_1915 291
505 3300041406 Ga0439439_0019516 Ga0439439_0019516_287_1186 291
506 3300041407 Ga0439447_011954 Ga0439447_011954_29_916 291
507 3300041413 Ga0439465_0003673 Ga0439465_0003673_1850_2743 291
508 3300041413 Ga0439465_0004523 Ga0439465_0004523_329_1231 291
509 3300041413 Ga0439465_0037900 Ga0439465_0037900_555_1451 291
510 3300041453 Ga0451797_0382392 Ga0451797_0382392_192_1091 291
511 3300041456 Ga0451795_0443075 Ga0451795_0443075_283_1179 291
512 3300041458 Ga0451798_0406233 Ga0451798_0406233_84_974 291
513 3300041459 Ga0451800_0326958 Ga0451800_0326958_246_1142 291
514 3300041494 Ga0451837_0162876 Ga0451837_0162876_154_1044 291
515 3300041494 Ga0451837_0578947 Ga0451837_0578947_11_901 291
516 3300041494 Ga0451837_0773876 Ga0451837_0773876_392_1291 291
517 3300041509 Ga0451843_1035942 Ga0451843_1035942_1269_2159 291
518 3300042006 Ga0439432_005521 Ga0439432_005521_1688_2578 291
519 3300042007 Ga0439449_0000156 Ga0439449_0000156_9161_10054 291
520 3300042007 Ga0439449_0012229 Ga0439449_0012229_1790_2680 291
521 3300042007 Ga0439449_0012427 Ga0439449_0012427_1014_1904 291
522 3300042007 Ga0439449_0032165 Ga0439449_0032165_674_1576 291
523 3300046507 Ga0495606_0086909 Ga0495606_0086909_426_1316 291
524 3300046525 Ga0495663_0001507 Ga0495663_0001507_5637_6536 291
525 3300046537 Ga0495598_0000742 Ga0495598_0000742_393_1283 291
526 3300046615 Ga0495656_0009800 Ga0495656_0009800_1694_2587 291
527 3300046664 Ga0495659_0142024 Ga0495659_0142024_36_929 291
528 3300046692 Ga0495671_0010539 Ga0495671_0010539_929_1828 291
529 3300047318 Ga0495636_0003452 Ga0495636_0003452_1084_1974 291
530 3300047318 Ga0495636_0008887 Ga0495636_0008887_1604_2494 291
531 3300047318 Ga0495636_0044107 Ga0495636_0044107_92_982 291
532 3300047472 Ga0495686_0025032 Ga0495686_0025032_1957_2913 291
533 3300048904 Ga0496101_0087253 Ga0496101_0087253_845_1732 291
534 3300048912 Ga0496109_0038143 Ga0496109_0038143_3106_3993 291
535 3300048917 Ga0496114_0006407 Ga0496114_0006407_7608_8501 291
536 3300048925 Ga0496122_0039435 Ga0496122_0039435_1430_2320 291
537 3300048925 Ga0496122_0041940 Ga0496122_0041940_1472_2371 291
538 3300048926 Ga0496123_0013609 Ga0496123_0013609_3751_4641 291
539 3300048926 Ga0496123_0033730 Ga0496123_0033730_661_1560 291
540 3300048927 Ga0496124_0000009 Ga0496124_0000009_157443_158333 291
541 3300049568 Ga0501031_0015466 Ga0501031_0015466_2090_2977 291
542 3300049568 Ga0501031_0040249 Ga0501031_0040249_1804_2694 291
543 3300049569 Ga0501032_0003474 Ga0501032_0003474_2050_2937 291
544 3300049570 Ga0501033_0002438 Ga0501033_0002438_12959_13849 291
545 3300049571 Ga0501034_0000122 Ga0501034_0000122_141064_141957 291
546 3300049571 Ga0501034_0001021 Ga0501034_0001021_21416_22306 291
547 3300049571 Ga0501034_0007363 Ga0501034_0007363_6640_7527 291
548 3300049571 Ga0501034_0087102 Ga0501034_0087102_1921_2811 291
549 3300049572 Ga0501036_0120311 Ga0501036_0120311_23_910 291
550 3300049573 Ga0501037_0030670 Ga0501037_0030670_1047_1934 291
551 3300049573 Ga0501037_0061087 Ga0501037_0061087_1435_2325 291
552 3300049574 Ga0501038_0005011 Ga0501038_0005011_1962_2849 291
553 3300049574 Ga0501038_0046025 Ga0501038_0046025_584_1474 291
554 3300049575 Ga0501039_0031363 Ga0501039_0031363_1255_2142 291
555 3300049579 Ga0501043_0006239 Ga0501043_0006239_454_1341 291
556 3300049579 Ga0501043_0026118 Ga0501043_0026118_2041_2928 291
557 3300049581 Ga0501047_0068457 Ga0501047_0068457_797_1687 291
558 3300049581 Ga0501047_0178552 Ga0501047_0178552_510_1397 291
559 3300049586 Ga0501070_0009112 Ga0501070_0009112_2110_2997 291
560 3300049586 Ga0501070_0138686 Ga0501070_0138686_292_1182 291
561 3300049587 Ga0501071_0094032 Ga0501071_0094032_733_1620 291
562 3300049589 Ga0501073_0015658 Ga0501073_0015658_48_935 291
563 3300049705 Ga0501225_0016531 Ga0501225_0016531_981_1874 291
564 3300049742 Ga0501080_0105402 Ga0501080_0105402_877_1764 291
565 3300049762 Ga0501265_001185 Ga0501265_001185_1783_2673 291
566 3300049772 Ga0501275_000033 Ga0501275_000033_3689_4579 291
567 3300049822 Ga0501035_0104849 Ga0501035_0104849_462_1352 291
568 3300049823 Ga0501044_0046980 Ga0501044_0046980_2634_3521 291
569 3300049823 Ga0501044_0420528 Ga0501044_0420528_314_1204 291
570 3300050491 nmdc:mga00v17_202_c2 nmdc:mga00v17_202_c2_5731_6621 291
571 2162886007 SwRhRL2b_contig_314363 SwRhRL2b_0328.00007270 292
572 3300003856 Ga0058692_1000024 Ga0058692_1000024193 292
573 3300005289 Ga0065704_10083971 Ga0065704_100839713 292
574 3300005331 Ga0070670_100235742 Ga0070670_1002357422 292
575 3300009011 Ga0105251_10003611 Ga0105251_1000361114 292
576 3300015265 Ga0182005_1038803 Ga0182005_10388032 292
577 3300025735 Ga0207713_1000327 Ga0207713_100032711 292
578 3300025925 Ga0207650_10004381 Ga0207650_100043818 292
579 3300025935 Ga0207709_10040468 Ga0207709_100404682 292
580 3300027312 Ga0209371_1000016 Ga0209371_1000016378 292
581 3300030500 Ga0268256_1000015 Ga0268256_1000015192 292
582 3300048925 Ga0496122_0003858 Ga0496122_0003858_5636_6526 292
583 3300048926 Ga0496123_0000669 Ga0496123_0000669_13236_14126 292
584 3300048927 Ga0496124_0003480 Ga0496124_0003480_5793_6683 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17848

zf-ACC

Acetyl-CoA carboxylase zinc finger domain

46

71

0.98

PF01039

Carboxyl_trans

Carboxyl transferase domain

102

268

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9279 29 282
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9276 29 287
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9071 29 282
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9069 29 287
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8984 29 287
ID Description Score Start End Superfamily
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9276 29 287 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9169 28 282 3.90.226.10
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9069 29 287 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8984 29 287 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8968 28 282 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A522GU42-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9344 190 287 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A3Q0KZV0-F1-model_v4 Acetyl-CoA carboxylase beta subunit 0.9339 181 287 GO:0003989
GO:0006633
GO:0009329
GO:2001295
AF-A0A1B8QA07-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9338 29 284 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009329
GO:0016743
GO:2001295
AF-A0A126QHE5-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9333 39 288 GO:0003989
GO:0005524
GO:0006633
GO:0009329
GO:0016743
GO:2001295
AF-H9UL55-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9333 31 283 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009317
GO:0016743
GO:2001295

Feature Viewer

pLDDT pTM Quality
80.96 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map