F466328

General Info

Members Datasets Scaffolds Average Seq Length
584 266 539 266

Family's Representative Sequence

Representative Sequence 3300002077|JGI24744J21845_10007379|JGI24744J21845_100073793
Length 309
Sequence MQMHGYANAQYSNKQFQNLHIYLPAHLHIDYICTSSNLHIKIMPLIAPITSNTPSGAFERLLTIMNDLRLNCPWDKKQTLESLRHLTIEEVYELSDSILDGDMPEIKKELGDIMLHLVFYARIASETDDFTITDVLNSICDKLINRHPHIYGDVNVNNEEDVKRNWEQIKLKEGNKSVLAGVPASLPALVKASRIQEKARGVGFDWEEKGQVWAKVEEEMQEFKNEFNAEDESKIDHERAESEFGDLLFSLINYARFININPEDALEKTNRKFIKRFQYLESKAKENGKNLHDMSLAEMDIFWDEAKKL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
16 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
17 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
18 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
19 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
20 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
21 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
22 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
23 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
24 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
25 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
26 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
27 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
28 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
29 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
30 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
31 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
32 2914759650 Rhizosphaericola mali Isolate Rhizosphere
33 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
34 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
35 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
36 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
37 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
38 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
39 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
40 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
41 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
42 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
43 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
44 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
45 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
46 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
53 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
54 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
176 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
177 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
178 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
247 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
248 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
265 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
266 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.12
Metatranscriptomes 0
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 0.34
Rhizosphere 83.56
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1102301 2162886007 Bacteria 2499
2 SwRhRL2b_contig_415591 2162886007 Bacteria 9452
3 JGI24736J21556_1003575 3300001904 Bacteria 2688
4 JGI24739J22299_10078087 3300001989 Bacteria 1020
5 JGI24739J22299_10078198 3300001989 Bacteria 1019
6 JGI24737J22298_10000275 3300001990 Bacteria 16978
7 JGI24735J21928_10000016 3300002067 Bacteria 157028
8 JGI24735J21928_10040143 3300002067 Bacteria 1367
9 JGI24744J21845_10007379 3300002077 Bacteria 2271
10 JGI25162J39368_1000688 3300002737 Bacteria 23552
11 JGI25162J39368_1001792 3300002737 Bacteria 10135
12 JGI25157J39369_1005887 3300002741 Bacteria 1932
13 JGI25164J39214_1002306 3300002772 Bacteria 3054
14 JGI25152J39213_1000182 3300002773 Bacteria 42191
15 JGI25150J39212_1000002 3300002774 Bacteria 537631
16 JGI25151J46595_10000003 3300003187 Bacteria 715330
17 JGI25165J46597_1000846 3300003214 Bacteria 22324
18 JGI25153J46596_10000003 3300003215 Bacteria 553253
19 rootH1_10002396 3300003316 Bacteria 4913
20 rootH2_10013235 3300003320 Bacteria 76391
21 rootH2_10199545 3300003320 Bacteria 2358
22 rootL2_10078754 3300003322 Bacteria 2443
23 rootH1_10001276 3300003316 Bacteria 3262
24 rootH1_10001276 3300003323 Bacteria 38627
25 rootH1_10023383 3300003323 Bacteria 5025
26 rootH1_10061147 3300003323 Bacteria 3068
27 Ga0055536_1000007 3300003781 Bacteria 345133
28 Ga0055536_1007230 3300003781 Bacteria 5009
29 Ga0065165_1000519 3300005262 Bacteria 58989
30 Ga0065714_10002188 3300005288 Bacteria 166479
31 Ga0065714_10002254 3300005288 Bacteria 79136
32 Ga0065714_10002791 3300005288 Bacteria 21551
33 Ga0065714_10002889 3300005288 Bacteria 20284
34 Ga0065714_10065778 3300005288 Bacteria 8542
35 Ga0065714_10115146 3300005288 Bacteria 1419
36 Ga0065704_10000237 3300005289 Bacteria 90089
37 Ga0065704_10072608 3300005289 Bacteria 8257
38 Ga0065704_10088389 3300005289 Bacteria 2936
39 Ga0065704_10244727 3300005289 Bacteria 1002
40 Ga0065715_10002453 3300005293 Bacteria 4903
41 Ga0070658_10000028 3300005327 Bacteria 157278
42 Ga0070658_10021157 3300005327 Bacteria 5210
43 Ga0070658_10027068 3300005327 Bacteria 4603
44 Ga0070658_10043612 3300005327 Bacteria 3623
45 Ga0070658_10189942 3300005327 Bacteria 1731
46 Ga0070658_10375876 3300005327 Bacteria 1218
47 Ga0070658_10552577 3300005327 Unclassified 996
48 Ga0070676_10000004 3300005328 Bacteria 82919
49 Ga0070680_100014977 3300005336 Bacteria 6069
50 Ga0070680_100019423 3300005336 Bacteria 5385
51 Ga0070680_100532154 3300005336 Bacteria 1006
52 Ga0068868_100269039 3300005338 Bacteria 1439
53 Ga0070660_100003032 3300005339 Bacteria 11565
54 Ga0070660_100022315 3300005339 Bacteria 4679
55 Ga0070660_100030831 3300005339 Bacteria 4024
56 Ga0070660_100354212 3300005339 Bacteria 1209
57 Ga0070691_10081714 3300005341 Bacteria 1583
58 Ga0070691_10133782 3300005341 Bacteria 1258
59 Ga0070671_100065106 3300005355 Bacteria 3036
60 Ga0070674_100160933 3300005356 Bacteria 1703
61 Ga0070673_100492339 3300005364 Bacteria 1108
62 Ga0070659_100000824 3300005366 Bacteria 22594
63 Ga0070659_100003640 3300005366 Bacteria 10978
64 Ga0070659_100013216 3300005366 Bacteria 6139
65 Ga0070659_100076733 3300005366 Bacteria 2664
66 Ga0070659_100150995 3300005366 Bacteria 1895
67 Ga0070714_100316990 3300005435 Bacteria 1457
68 Ga0070663_100010857 3300005455 Bacteria 5690
69 Ga0070678_100015947 3300005456 Bacteria 4789
70 Ga0070662_100000029 3300005457 Bacteria 82498
71 Ga0070681_10009168 3300005458 Bacteria 9723
72 Ga0070681_10032801 3300005458 Bacteria 5214
73 Ga0070681_10066101 3300005458 Bacteria 3585
74 Ga0070681_10087433 3300005458 Bacteria 3070
75 Ga0070681_10218801 3300005458 Bacteria 1820
76 Ga0068867_100029272 3300005459 Bacteria 3968
77 Ga0070679_100012194 3300005530 Bacteria 8211
78 Ga0070679_100022761 3300005530 Bacteria 6128
79 Ga0070679_100748000 3300005530 Bacteria 920
80 Ga0070684_100502356 3300005535 Bacteria 1123
81 Ga0068853_100005673 3300005539 Bacteria 9817
82 Ga0068853_100010986 3300005539 Bacteria 7341
83 Ga0068853_100035720 3300005539 Bacteria 4222
84 Ga0068853_100067336 3300005539 Bacteria 3111
85 Ga0070665_100000032 3300005548 Bacteria 333352
86 Ga0068855_100000041 3300005563 Bacteria 151653
87 Ga0068855_100000043 3300005563 Bacteria 149118
88 Ga0068855_100000399 3300005563 Bacteria 53597
89 Ga0068855_100026880 3300005563 Bacteria 6885
90 Ga0068855_100040990 3300005563 Bacteria 5490
91 Ga0068855_100067820 3300005563 Bacteria 4154
92 Ga0068855_100102473 3300005563 Bacteria 3295
93 Ga0068855_100237207 3300005563 Bacteria 2039
94 Ga0068855_100291704 3300005563 Bacteria 1808
95 Ga0068857_100020050 3300005577 Bacteria 5878
96 Ga0068857_100036650 3300005577 Bacteria 4346
97 Ga0068857_100365298 3300005577 Bacteria 1338
98 Ga0068857_100458739 3300005577 Bacteria 1192
99 Ga0068854_100049203 3300005578 Bacteria 3010
100 Ga0068854_100179933 3300005578 Bacteria 1651
101 Ga0068856_100000424 3300005614 Bacteria 46509
102 Ga0068856_100000632 3300005614 Bacteria 38363
103 Ga0068856_100006123 3300005614 Bacteria 11807
104 Ga0068856_100009783 3300005614 Bacteria 9316
105 Ga0068856_100038529 3300005614 Bacteria 4692
106 Ga0068856_100053709 3300005614 Bacteria 3973
107 Ga0068856_100487856 3300005614 Bacteria 1253
108 Ga0068852_100000244 3300005616 Bacteria 37013
109 Ga0068852_100185674 3300005616 Bacteria 1958
110 Ga0068852_100278484 3300005616 Bacteria 1612
111 Ga0068852_100579024 3300005616 Bacteria 1125
112 Ga0068866_10059849 3300005718 Bacteria 1972
113 Ga0068866_10111276 3300005718 Bacteria 1528
114 Ga0068851_10126535 3300005834 Bacteria 1378
115 Ga0068851_10192526 3300005834 Bacteria 1134
116 Ga0068863_100152015 3300005841 Bacteria 2215
117 Ga0068860_100213948 3300005843 Unclassified 1870
118 Ga0075366_10000758 3300006195 Bacteria 15377
119 Ga0075366_10025480 3300006195 Bacteria 3455
120 Ga0097621_100001022 3300006237 Bacteria 19710
121 Ga0068871_100000021 3300006358 Bacteria 83155
122 Ga0068865_100000045 3300006881 Bacteria 70227
123 Ga0105240_10000126 3300009093 Bacteria 157403
124 Ga0105240_10007920 3300009093 Bacteria 15325
125 Ga0105240_10022098 3300009093 Bacteria 8443
126 Ga0105240_10055317 3300009093 Bacteria 4968
127 Ga0105240_10058286 3300009093 Bacteria 4821
128 Ga0105240_10063068 3300009093 Bacteria 4612
129 Ga0105240_10239994 3300009093 Bacteria 2101
130 Ga0105240_10469453 3300009093 Bacteria 1404
131 Ga0105245_10067090 3300009098 Bacteria 3249
132 Ga0105243_10000007 3300009148 Bacteria 445042
133 Ga0105241_10002344 3300009174 Bacteria 14232
134 Ga0105241_10005542 3300009174 Bacteria 9330
135 Ga0105241_10686192 3300009174 Bacteria 933
136 Ga0105242_10018244 3300009176 Bacteria 5484
137 Ga0105242_10133479 3300009176 Bacteria 2146
138 Ga0105237_10001066 3300009545 Bacteria 36850
139 Ga0105237_10004075 3300009545 Bacteria 17038
140 Ga0105237_10005461 3300009545 Bacteria 14336
141 Ga0105237_10018709 3300009545 Bacteria 7162
142 Ga0105237_10024081 3300009545 Bacteria 6228
143 Ga0105238_10125961 3300009551 Bacteria 2540
144 Ga0105238_10166639 3300009551 Bacteria 2179
145 Ga0105239_10000001 3300010375 Bacteria 617353
146 Ga0105239_10000017 3300010375 Bacteria 290760
147 Ga0105239_10000190 3300010375 Bacteria 89155
148 Ga0105239_10002606 3300010375 Bacteria 22829
149 Ga0105239_10003229 3300010375 Bacteria 20165
150 Ga0105239_10014938 3300010375 Bacteria 8607
151 Ga0105239_10074932 3300010375 Bacteria 3721
152 Ga0105239_10151726 3300010375 Bacteria 2586
153 Ga0105239_10341583 3300010375 Bacteria 1690
154 Ga0105246_10231777 3300011119 Bacteria 1454
155 Ga0157373_10000013 3300013100 Bacteria 186870
156 Ga0157373_10000021 3300013100 Bacteria 165522
157 Ga0157373_10002450 3300013100 Bacteria 14129
158 Ga0157373_10006801 3300013100 Bacteria 8520
159 Ga0157373_10013747 3300013100 Bacteria 5934
160 Ga0157373_10066890 3300013100 Bacteria 2541
161 Ga0157373_10083252 3300013100 Bacteria 2255
162 Ga0157373_10118670 3300013100 Bacteria 1859
163 Ga0157373_10122065 3300013100 Bacteria 1831
164 Ga0157371_10000085 3300013102 Bacteria 148566
165 Ga0157371_10000266 3300013102 Bacteria 71146
166 Ga0157371_10000711 3300013102 Bacteria 38929
167 Ga0157371_10001708 3300013102 Bacteria 22354
168 Ga0157371_10001789 3300013102 Bacteria 21728
169 Ga0157371_10003164 3300013102 Bacteria 15153
170 Ga0157371_10006207 3300013102 Bacteria 9906
171 Ga0157371_10007282 3300013102 Bacteria 8988
172 Ga0157371_10009013 3300013102 Bacteria 7886
173 Ga0157371_10012786 3300013102 Bacteria 6398
174 Ga0157371_10013494 3300013102 Bacteria 6201
175 Ga0157371_10014503 3300013102 Bacteria 5946
176 Ga0157371_10020362 3300013102 Bacteria 4881
177 Ga0157371_10048972 3300013102 Bacteria 3003
178 Ga0157371_10066476 3300013102 Bacteria 2552
179 Ga0157371_10093172 3300013102 Bacteria 2135
180 Ga0157371_10335614 3300013102 Bacteria 1099
181 Ga0157370_10000267 3300013104 Bacteria 66250
182 Ga0157370_10000750 3300013104 Bacteria 40524
183 Ga0157370_10000956 3300013104 Bacteria 36647
184 Ga0157370_10004077 3300013104 Bacteria 16933
185 Ga0157370_10005134 3300013104 Bacteria 14766
186 Ga0157370_10033417 3300013104 Bacteria 5016
187 Ga0157370_10040868 3300013104 Bacteria 4476
188 Ga0157370_10089823 3300013104 Bacteria 2885
189 Ga0157370_10106889 3300013104 Bacteria 2618
190 Ga0157370_10121143 3300013104 Bacteria 2442
191 Ga0157370_10121344 3300013104 Bacteria 2440
192 Ga0157370_10123886 3300013104 Bacteria 2413
193 Ga0157370_10131940 3300013104 Bacteria 2330
194 Ga0157370_10145564 3300013104 Bacteria 2206
195 Ga0157370_10187405 3300013104 Bacteria 1921
196 Ga0157370_10273839 3300013104 Bacteria 1560
197 Ga0157369_10000441 3300013105 Bacteria 55264
198 Ga0157369_10001323 3300013105 Bacteria 30703
199 Ga0157369_10004629 3300013105 Bacteria 16161
200 Ga0157369_10005343 3300013105 Bacteria 14966
201 Ga0157369_10005397 3300013105 Bacteria 14882
202 Ga0157369_10029021 3300013105 Bacteria 6117
203 Ga0157369_10046443 3300013105 Bacteria 4719
204 Ga0157369_10122696 3300013105 Bacteria 2756
205 Ga0157369_10159198 3300013105 Unclassified 2384
206 Ga0157369_10683580 3300013105 Bacteria 1057
207 Ga0157374_10000700 3300013296 Bacteria 29512
208 Ga0157374_10000775 3300013296 Bacteria 27961
209 Ga0157374_10002662 3300013296 Bacteria 15044
210 Ga0157378_10037217 3300013297 Bacteria 4309
211 Ga0157378_10265796 3300013297 Bacteria 1648
212 Ga0163162_10000010 3300013306 Bacteria 302032
213 Ga0163162_10000439 3300013306 Bacteria 38391
214 Ga0163162_10007708 3300013306 Bacteria 10487
215 Ga0163162_10024503 3300013306 Bacteria 5956
216 Ga0157372_10000073 3300013307 Bacteria 107356
217 Ga0157372_10002553 3300013307 Bacteria 19735
218 Ga0157372_10011477 3300013307 Bacteria 9422
219 Ga0157372_10014858 3300013307 Bacteria 8336
220 Ga0157372_10015972 3300013307 Bacteria 8053
221 Ga0157372_10025881 3300013307 Bacteria 6382
222 Ga0157372_10044263 3300013307 Bacteria 4932
223 Ga0157372_10075507 3300013307 Bacteria 3803
224 Ga0157372_10101211 3300013307 Bacteria 3289
225 Ga0157372_10575973 3300013307 Bacteria 1312
226 Ga0157375_10060765 3300013308 Bacteria 3749
227 Ga0182008_10000017 3300014497 Bacteria 235130
228 Ga0182008_10000549 3300014497 Bacteria 27943
229 Ga0182008_10000940 3300014497 Bacteria 20298
230 Ga0182008_10021912 3300014497 Bacteria 3277
231 Ga0182008_10062959 3300014497 Bacteria 1828
232 Ga0157377_10051895 3300014745 Bacteria 2314
233 Ga0157376_10040398 3300014969 Bacteria 3813
234 Ga0182006_1000375 3300015261 Bacteria 37085
235 Ga0182006_1000610 3300015261 Bacteria 25820
236 Ga0182006_1004860 3300015261 Bacteria 6520
237 Ga0182007_10001103 3300015262 Bacteria 14661
238 Ga0182007_10012291 3300015262 Bacteria 3297
239 Ga0183373_1005 3300015682 Bacteria 351562
240 Ga0163161_10000232 3300017792 Bacteria 51372
241 Ga0163161_10001126 3300017792 Bacteria 20160
242 Ga0163161_10045080 3300017792 Bacteria 3178
243 Ga0163161_10066815 3300017792 Bacteria 2626
244 Ga0163161_10069853 3300017792 Bacteria 2568
245 Ga0163161_10125506 3300017792 Bacteria 1932
246 Ga0213872_10011171 3300021361 Bacteria 4254
247 Ga0207427_100138 3300025231 Bacteria 86499
248 Ga0209437_100010 3300025233 Bacteria 838447
249 Ga0209437_100169 3300025233 Bacteria 142584
250 Ga0207425_1000004 3300025245 Bacteria 1092421
251 Ga0209026_1000320 3300025250 Bacteria 51184
252 Ga0209026_1003989 3300025250 Bacteria 4599
253 Ga0209129_1000005 3300025258 Bacteria 777812
254 Ga0209129_1006691 3300025258 Bacteria 3647
255 Ga0209233_1000017 3300025261 Bacteria 898076
256 Ga0209233_1012287 3300025261 Bacteria 2488
257 Ga0209455_1003033 3300025272 Bacteria 6149
258 Ga0209676_1000058 3300025292 Bacteria 345185
259 Ga0209676_1001678 3300025292 Bacteria 19220
260 Ga0209025_1000009 3300025294 Bacteria 1092561
261 Ga0209564_1004209 3300025295 Bacteria 8972
262 Ga0209564_1044448 3300025295 Bacteria 1153
263 Ga0209758_1000010 3300025297 Bacteria 1092782
264 Ga0209758_1011513 3300025297 Bacteria 5110
265 Ga0209050_1000054 3300025298 Bacteria 345186
266 Ga0209050_1013318 3300025298 Bacteria 3663
267 Ga0207426_1031402 3300025302 Bacteria 1733
268 Ga0207647_10000022 3300025904 Bacteria 118094
269 Ga0207647_10000211 3300025904 Bacteria 47375
270 Ga0207647_10043916 3300025904 Bacteria 2794
271 Ga0207645_10000151 3300025907 Bacteria 54588
272 Ga0207705_10000045 3300025909 Bacteria 180625
273 Ga0207705_10002548 3300025909 Bacteria 14024
274 Ga0207705_10021129 3300025909 Bacteria 4643
275 Ga0207705_10031081 3300025909 Bacteria 3810
276 Ga0207705_10054870 3300025909 Bacteria 2872
277 Ga0207654_10004382 3300025911 Bacteria 7115
278 Ga0207654_10006179 3300025911 Bacteria 6022
279 Ga0207654_10062516 3300025911 Bacteria 2182
280 Ga0207707_10032777 3300025912 Bacteria 4547
281 Ga0207707_10195175 3300025912 Bacteria 1766
282 Ga0207695_10000013 3300025913 Bacteria 821265
283 Ga0207695_10010313 3300025913 Bacteria 11440
284 Ga0207695_10011532 3300025913 Bacteria 10695
285 Ga0207695_10012097 3300025913 Bacteria 10372
286 Ga0207695_10048507 3300025913 Bacteria 4484
287 Ga0207695_10102638 3300025913 Bacteria 2852
288 Ga0207695_10120429 3300025913 Bacteria 2593
289 Ga0207671_10001167 3300025914 Bacteria 31300
290 Ga0207671_10001212 3300025914 Bacteria 30643
291 Ga0207671_10005732 3300025914 Bacteria 11324
292 Ga0207671_10006644 3300025914 Bacteria 10252
293 Ga0207671_10013135 3300025914 Bacteria 6614
294 Ga0207671_10027546 3300025914 Bacteria 4249
295 Ga0207671_10029417 3300025914 Bacteria 4101
296 Ga0207660_10003854 3300025917 Bacteria 9777
297 Ga0207660_10524506 3300025917 Bacteria 962
298 Ga0207657_10030889 3300025919 Bacteria 4856
299 Ga0207657_10040214 3300025919 Bacteria 4145
300 Ga0207657_10354300 3300025919 Bacteria 1157
301 Ga0207652_10000228 3300025921 Bacteria 58720
302 Ga0207652_10003662 3300025921 Bacteria 12649
303 Ga0207652_10308219 3300025921 Bacteria 1429
304 Ga0207687_10290164 3300025927 Bacteria 1314
305 Ga0207644_10017434 3300025931 Bacteria 4848
306 Ga0207690_10000351 3300025932 Bacteria 30727
307 Ga0207690_10004191 3300025932 Bacteria 8521
308 Ga0207690_10018755 3300025932 Bacteria 4247
309 Ga0207690_10213136 3300025932 Bacteria 1474
310 Ga0207690_10577007 3300025932 Bacteria 916
311 Ga0207706_10000047 3300025933 Bacteria 119022
312 Ga0207686_10217885 3300025934 Unclassified 1376
313 Ga0207709_10000033 3300025935 Bacteria 320483
314 Ga0207704_10000077 3300025938 Bacteria 60841
315 Ga0207667_10000015 3300025949 Bacteria 417534
316 Ga0207667_10000312 3300025949 Bacteria 67340
317 Ga0207667_10000404 3300025949 Bacteria 58450
318 Ga0207667_10005433 3300025949 Bacteria 15535
319 Ga0207667_10009196 3300025949 Bacteria 11672
320 Ga0207667_10025578 3300025949 Bacteria 6459
321 Ga0207667_10079549 3300025949 Bacteria 3397
322 Ga0207667_10084973 3300025949 Bacteria 3276
323 Ga0207667_10130803 3300025949 Bacteria 2585
324 Ga0207667_10133517 3300025949 Bacteria 2557
325 Ga0207651_10340735 3300025960 Bacteria 1259
326 Ga0207640_10008525 3300025981 Bacteria 5694
327 Ga0207639_10005896 3300026041 Bacteria 8302
328 Ga0207639_10051690 3300026041 Bacteria 3127
329 Ga0207639_10086774 3300026041 Bacteria 2493
330 Ga0207639_10178358 3300026041 Bacteria 1805
331 Ga0207678_10011065 3300026067 Bacteria 7927
332 Ga0207678_10013732 3300026067 Bacteria 7113
333 Ga0207702_10009859 3300026078 Bacteria 8006
334 Ga0207702_10041267 3300026078 Bacteria 3869
335 Ga0207702_10043943 3300026078 Bacteria 3753
336 Ga0207702_10094430 3300026078 Bacteria 2625
337 Ga0207702_10443845 3300026078 Bacteria 1258
338 Ga0207641_10134701 3300026088 Bacteria 2222
339 Ga0207641_10326629 3300026088 Bacteria 1456
340 Ga0207648_10002829 3300026089 Bacteria 18417
341 Ga0207674_10051687 3300026116 Bacteria 4193
342 Ga0207674_10068181 3300026116 Bacteria 3580
343 Ga0207674_10081072 3300026116 Bacteria 3247
344 Ga0207674_10132117 3300026116 Bacteria 2459
345 Ga0207683_10066580 3300026121 Bacteria 3177
346 Ga0207698_10090397 3300026142 Bacteria 2504
347 Ga0207698_10192679 3300026142 Bacteria 1818
348 Ga0268266_10000030 3300028379 Bacteria 417120
349 Ga0268264_10359167 3300028381 Bacteria 1389
350 Ga0265334_10014351 3300028573 Bacteria 3304
351 Ga0265334_10063586 3300028573 Bacteria 1387
352 Ga0265336_10058725 3300028666 Bacteria 1154
353 Ga0307517_10005480 3300028786 Bacteria 19110
354 Ga0307515_10001136 3300028794 Bacteria 61007
355 Ga0307515_10001603 3300028794 Bacteria 50415
356 Ga0307515_10035384 3300028794 Bacteria 8128
357 Ga0307515_10201181 3300028794 Bacteria 1867
358 Ga0265338_10011270 3300028800 Bacteria 10351
359 Ga0265338_10155082 3300028800 Bacteria 1775
360 Ga0316177_1005756 3300030731 Bacteria 18340
361 Ga0316176_1163657 3300030732 Bacteria 9695
362 Ga0316183_1049060 3300030742 Bacteria 42044
363 Ga0316181_1078627 3300030744 Bacteria 958
364 Ga0316181_1217212 3300030744 Bacteria 5130
365 Ga0265327_10054832 3300031251 Bacteria 2061
366 Ga0265327_10061967 3300031251 Bacteria 1906
367 Ga0265327_10111693 3300031251 Bacteria 1305
368 Ga0307509_10029694 3300031507 Bacteria 6063
369 Ga0307408_100000412 3300031548 Bacteria 38446
370 Ga0307408_100002539 3300031548 Bacteria 12760
371 Ga0307408_100006871 3300031548 Bacteria 7543
372 Ga0307408_100011427 3300031548 Bacteria 5867
373 Ga0307408_100197124 3300031548 Bacteria 1627
374 Ga0307408_100269578 3300031548 Bacteria 1413
375 Ga0316576_10053537 3300031727 Bacteria 2941
376 Ga0316576_10166566 3300031727 Bacteria 1663
377 Ga0307405_10000043 3300031731 Bacteria 78391
378 Ga0307405_10062578 3300031731 Bacteria 2357
379 Ga0307407_10000039 3300031903 Bacteria 67825
380 Ga0307412_10000004 3300031911 Bacteria 544053
381 Ga0307412_10006483 3300031911 Bacteria 6618
382 Ga0307412_10047985 3300031911 Bacteria 2806
383 Ga0307409_100057316 3300031995 Bacteria 3018
384 Ga0307416_100000029 3300032002 Bacteria 164815
385 Ga0307416_100882767 3300032002 Bacteria 993
386 Ga0307416_101064965 3300032002 Bacteria 913
387 Ga0307414_10000088 3300032004 Bacteria 84711
388 Ga0307414_10002804 3300032004 Bacteria 9181
389 Ga0307414_10004599 3300032004 Bacteria 7508
390 Ga0307414_10009130 3300032004 Bacteria 5679
391 Ga0307414_10010264 3300032004 Bacteria 5425
392 Ga0307414_10010743 3300032004 Bacteria 5334
393 Ga0307414_10015266 3300032004 Bacteria 4633
394 Ga0307414_10110509 3300032004 Bacteria 2091
395 Ga0307414_10127765 3300032004 Bacteria 1967
396 Ga0307414_10207374 3300032004 Bacteria 1599
397 Ga0307414_10226300 3300032004 Bacteria 1539
398 Ga0307414_10444103 3300032004 Bacteria 1136
399 Ga0307507_10001027 3300033179 Bacteria 62236
400 Ga0373941_0019620 3300035115 Bacteria 1885
401 Ga0316584_0060899 3300036712 Bacteria 2828
402 Ga0395899_0000002 3300037312 Bacteria 1324310
403 Ga0395899_0000209 3300037312 Bacteria 85489
404 Ga0395899_0005252 3300037312 Bacteria 10067
405 Ga0395899_0028491 3300037312 Bacteria 4205
406 Ga0395899_0028789 3300037312 Bacteria 4180
407 Ga0395899_0115607 3300037312 Unclassified 1925
408 Ga0395899_0248193 3300037312 Unclassified 1222
409 Ga0395900_0000460 3300037418 Bacteria 58482
410 Ga0395900_0000721 3300037418 Bacteria 43960
411 Ga0395900_0004396 3300037418 Bacteria 14943
412 Ga0395900_0008777 3300037418 Bacteria 10386
413 Ga0395900_0043407 3300037418 Unclassified 4634
414 Ga0395900_0049038 3300037418 Unclassified 4350
415 Ga0395900_0273013 3300037418 Bacteria 1685
416 Ga0395900_0516223 3300037418 Unclassified 1143
417 Ga0395898_0000794 3300037466 Bacteria 53591
418 Ga0395898_0020909 3300037466 Bacteria 6642
419 Ga0395898_0056702 3300037466 Bacteria 3818
420 Ga0395898_0069048 3300037466 Unclassified 3420
421 Ga0395905_0000011 3300037471 Bacteria 424563
422 Ga0395905_0000149 3300037471 Bacteria 115709
423 Ga0395905_0116196 3300037471 Bacteria 2515
424 Ga0395901_0000198 3300038443 Bacteria 76490
425 Ga0395901_0002103 3300038443 Bacteria 20429
426 Ga0395901_0002579 3300038443 Bacteria 18374
427 Ga0395901_0025205 3300038443 Bacteria 6106
428 Ga0395901_0136095 3300038443 Bacteria 2582
429 Ga0395901_0438401 3300038443 Bacteria 1337
430 Ga0400483_287105 3300039062 Bacteria 1915
431 Ga0436361_0280573 3300039447 Bacteria 5233
432 Ga0439448_0028594 3300042005 Bacteria 1761
433 Ga0451577_0000558 3300042876 Bacteria 60774
434 Ga0451577_0005791 3300042876 Bacteria 12520
435 Ga0451577_0234965 3300042876 Bacteria 1658
436 Ga0466969_0079499 3300044656 Bacteria 1567
437 Ga0453683_0045570 3300044673 Bacteria 2750
438 Ga0453684_0001190 3300044712 Bacteria 80396
439 Ga0453684_0001377 3300044712 Bacteria 70373
440 Ga0453684_0029328 3300044712 Bacteria 7817
441 Ga0453684_0058590 3300044712 Bacteria 4973
442 Ga0453684_0062632 3300044712 Bacteria 4763
443 Ga0466959_0287328 3300045049 Bacteria 1128
444 Ga0451576_0000002 3300045051 Bacteria 1670975
445 Ga0495650_0000277 3300046471 Bacteria 98027
446 Ga0495650_0026173 3300046471 Bacteria 2719
447 Ga0495650_0052258 3300046471 Bacteria 1678
448 Ga0495605_0030915 3300046474 Bacteria 2739
449 Ga0495662_0098235 3300046476 Bacteria 1432
450 Ga0495585_0000695 3300046492 Bacteria 30570
451 Ga0495585_0003287 3300046492 Bacteria 10985
452 Ga0495583_0070485 3300046506 Bacteria 1537
453 Ga0495606_0000033 3300046507 Bacteria 247739
454 Ga0495606_0016334 3300046507 Bacteria 5667
455 Ga0495606_0041421 3300046507 Bacteria 3088
456 Ga0495606_0071266 3300046507 Bacteria 2189
457 Ga0495606_0075952 3300046507 Bacteria 2101
458 Ga0495610_0000026 3300046512 Bacteria 284737
459 Ga0495610_0000386 3300046512 Bacteria 45558
460 Ga0495610_0002950 3300046512 Bacteria 13725
461 Ga0495610_0097223 3300046512 Bacteria 1325
462 Ga0495616_0007622 3300046513 Bacteria 6475
463 Ga0495616_0010435 3300046513 Bacteria 5376
464 Ga0495628_0000013 3300046516 Bacteria 211823
465 Ga0495628_0167215 3300046516 Bacteria 1669
466 Ga0495631_0011918 3300046518 Bacteria 4263
467 Ga0495644_0004694 3300046523 Bacteria 5371
468 Ga0495648_0002201 3300046524 Bacteria 18264
469 Ga0495648_0127311 3300046524 Bacteria 1359
470 Ga0495652_0295542 3300046529 Bacteria 1180
471 Ga0495652_0488343 3300046529 Bacteria 856
472 Ga0495609_0002573 3300046538 Bacteria 11064
473 Ga0495633_0000172 3300046558 Bacteria 84811
474 Ga0495633_0037966 3300046558 Bacteria 2302
475 Ga0495668_0000069 3300046616 Bacteria 174287
476 Ga0495668_0166167 3300046616 Bacteria 1209
477 Ga0495634_0031303 3300046642 Bacteria 3665
478 Ga0495625_0000048 3300046660 Bacteria 198976
479 Ga0495625_0000419 3300046660 Bacteria 63844
480 Ga0495625_0000752 3300046660 Bacteria 45252
481 Ga0495625_0062781 3300046660 Bacteria 2625
482 Ga0495625_0073447 3300046660 Bacteria 2397
483 Ga0495625_0092722 3300046660 Bacteria 2086
484 Ga0495661_0003353 3300046665 Bacteria 11869
485 Ga0495661_0022489 3300046665 Bacteria 4102
486 Ga0495661_0056565 3300046665 Bacteria 2346
487 Ga0495661_0193274 3300046665 Bacteria 1070
488 Ga0495649_0000059 3300046694 Bacteria 98956
489 Ga0495589_0042907 3300046794 Bacteria 2253
490 Ga0495600_0068135 3300046809 Bacteria 2326
491 Ga0495600_0183397 3300046809 Bacteria 1348
492 Ga0495660_0067865 3300046810 Bacteria 1899
493 Ga0495683_0062508 3300047323 Bacteria 1842
494 Ga0495687_001183 3300047443 Bacteria 25146
495 Ga0495677_0019314 3300047445 Bacteria 2472
496 Ga0495685_006615 3300047447 Bacteria 3803
497 Ga0495681_0122275 3300047470 Bacteria 1116
498 Ga0495686_0000299 3300047472 Bacteria 85384
499 Ga0495686_0002147 3300047472 Bacteria 19284
500 Ga0495686_0048573 3300047472 Bacteria 2675
501 Ga0495686_0067913 3300047472 Bacteria 2200
502 Ga0496115_0161185 3300048918 Unclassified 1853
503 Ga0496116_0001485 3300048919 Bacteria 26153
504 Ga0496117_0004024 3300048920 Bacteria 16574
505 Ga0496118_0076664 3300048921 Bacteria 2376
506 Ga0496121_0000028 3300048924 Bacteria 439193
507 Ga0496122_0001885 3300048925 Bacteria 31746
508 Ga0496122_0009623 3300048925 Bacteria 10123
509 Ga0496123_0004377 3300048926 Bacteria 14902
510 Ga0496123_0005024 3300048926 Bacteria 13540
511 Ga0496124_0042293 3300048927 Bacteria 3925
512 Ga0496125_0161130 3300048928 Bacteria 1524
513 Ga0501034_0015948 3300049571 Bacteria 7712
514 Ga0501034_0091738 3300049571 Bacteria 3035
515 Ga0501070_0295864 3300049586 Unclassified 1319
516 Ga0501222_002837 3300049662 Bacteria 2392
517 Ga0501223_003246 3300049663 Bacteria 3552
518 Ga0501227_084202 3300049665 Bacteria 836
519 Ga0501257_000469 3300049686 Bacteria 8008
520 Ga0501257_001137 3300049686 Bacteria 5426
521 Ga0501264_000639 3300049761 Bacteria 4892
522 Ga0501035_0211554 3300049822 Bacteria 1659
523 Ga0501044_0218945 3300049823 Bacteria 1855
524 Ga0501044_0624490 3300049823 Unclassified 969
525 nmdc:mga0k408_649_c1 3300050493 Bacteria 19167
526 nmdc:mga0k408_6505_c1 3300050493 Bacteria 6228
527 Ga0500635_0003356 3300053080 Bacteria 4018
528 Ga0500644_0045127 3300053088 Bacteria 1483
529 Ga0500651_0001246 3300053093 Bacteria 12657
530 Ga0500562_000008 3300053108 Bacteria 188332
531 Ga0500608_005003 3300053122 Bacteria 5206
532 Ga0500608_092969 3300053122 Bacteria 1407
533 Ga0500618_000012 3300053125 Bacteria 185382
534 Ga0500642_0017818 3300053130 Bacteria 2732
535 Ga0500568_0071336 3300053139 Bacteria 1330
536 Ga0500622_0000852 3300053156 Bacteria 26070
537 Ga0500622_0001455 3300053156 Bacteria 18927
538 Ga0500645_007010 3300053730 Bacteria 3964
539 Ga0500661_002005 3300055283 Bacteria 3843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049665 Ga0501227_084202 Ga0501227_084202_91_804 231
2 3300013100 Ga0157373_10118670 Ga0157373_101186702 241
3 3300028381 Ga0268264_10359167 Ga0268264_103591672 242
4 3300026041 Ga0207639_10178358 Ga0207639_101783582 243
5 3300049761 Ga0501264_000639 Ga0501264_000639_3808_4632 244
6 3300031548 Ga0307408_100006871 Ga0307408_1000068712 245
7 3300036712 Ga0316584_0060899 Ga0316584_0060899_117_932 245
8 3300049686 Ga0501257_000469 Ga0501257_000469_1281_2105 245
9 3300049571 Ga0501034_0015948 Ga0501034_0015948_983_1756 247
10 3300049823 Ga0501044_0218945 Ga0501044_0218945_302_1075 247
11 3300005577 Ga0068857_100458739 Ga0068857_1004587391 248
12 3300005841 Ga0068863_100152015 Ga0068863_1001520152 249
13 3300026088 Ga0207641_10134701 Ga0207641_101347013 249
14 3300005355 Ga0070671_100065106 Ga0070671_1000651062 251
15 3300009098 Ga0105245_10067090 Ga0105245_100670901 251
16 3300011119 Ga0105246_10231777 Ga0105246_102317771 251
17 3300025927 Ga0207687_10290164 Ga0207687_102901641 251
18 3300025931 Ga0207644_10017434 Ga0207644_100174342 251
19 3300047443 Ga0495687_001183 Ga0495687_001183_22656_23459 251
20 3300031727 Ga0316576_10053537 Ga0316576_100535373 252
21 3300046471 Ga0495650_0026173 Ga0495650_0026173_590_1393 252
22 3300049662 Ga0501222_002837 Ga0501222_002837_536_1348 252
23 3300049686 Ga0501257_001137 Ga0501257_001137_582_1394 252
24 3300053156 Ga0500622_0001455 Ga0500622_0001455_9462_10265 252
25 3300003320 rootH2_10199545 rootH2_101995452 253
26 3300005341 Ga0070691_10081714 Ga0070691_100817141 253
27 3300005458 Ga0070681_10032801 Ga0070681_100328012 253
28 3300005530 Ga0070679_100012194 Ga0070679_1000121944 253
29 3300005539 Ga0068853_100005673 Ga0068853_1000056736 253
30 3300005563 Ga0068855_100026880 Ga0068855_1000268803 253
31 3300005614 Ga0068856_100006123 Ga0068856_10000612310 253
32 3300010375 Ga0105239_10014938 Ga0105239_100149382 253
33 3300013100 Ga0157373_10006801 Ga0157373_1000680110 253
34 3300013102 Ga0157371_10006207 Ga0157371_100062078 253
35 3300013104 Ga0157370_10123886 Ga0157370_101238862 253
36 3300013105 Ga0157369_10004629 Ga0157369_100046293 253
37 3300013105 Ga0157369_10122696 Ga0157369_101226962 253
38 3300025911 Ga0207654_10006179 Ga0207654_100061795 253
39 3300025913 Ga0207695_10011532 Ga0207695_100115322 253
40 3300025921 Ga0207652_10308219 Ga0207652_103082192 253
41 3300025949 Ga0207667_10005433 Ga0207667_1000543313 253
42 3300048918 Ga0496115_0161185 Ga0496115_0161185_1065_1826 253
43 3300048924 Ga0496121_0000028 Ga0496121_0000028_77264_78025 253
44 iso_pu_bacteria 2929154850 2929155505 253
45 3300005327 Ga0070658_10021157 Ga0070658_100211576 254
46 3300005327 Ga0070658_10043612 Ga0070658_100436123 254
47 3300005327 Ga0070658_10375876 Ga0070658_103758761 254
48 3300005327 Ga0070658_10552577 Ga0070658_105525772 254
49 3300005336 Ga0070680_100014977 Ga0070680_1000149773 254
50 3300005336 Ga0070680_100019423 Ga0070680_1000194233 254
51 3300005336 Ga0070680_100532154 Ga0070680_1005321542 254
52 3300005339 Ga0070660_100003032 Ga0070660_1000030326 254
53 3300005339 Ga0070660_100030831 Ga0070660_1000308311 254
54 3300005366 Ga0070659_100003640 Ga0070659_10000364010 254
55 3300005366 Ga0070659_100013216 Ga0070659_1000132162 254
56 3300005455 Ga0070663_100010857 Ga0070663_1000108572 254
57 3300005458 Ga0070681_10009168 Ga0070681_100091685 254
58 3300005458 Ga0070681_10066101 Ga0070681_100661012 254
59 3300005458 Ga0070681_10087433 Ga0070681_100874333 254
60 3300005458 Ga0070681_10218801 Ga0070681_102188012 254
61 3300005530 Ga0070679_100022761 Ga0070679_1000227616 254
62 3300005530 Ga0070679_100748000 Ga0070679_1007480001 254
63 3300005535 Ga0070684_100502356 Ga0070684_1005023561 254
64 3300005563 Ga0068855_100000399 Ga0068855_1000003994 254
65 3300005563 Ga0068855_100067820 Ga0068855_1000678202 254
66 3300005563 Ga0068855_100102473 Ga0068855_1001024732 254
67 3300005563 Ga0068855_100237207 Ga0068855_1002372072 254
68 3300005563 Ga0068855_100291704 Ga0068855_1002917042 254
69 3300005577 Ga0068857_100020050 Ga0068857_1000200502 254
70 3300005577 Ga0068857_100365298 Ga0068857_1003652981 254
71 3300005578 Ga0068854_100049203 Ga0068854_1000492032 254
72 3300005614 Ga0068856_100038529 Ga0068856_1000385295 254
73 3300005616 Ga0068852_100278484 Ga0068852_1002784841 254
74 3300009093 Ga0105240_10239994 Ga0105240_102399942 254
75 3300013100 Ga0157373_10002450 Ga0157373_100024503 254
76 3300013100 Ga0157373_10083252 Ga0157373_100832522 254
77 3300013100 Ga0157373_10122065 Ga0157373_101220651 254
78 3300013102 Ga0157371_10001708 Ga0157371_1000170812 254
79 3300013102 Ga0157371_10003164 Ga0157371_100031648 254
80 3300013102 Ga0157371_10007282 Ga0157371_100072823 254
81 3300013102 Ga0157371_10009013 Ga0157371_100090133 254
82 3300013102 Ga0157371_10012786 Ga0157371_100127863 254
83 3300013102 Ga0157371_10013494 Ga0157371_100134944 254
84 3300013102 Ga0157371_10014503 Ga0157371_100145033 254
85 3300013102 Ga0157371_10093172 Ga0157371_100931722 254
86 3300013104 Ga0157370_10000956 Ga0157370_1000095619 254
87 3300013104 Ga0157370_10005134 Ga0157370_100051347 254
88 3300013104 Ga0157370_10033417 Ga0157370_100334172 254
89 3300013104 Ga0157370_10131940 Ga0157370_101319402 254
90 3300013104 Ga0157370_10187405 Ga0157370_101874052 254
91 3300013105 Ga0157369_10005343 Ga0157369_100053437 254
92 3300013105 Ga0157369_10005397 Ga0157369_100053973 254
93 3300013105 Ga0157369_10046443 Ga0157369_100464432 254
94 3300013105 Ga0157369_10159198 Ga0157369_101591983 254
95 3300013307 Ga0157372_10011477 Ga0157372_100114776 254
96 3300013307 Ga0157372_10015972 Ga0157372_100159729 254
97 3300013307 Ga0157372_10025881 Ga0157372_100258812 254
98 3300013307 Ga0157372_10044263 Ga0157372_100442635 254
99 3300013307 Ga0157372_10575973 Ga0157372_105759732 254
100 3300025909 Ga0207705_10002548 Ga0207705_100025488 254
101 3300025909 Ga0207705_10054870 Ga0207705_100548702 254
102 3300025912 Ga0207707_10032777 Ga0207707_100327772 254
103 3300025912 Ga0207707_10195175 Ga0207707_101951752 254
104 3300025917 Ga0207660_10003854 Ga0207660_100038542 254
105 3300025917 Ga0207660_10524506 Ga0207660_105245061 254
106 3300025919 Ga0207657_10030889 Ga0207657_100308892 254
107 3300025921 Ga0207652_10000228 Ga0207652_1000022824 254
108 3300025921 Ga0207652_10003662 Ga0207652_1000366210 254
109 3300025932 Ga0207690_10018755 Ga0207690_100187552 254
110 3300025932 Ga0207690_10577007 Ga0207690_105770071 254
111 3300025949 Ga0207667_10000312 Ga0207667_1000031219 254
112 3300025949 Ga0207667_10025578 Ga0207667_100255783 254
113 3300025949 Ga0207667_10084973 Ga0207667_100849733 254
114 3300025949 Ga0207667_10130803 Ga0207667_101308032 254
115 3300025949 Ga0207667_10133517 Ga0207667_101335172 254
116 3300026067 Ga0207678_10011065 Ga0207678_100110652 254
117 3300026067 Ga0207678_10013732 Ga0207678_100137324 254
118 3300026116 Ga0207674_10051687 Ga0207674_100516873 254
119 3300026116 Ga0207674_10068181 Ga0207674_100681812 254
120 3300026116 Ga0207674_10081072 Ga0207674_100810722 254
121 3300026142 Ga0207698_10090397 Ga0207698_100903971 254
122 3300037312 Ga0395899_0005252 Ga0395899_0005252_1872_2645 254
123 3300037312 Ga0395899_0028491 Ga0395899_0028491_2198_2971 254
124 3300037312 Ga0395899_0028789 Ga0395899_0028789_1341_2132 254
125 3300037312 Ga0395899_0115607 Ga0395899_0115607_1118_1891 254
126 3300037312 Ga0395899_0248193 Ga0395899_0248193_253_1038 254
127 3300037418 Ga0395900_0004396 Ga0395900_0004396_6665_7438 254
128 3300037418 Ga0395900_0008777 Ga0395900_0008777_2960_3751 254
129 3300037418 Ga0395900_0043407 Ga0395900_0043407_2157_2930 254
130 3300037418 Ga0395900_0273013 Ga0395900_0273013_870_1661 254
131 3300037418 Ga0395900_0516223 Ga0395900_0516223_312_1103 254
132 3300037466 Ga0395898_0000794 Ga0395898_0000794_6615_7388 254
133 3300037466 Ga0395898_0020909 Ga0395898_0020909_1022_1795 254
134 3300037466 Ga0395898_0056702 Ga0395898_0056702_2691_3482 254
135 3300037471 Ga0395905_0116196 Ga0395905_0116196_83_874 254
136 3300038443 Ga0395901_0002103 Ga0395901_0002103_10978_11751 254
137 3300038443 Ga0395901_0025205 Ga0395901_0025205_2248_3039 254
138 3300038443 Ga0395901_0136095 Ga0395901_0136095_721_1494 254
139 3300038443 Ga0395901_0438401 Ga0395901_0438401_427_1200 254
140 3300042876 Ga0451577_0234965 Ga0451577_0234965_246_1013 254
141 3300044712 Ga0453684_0058590 Ga0453684_0058590_2718_3485 254
142 3300046476 Ga0495662_0098235 Ga0495662_0098235_505_1290 254
143 3300046642 Ga0495634_0031303 Ga0495634_0031303_850_1635 254
144 3300046809 Ga0495600_0183397 Ga0495600_0183397_37_822 254
145 3300049571 Ga0501034_0091738 Ga0501034_0091738_1383_2156 254
146 3300049586 Ga0501070_0295864 Ga0501070_0295864_123_896 254
147 3300049822 Ga0501035_0211554 Ga0501035_0211554_493_1275 254
148 3300049823 Ga0501044_0624490 Ga0501044_0624490_26_799 254
149 iso_pu_bacteria 8036736890 8036738512 254
150 3300005843 Ga0068860_100213948 Ga0068860_1002139481 255
151 3300009176 Ga0105242_10133479 Ga0105242_101334792 255
152 3300025295 Ga0209564_1044448 Ga0209564_10444482 255
153 3300025934 Ga0207686_10217885 Ga0207686_102178852 255
154 3300026078 Ga0207702_10094430 Ga0207702_100944302 255
155 3300028573 Ga0265334_10063586 Ga0265334_100635861 255
156 3300028666 Ga0265336_10058725 Ga0265336_100587251 255
157 3300037471 Ga0395905_0000011 Ga0395905_0000011_385945_386712 255
158 3300044712 Ga0453684_0001377 Ga0453684_0001377_2039_2809 255
159 3300044712 Ga0453684_0029328 Ga0453684_0029328_2727_3494 255
160 3300053108 Ga0500562_000008 Ga0500562_000008_123284_124075 255
161 3300053730 Ga0500645_007010 Ga0500645_007010_1574_2365 255
162 3300005338 Ga0068868_100269039 Ga0068868_1002690391 256
163 3300031251 Ga0265327_10111693 Ga0265327_101116932 256
164 3300031727 Ga0316576_10166566 Ga0316576_101665662 256
165 3300032004 Ga0307414_10000088 Ga0307414_1000008812 256
166 3300044673 Ga0453683_0045570 Ga0453683_0045570_1292_2065 256
167 3300044712 Ga0453684_0062632 Ga0453684_0062632_2236_3009 256
168 3300046523 Ga0495644_0004694 Ga0495644_0004694_433_1236 256
169 3300047445 Ga0495677_0019314 Ga0495677_0019314_715_1518 256
170 3300047447 Ga0495685_006615 Ga0495685_006615_1887_2690 256
171 3300048919 Ga0496116_0001485 Ga0496116_0001485_8482_9294 256
172 3300048920 Ga0496117_0004024 Ga0496117_0004024_9477_10289 256
173 3300048921 Ga0496118_0076664 Ga0496118_0076664_1332_2144 256
174 3300048925 Ga0496122_0009623 Ga0496122_0009623_5094_5906 256
175 3300048926 Ga0496123_0004377 Ga0496123_0004377_13651_14463 256
176 3300048927 Ga0496124_0042293 Ga0496124_0042293_402_1214 256
177 3300048928 Ga0496125_0161130 Ga0496125_0161130_411_1223 256
178 3300053156 Ga0500622_0000852 Ga0500622_0000852_5184_5978 256
179 iso_pu_bacteria 2914759650 2914762452 256
180 3300013102 Ga0157371_10000085 Ga0157371_1000008556 257
181 3300013104 Ga0157370_10106889 Ga0157370_101068892 257
182 3300042876 Ga0451577_0000558 Ga0451577_0000558_9777_10550 257
183 3300037312 Ga0395899_0000002 Ga0395899_0000002_664342_665148 258
184 3300003322 rootL2_10078754 rootL2_100787542 259
185 3300028573 Ga0265334_10014351 Ga0265334_100143512 259
186 3300031251 Ga0265327_10054832 Ga0265327_100548322 259
187 3300045051 Ga0451576_0000002 Ga0451576_0000002_1583064_1583846 259
188 3300025295 Ga0209564_1004209 Ga0209564_10042095 260
189 3300025297 Ga0209758_1011513 Ga0209758_10115132 260
190 3300025302 Ga0207426_1031402 Ga0207426_10314022 260
191 3300026088 Ga0207641_10326629 Ga0207641_103266292 260
192 iso_pu_bacteria 2884634485 2884635889 260
193 iso_pu_bacteria 2919692658 2919694889 260
194 3300005293 Ga0065715_10002453 Ga0065715_100024532 261
195 3300005435 Ga0070714_100316990 Ga0070714_1003169902 261
196 3300053088 Ga0500644_0045127 Ga0500644_0045127_429_1301 261
197 3300055283 Ga0500661_002005 Ga0500661_002005_2765_3637 261
198 3300005341 Ga0070691_10133782 Ga0070691_101337822 262
199 iso_pu_bacteria 2599185184 2599478959 263
200 iso_pu_bacteria 2896317667 2896319961 263
201 iso_pu_bacteria 2910245624 2910246049 263
202 iso_pu_bacteria 2919437846 2919442625 263
203 iso_pu_bacteria 2928078545 2928082726 263
204 iso_pu_bacteria 2928147474 2928153033 263
205 iso_pu_bacteria 2932082852 2932086093 263
206 iso_pu_bacteria 2977232053 2977236619 263
207 iso_pu_bacteria 8055588893 8055589640 263
208 3300032004 Ga0307414_10010264 Ga0307414_100102647 264
209 3300039062 Ga0400483_287105 Ga0400483_287105_878_1681 264
210 3300042876 Ga0451577_0005791 Ga0451577_0005791_3792_4592 264
211 3300044712 Ga0453684_0001190 Ga0453684_0001190_48756_49556 264
212 iso_pu_bacteria 2585427687 2586210706 264
213 iso_pu_bacteria 2738541283 2738754493 264
214 iso_pu_bacteria 2738541302 2738852282 264
215 iso_pu_bacteria 2739367651 2739589826 264
216 iso_pu_bacteria 2739367656 2739617041 264
217 iso_pu_bacteria 2739367663 2739647350 264
218 iso_pu_bacteria 2818991437 2819548691 264
219 iso_pu_bacteria 2842722452 2842722577 264
220 iso_pu_bacteria 2842903701 2842906489 264
221 iso_pu_bacteria 2842909656 2842914532 264
222 iso_pu_bacteria 2849281842 2849285831 264
223 iso_pu_bacteria 2852623160 2852624746 264
224 iso_pu_bacteria 2852627209 2852629972 264
225 iso_pu_bacteria 2857627736 2857629783 264
226 iso_pu_bacteria 2884933994 2884936367 264
227 iso_pu_bacteria 2890737413 2890740459 264
228 iso_pu_bacteria 2896344016 2896344910 264
229 iso_pu_bacteria 2904445276 2904449443 264
230 iso_pu_bacteria 2919186247 2919188260 264
231 iso_pu_bacteria 2939664404 2939664473 264
232 iso_pu_bacteria 2945997725 2945999485 264
233 iso_pu_bacteria 2954016120 2954016218 264
234 3300046516 Ga0495628_0000013 Ga0495628_0000013_24905_25765 265
235 iso_pu_bacteria 2721755487 2722727783 265
236 iso_pu_bacteria 2738541284 2738763688 265
237 iso_pu_bacteria 2739367866 2740032433 265
238 iso_pu_bacteria 2775506987 2776614831 265
239 iso_pu_bacteria 2898713307 2898715471 265
240 iso_pu_bacteria 2904780799 2904781539 265
241 iso_pu_bacteria 2911138879 2911140567 265
242 iso_pu_bacteria 2919177583 2919177750 265
243 3300001904 JGI24736J21556_1003575 JGI24736J21556_10035751 267
244 3300001989 JGI24739J22299_10078087 JGI24739J22299_100780871 267
245 3300001989 JGI24739J22299_10078198 JGI24739J22299_100781981 267
246 3300001990 JGI24737J22298_10000275 JGI24737J22298_1000027510 267
247 3300002067 JGI24735J21928_10000016 JGI24735J21928_1000001681 267
248 3300002067 JGI24735J21928_10040143 JGI24735J21928_100401432 267
249 3300002077 JGI24744J21845_10007379 JGI24744J21845_100073793 267
250 3300002737 JGI25162J39368_1000688 JGI25162J39368_100068811 267
251 3300002737 JGI25162J39368_1001792 JGI25162J39368_10017924 267
252 3300002741 JGI25157J39369_1005887 JGI25157J39369_10058872 267
253 3300002772 JGI25164J39214_1002306 JGI25164J39214_10023063 267
254 3300003214 JGI25165J46597_1000846 JGI25165J46597_100084613 267
255 3300003316 rootH1_10002396 rootH1_100023963 267
256 3300003320 rootH2_10013235 rootH2_1001323565 267
257 3300003323 rootH1_10001276 rootH1_1000127618 267
258 3300003323 rootH1_10023383 rootH1_100233834 267
259 3300003323 rootH1_10061147 rootH1_100611473 267
260 3300005288 Ga0065714_10115146 Ga0065714_101151461 267
261 3300005327 Ga0070658_10000028 Ga0070658_10000028140 267
262 3300005327 Ga0070658_10189942 Ga0070658_101899422 267
263 3300005328 Ga0070676_10000004 Ga0070676_1000000417 267
264 3300005339 Ga0070660_100022315 Ga0070660_1000223151 267
265 3300005339 Ga0070660_100354212 Ga0070660_1003542121 267
266 3300005356 Ga0070674_100160933 Ga0070674_1001609332 267
267 3300005364 Ga0070673_100492339 Ga0070673_1004923391 267
268 3300005366 Ga0070659_100000824 Ga0070659_1000008241 267
269 3300005366 Ga0070659_100076733 Ga0070659_1000767331 267
270 3300005366 Ga0070659_100150995 Ga0070659_1001509953 267
271 3300005456 Ga0070678_100015947 Ga0070678_1000159474 267
272 3300005457 Ga0070662_100000029 Ga0070662_10000002917 267
273 3300005459 Ga0068867_100029272 Ga0068867_1000292723 267
274 3300005539 Ga0068853_100010986 Ga0068853_1000109864 267
275 3300005539 Ga0068853_100035720 Ga0068853_1000357203 267
276 3300005539 Ga0068853_100067336 Ga0068853_1000673361 267
277 3300005548 Ga0070665_100000032 Ga0070665_100000032275 267
278 3300005563 Ga0068855_100000041 Ga0068855_10000004190 267
279 3300005563 Ga0068855_100000043 Ga0068855_10000004316 267
280 3300005563 Ga0068855_100040990 Ga0068855_1000409905 267
281 3300005577 Ga0068857_100036650 Ga0068857_1000366501 267
282 3300005578 Ga0068854_100179933 Ga0068854_1001799332 267
283 3300005614 Ga0068856_100000424 Ga0068856_10000042440 267
284 3300005614 Ga0068856_100000632 Ga0068856_1000006326 267
285 3300005614 Ga0068856_100009783 Ga0068856_1000097839 267
286 3300005614 Ga0068856_100053709 Ga0068856_1000537092 267
287 3300005614 Ga0068856_100487856 Ga0068856_1004878562 267
288 3300005616 Ga0068852_100000244 Ga0068852_10000024416 267
289 3300005616 Ga0068852_100185674 Ga0068852_1001856742 267
290 3300005616 Ga0068852_100579024 Ga0068852_1005790241 267
291 3300005718 Ga0068866_10059849 Ga0068866_100598492 267
292 3300005718 Ga0068866_10111276 Ga0068866_101112762 267
293 3300005834 Ga0068851_10126535 Ga0068851_101265352 267
294 3300005834 Ga0068851_10192526 Ga0068851_101925262 267
295 3300006195 Ga0075366_10000758 Ga0075366_1000075811 267
296 3300006195 Ga0075366_10025480 Ga0075366_100254801 267
297 3300006237 Ga0097621_100001022 Ga0097621_1000010227 267
298 3300006358 Ga0068871_100000021 Ga0068871_10000002140 267
299 3300006881 Ga0068865_100000045 Ga0068865_10000004562 267
300 3300009093 Ga0105240_10007920 Ga0105240_1000792015 267
301 3300009093 Ga0105240_10022098 Ga0105240_100220984 267
302 3300009093 Ga0105240_10055317 Ga0105240_100553174 267
303 3300009093 Ga0105240_10058286 Ga0105240_100582863 267
304 3300009093 Ga0105240_10063068 Ga0105240_100630682 267
305 3300009093 Ga0105240_10469453 Ga0105240_104694532 267
306 3300009174 Ga0105241_10005542 Ga0105241_100055427 267
307 3300009174 Ga0105241_10686192 Ga0105241_106861921 267
308 3300009176 Ga0105242_10018244 Ga0105242_100182445 267
309 3300009545 Ga0105237_10004075 Ga0105237_100040759 267
310 3300009545 Ga0105237_10005461 Ga0105237_100054612 267
311 3300009545 Ga0105237_10018709 Ga0105237_100187096 267
312 3300009545 Ga0105237_10024081 Ga0105237_100240816 267
313 3300009551 Ga0105238_10125961 Ga0105238_101259612 267
314 3300009551 Ga0105238_10166639 Ga0105238_101666391 267
315 3300010375 Ga0105239_10000001 Ga0105239_10000001219 267
316 3300010375 Ga0105239_10000017 Ga0105239_1000001794 267
317 3300010375 Ga0105239_10000190 Ga0105239_1000019045 267
318 3300010375 Ga0105239_10002606 Ga0105239_1000260618 267
319 3300010375 Ga0105239_10003229 Ga0105239_1000322911 267
320 3300010375 Ga0105239_10074932 Ga0105239_100749324 267
321 3300010375 Ga0105239_10151726 Ga0105239_101517262 267
322 3300010375 Ga0105239_10341583 Ga0105239_103415831 267
323 3300013100 Ga0157373_10000013 Ga0157373_10000013115 267
324 3300013100 Ga0157373_10066890 Ga0157373_100668902 267
325 3300013102 Ga0157371_10000266 Ga0157371_1000026647 267
326 3300013102 Ga0157371_10001789 Ga0157371_1000178912 267
327 3300013102 Ga0157371_10066476 Ga0157371_100664761 267
328 3300013102 Ga0157371_10335614 Ga0157371_103356142 267
329 3300013104 Ga0157370_10040868 Ga0157370_100408685 267
330 3300013104 Ga0157370_10121344 Ga0157370_101213443 267
331 3300013105 Ga0157369_10001323 Ga0157369_100013239 267
332 3300013105 Ga0157369_10029021 Ga0157369_100290217 267
333 3300013296 Ga0157374_10000700 Ga0157374_1000070019 267
334 3300013296 Ga0157374_10000775 Ga0157374_1000077512 267
335 3300013296 Ga0157374_10002662 Ga0157374_100026627 267
336 3300013297 Ga0157378_10037217 Ga0157378_100372173 267
337 3300013297 Ga0157378_10265796 Ga0157378_102657962 267
338 3300013306 Ga0163162_10000010 Ga0163162_10000010190 267
339 3300013306 Ga0163162_10007708 Ga0163162_1000770810 267
340 3300013306 Ga0163162_10024503 Ga0163162_100245033 267
341 3300013307 Ga0157372_10000073 Ga0157372_1000007380 267
342 3300013307 Ga0157372_10002553 Ga0157372_100025537 267
343 3300013307 Ga0157372_10014858 Ga0157372_100148582 267
344 3300013307 Ga0157372_10075507 Ga0157372_100755073 267
345 3300013307 Ga0157372_10101211 Ga0157372_101012113 267
346 3300013308 Ga0157375_10060765 Ga0157375_100607651 267
347 3300014745 Ga0157377_10051895 Ga0157377_100518952 267
348 3300014969 Ga0157376_10040398 Ga0157376_100403984 267
349 3300017792 Ga0163161_10066815 Ga0163161_100668151 267
350 3300021361 Ga0213872_10011171 Ga0213872_100111712 267
351 3300025231 Ga0207427_100138 Ga0207427_10013832 267
352 3300025233 Ga0209437_100010 Ga0209437_10001069 267
353 3300025233 Ga0209437_100169 Ga0209437_10016910 267
354 3300025250 Ga0209026_1000320 Ga0209026_100032038 267
355 3300025250 Ga0209026_1003989 Ga0209026_10039896 267
356 3300025258 Ga0209129_1006691 Ga0209129_10066913 267
357 3300025261 Ga0209233_1000017 Ga0209233_100001782 267
358 3300025261 Ga0209233_1012287 Ga0209233_10122872 267
359 3300025272 Ga0209455_1003033 Ga0209455_10030335 267
360 3300025904 Ga0207647_10000022 Ga0207647_1000002263 267
361 3300025904 Ga0207647_10000211 Ga0207647_1000021129 267
362 3300025904 Ga0207647_10043916 Ga0207647_100439164 267
363 3300025907 Ga0207645_10000151 Ga0207645_1000015112 267
364 3300025909 Ga0207705_10000045 Ga0207705_10000045141 267
365 3300025909 Ga0207705_10031081 Ga0207705_100310812 267
366 3300025911 Ga0207654_10004382 Ga0207654_100043827 267
367 3300025913 Ga0207695_10010313 Ga0207695_100103136 267
368 3300025913 Ga0207695_10012097 Ga0207695_1001209710 267
369 3300025913 Ga0207695_10048507 Ga0207695_100485072 267
370 3300025913 Ga0207695_10120429 Ga0207695_101204293 267
371 3300025914 Ga0207671_10001167 Ga0207671_1000116725 267
372 3300025914 Ga0207671_10005732 Ga0207671_100057327 267
373 3300025914 Ga0207671_10006644 Ga0207671_100066446 267
374 3300025914 Ga0207671_10013135 Ga0207671_100131357 267
375 3300025914 Ga0207671_10027546 Ga0207671_100275465 267
376 3300025919 Ga0207657_10040214 Ga0207657_100402144 267
377 3300025919 Ga0207657_10354300 Ga0207657_103543001 267
378 3300025932 Ga0207690_10000351 Ga0207690_1000035125 267
379 3300025932 Ga0207690_10004191 Ga0207690_100041913 267
380 3300025932 Ga0207690_10213136 Ga0207690_102131362 267
381 3300025933 Ga0207706_10000047 Ga0207706_1000004743 267
382 3300025938 Ga0207704_10000077 Ga0207704_100000777 267
383 3300025949 Ga0207667_10000015 Ga0207667_1000001515 267
384 3300025949 Ga0207667_10000404 Ga0207667_100004047 267
385 3300025949 Ga0207667_10009196 Ga0207667_100091964 267
386 3300025949 Ga0207667_10079549 Ga0207667_100795492 267
387 3300025960 Ga0207651_10340735 Ga0207651_103407351 267
388 3300025981 Ga0207640_10008525 Ga0207640_100085255 267
389 3300026041 Ga0207639_10005896 Ga0207639_100058965 267
390 3300026041 Ga0207639_10051690 Ga0207639_100516904 267
391 3300026041 Ga0207639_10086774 Ga0207639_100867742 267
392 3300026078 Ga0207702_10009859 Ga0207702_100098594 267
393 3300026078 Ga0207702_10041267 Ga0207702_100412674 267
394 3300026078 Ga0207702_10043943 Ga0207702_100439435 267
395 3300026078 Ga0207702_10443845 Ga0207702_104438452 267
396 3300026089 Ga0207648_10002829 Ga0207648_100028297 267
397 3300026116 Ga0207674_10132117 Ga0207674_101321173 267
398 3300026121 Ga0207683_10066580 Ga0207683_100665804 267
399 3300026142 Ga0207698_10192679 Ga0207698_101926792 267
400 3300028379 Ga0268266_10000030 Ga0268266_1000003056 267
401 3300028786 Ga0307517_10005480 Ga0307517_1000548014 267
402 3300028794 Ga0307515_10001136 Ga0307515_1000113629 267
403 3300028794 Ga0307515_10001603 Ga0307515_100016038 267
404 3300028794 Ga0307515_10201181 Ga0307515_102011812 267
405 3300028800 Ga0265338_10011270 Ga0265338_100112705 267
406 3300028800 Ga0265338_10155082 Ga0265338_101550822 267
407 3300031251 Ga0265327_10061967 Ga0265327_100619672 267
408 3300031507 Ga0307509_10029694 Ga0307509_100296945 267
409 3300033179 Ga0307507_10001027 Ga0307507_1000102711 267
410 3300035115 Ga0373941_0019620 Ga0373941_0019620_813_1616 267
411 3300037312 Ga0395899_0000209 Ga0395899_0000209_60707_61510 267
412 3300037418 Ga0395900_0000460 Ga0395900_0000460_29395_30198 267
413 3300037418 Ga0395900_0000721 Ga0395900_0000721_37557_38360 267
414 3300037418 Ga0395900_0049038 Ga0395900_0049038_463_1266 267
415 3300037466 Ga0395898_0069048 Ga0395898_0069048_1367_2170 267
416 3300037471 Ga0395905_0000149 Ga0395905_0000149_32741_33544 267
417 3300038443 Ga0395901_0000198 Ga0395901_0000198_55551_56354 267
418 3300038443 Ga0395901_0002579 Ga0395901_0002579_17489_18292 267
419 3300039447 Ga0436361_0280573 Ga0436361_0280573_313_1116 267
420 3300042005 Ga0439448_0028594 Ga0439448_0028594_36_1016 267
421 3300044656 Ga0466969_0079499 Ga0466969_0079499_327_1130 267
422 3300045049 Ga0466959_0287328 Ga0466959_0287328_278_1081 267
423 3300046471 Ga0495650_0000277 Ga0495650_0000277_12873_13676 267
424 3300046471 Ga0495650_0052258 Ga0495650_0052258_307_1110 267
425 3300046474 Ga0495605_0030915 Ga0495605_0030915_1813_2616 267
426 3300046492 Ga0495585_0000695 Ga0495585_0000695_25613_26416 267
427 3300046492 Ga0495585_0003287 Ga0495585_0003287_10069_10872 267
428 3300046506 Ga0495583_0070485 Ga0495583_0070485_81_884 267
429 3300046507 Ga0495606_0000033 Ga0495606_0000033_110391_111194 267
430 3300046507 Ga0495606_0016334 Ga0495606_0016334_3605_4411 267
431 3300046507 Ga0495606_0041421 Ga0495606_0041421_1038_1841 267
432 3300046507 Ga0495606_0071266 Ga0495606_0071266_115_918 267
433 3300046512 Ga0495610_0002950 Ga0495610_0002950_3766_4569 267
434 3300046512 Ga0495610_0097223 Ga0495610_0097223_399_1202 267
435 3300046513 Ga0495616_0007622 Ga0495616_0007622_2178_2981 267
436 3300046513 Ga0495616_0010435 Ga0495616_0010435_1243_2046 267
437 3300046516 Ga0495628_0167215 Ga0495628_0167215_477_1280 267
438 3300046518 Ga0495631_0011918 Ga0495631_0011918_3236_4039 267
439 3300046524 Ga0495648_0002201 Ga0495648_0002201_11655_12458 267
440 3300046524 Ga0495648_0127311 Ga0495648_0127311_266_1069 267
441 3300046529 Ga0495652_0295542 Ga0495652_0295542_211_1014 267
442 3300046529 Ga0495652_0488343 Ga0495652_0488343_27_830 267
443 3300046538 Ga0495609_0002573 Ga0495609_0002573_9080_9883 267
444 3300046558 Ga0495633_0000172 Ga0495633_0000172_32048_32851 267
445 3300046558 Ga0495633_0037966 Ga0495633_0037966_547_1350 267
446 3300046616 Ga0495668_0000069 Ga0495668_0000069_135896_136699 267
447 3300046616 Ga0495668_0166167 Ga0495668_0166167_135_938 267
448 3300046660 Ga0495625_0000048 Ga0495625_0000048_12906_13709 267
449 3300046660 Ga0495625_0000419 Ga0495625_0000419_39541_40344 267
450 3300046660 Ga0495625_0000752 Ga0495625_0000752_10031_10834 267
451 3300046660 Ga0495625_0062781 Ga0495625_0062781_56_859 267
452 3300046660 Ga0495625_0073447 Ga0495625_0073447_1440_2243 267
453 3300046660 Ga0495625_0092722 Ga0495625_0092722_802_1605 267
454 3300046665 Ga0495661_0003353 Ga0495661_0003353_9174_9977 267
455 3300046665 Ga0495661_0022489 Ga0495661_0022489_124_927 267
456 3300046665 Ga0495661_0056565 Ga0495661_0056565_99_902 267
457 3300046665 Ga0495661_0193274 Ga0495661_0193274_83_886 267
458 3300046694 Ga0495649_0000059 Ga0495649_0000059_85257_86060 267
459 3300046794 Ga0495589_0042907 Ga0495589_0042907_1221_2024 267
460 3300046809 Ga0495600_0068135 Ga0495600_0068135_460_1263 267
461 3300046810 Ga0495660_0067865 Ga0495660_0067865_898_1701 267
462 3300047323 Ga0495683_0062508 Ga0495683_0062508_221_1024 267
463 3300047470 Ga0495681_0122275 Ga0495681_0122275_52_855 267
464 3300047472 Ga0495686_0000299 Ga0495686_0000299_74736_75539 267
465 3300047472 Ga0495686_0048573 Ga0495686_0048573_571_1374 267
466 3300047472 Ga0495686_0067913 Ga0495686_0067913_411_1214 267
467 3300050493 nmdc:mga0k408_649_c1 nmdc:mga0k408_649_c1_8863_9666 267
468 3300050493 nmdc:mga0k408_6505_c1 nmdc:mga0k408_6505_c1_2817_3620 267
469 3300053080 Ga0500635_0003356 Ga0500635_0003356_2978_3781 267
470 3300053122 Ga0500608_005003 Ga0500608_005003_3373_4185 267
471 3300053122 Ga0500608_092969 Ga0500608_092969_589_1392 267
472 3300053125 Ga0500618_000012 Ga0500618_000012_49580_50383 267
473 3300053130 Ga0500642_0017818 Ga0500642_0017818_733_1536 267
474 iso_pu_bacteria 2522125168 2522549517 267
475 3300002773 JGI25152J39213_1000182 JGI25152J39213_100018228 268
476 3300002774 JGI25150J39212_1000002 JGI25150J39212_100000258 268
477 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003598 268
478 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003430 268
479 3300003781 Ga0055536_1000007 Ga0055536_1000007225 268
480 3300005288 Ga0065714_10002188 Ga0065714_1000218860 268
481 3300005288 Ga0065714_10002254 Ga0065714_1000225427 268
482 3300005288 Ga0065714_10065778 Ga0065714_100657782 268
483 3300005327 Ga0070658_10027068 Ga0070658_100270682 268
484 3300009093 Ga0105240_10000126 Ga0105240_10000126115 268
485 3300009174 Ga0105241_10002344 Ga0105241_100023446 268
486 3300009545 Ga0105237_10001066 Ga0105237_1000106611 268
487 3300013100 Ga0157373_10013747 Ga0157373_100137473 268
488 3300013104 Ga0157370_10000267 Ga0157370_1000026744 268
489 3300013104 Ga0157370_10000750 Ga0157370_1000075024 268
490 3300013104 Ga0157370_10089823 Ga0157370_100898233 268
491 3300013104 Ga0157370_10145564 Ga0157370_101455643 268
492 3300013105 Ga0157369_10000441 Ga0157369_1000044151 268
493 3300013105 Ga0157369_10683580 Ga0157369_106835801 268
494 3300013306 Ga0163162_10000439 Ga0163162_1000043915 268
495 3300014497 Ga0182008_10000549 Ga0182008_1000054912 268
496 3300014497 Ga0182008_10000940 Ga0182008_100009402 268
497 3300014497 Ga0182008_10021912 Ga0182008_100219122 268
498 3300014497 Ga0182008_10062959 Ga0182008_100629592 268
499 3300015261 Ga0182006_1000375 Ga0182006_100037529 268
500 3300015261 Ga0182006_1000610 Ga0182006_100061017 268
501 3300015262 Ga0182007_10001103 Ga0182007_1000110311 268
502 3300015262 Ga0182007_10012291 Ga0182007_100122912 268
503 3300015682 Ga0183373_1005 Ga0183373_100535 268
504 3300017792 Ga0163161_10000232 Ga0163161_1000023215 268
505 3300017792 Ga0163161_10001126 Ga0163161_1000112617 268
506 3300017792 Ga0163161_10045080 Ga0163161_100450805 268
507 3300017792 Ga0163161_10069853 Ga0163161_100698532 268
508 3300017792 Ga0163161_10125506 Ga0163161_101255062 268
509 3300025245 Ga0207425_1000004 Ga0207425_1000004882 268
510 3300025258 Ga0209129_1000005 Ga0209129_100000558 268
511 3300025292 Ga0209676_1000058 Ga0209676_1000058218 268
512 3300025294 Ga0209025_1000009 Ga0209025_1000009882 268
513 3300025297 Ga0209758_1000010 Ga0209758_1000010883 268
514 3300025298 Ga0209050_1000054 Ga0209050_1000054218 268
515 3300025909 Ga0207705_10021129 Ga0207705_100211294 268
516 3300025911 Ga0207654_10062516 Ga0207654_100625162 268
517 3300025913 Ga0207695_10000013 Ga0207695_10000013436 268
518 3300025913 Ga0207695_10102638 Ga0207695_101026382 268
519 3300025914 Ga0207671_10001212 Ga0207671_100012126 268
520 3300025914 Ga0207671_10029417 Ga0207671_100294173 268
521 3300028794 Ga0307515_10035384 Ga0307515_100353849 268
522 3300030731 Ga0316177_1005756 Ga0316177_100575613 268
523 3300030732 Ga0316176_1163657 Ga0316176_11636575 268
524 3300030742 Ga0316183_1049060 Ga0316183_104906028 268
525 3300030744 Ga0316181_1078627 Ga0316181_10786271 268
526 3300030744 Ga0316181_1217212 Ga0316181_12172125 268
527 3300031548 Ga0307408_100000412 Ga0307408_10000041231 268
528 3300031548 Ga0307408_100002539 Ga0307408_1000025399 268
529 3300031548 Ga0307408_100011427 Ga0307408_1000114273 268
530 3300031548 Ga0307408_100269578 Ga0307408_1002695782 268
531 3300031731 Ga0307405_10000043 Ga0307405_1000004342 268
532 3300031903 Ga0307407_10000039 Ga0307407_100000399 268
533 3300031911 Ga0307412_10006483 Ga0307412_100064834 268
534 3300031995 Ga0307409_100057316 Ga0307409_1000573164 268
535 3300032002 Ga0307416_100000029 Ga0307416_10000002939 268
536 3300032002 Ga0307416_100882767 Ga0307416_1008827671 268
537 3300032002 Ga0307416_101064965 Ga0307416_1010649651 268
538 3300032004 Ga0307414_10002804 Ga0307414_100028045 268
539 3300032004 Ga0307414_10004599 Ga0307414_100045994 268
540 3300032004 Ga0307414_10009130 Ga0307414_100091302 268
541 3300032004 Ga0307414_10010743 Ga0307414_100107437 268
542 3300032004 Ga0307414_10110509 Ga0307414_101105092 268
543 3300032004 Ga0307414_10127765 Ga0307414_101277653 268
544 3300032004 Ga0307414_10207374 Ga0307414_102073742 268
545 3300032004 Ga0307414_10226300 Ga0307414_102263002 268
546 3300032004 Ga0307414_10444103 Ga0307414_104441032 268
547 3300046507 Ga0495606_0075952 Ga0495606_0075952_151_957 268
548 3300046512 Ga0495610_0000026 Ga0495610_0000026_240939_241745 268
549 3300046512 Ga0495610_0000386 Ga0495610_0000386_5763_6569 268
550 3300047472 Ga0495686_0002147 Ga0495686_0002147_1212_2123 268
551 3300048925 Ga0496122_0001885 Ga0496122_0001885_52_858 268
552 3300048926 Ga0496123_0005024 Ga0496123_0005024_5388_6194 268
553 3300053139 Ga0500568_0071336 Ga0500568_0071336_281_1099 268
554 iso_pu_bacteria 3003233435 3003234538 268
555 2162886007 SwRhRL2b_contig_1102301 SwRhRL2b_0203.00004500 269
556 2162886007 SwRhRL2b_contig_415591 SwRhRL2b_0105.00006740 269
557 3300003781 Ga0055536_1007230 Ga0055536_10072304 269
558 3300005262 Ga0065165_1000519 Ga0065165_100051929 269
559 3300005288 Ga0065714_10002791 Ga0065714_1000279113 269
560 3300005288 Ga0065714_10002889 Ga0065714_1000288916 269
561 3300005289 Ga0065704_10000237 Ga0065704_1000023714 269
562 3300005289 Ga0065704_10072608 Ga0065704_100726087 269
563 3300005289 Ga0065704_10088389 Ga0065704_100883892 269
564 3300005289 Ga0065704_10244727 Ga0065704_102447271 269
565 3300009148 Ga0105243_10000007 Ga0105243_1000000737 269
566 3300013100 Ga0157373_10000021 Ga0157373_1000002148 269
567 3300013102 Ga0157371_10000711 Ga0157371_100007118 269
568 3300013102 Ga0157371_10020362 Ga0157371_100203626 269
569 3300013102 Ga0157371_10048972 Ga0157371_100489722 269
570 3300013104 Ga0157370_10004077 Ga0157370_1000407712 269
571 3300013104 Ga0157370_10121143 Ga0157370_101211432 269
572 3300013104 Ga0157370_10273839 Ga0157370_102738392 269
573 3300014497 Ga0182008_10000017 Ga0182008_1000001796 269
574 3300015261 Ga0182006_1004860 Ga0182006_10048604 269
575 3300025292 Ga0209676_1001678 Ga0209676_100167810 269
576 3300025298 Ga0209050_1013318 Ga0209050_10133184 269
577 3300025935 Ga0207709_10000033 Ga0207709_10000033134 269
578 3300031548 Ga0307408_100197124 Ga0307408_1001971242 269
579 3300031731 Ga0307405_10062578 Ga0307405_100625783 269
580 3300031911 Ga0307412_10000004 Ga0307412_1000000428 269
581 3300031911 Ga0307412_10047985 Ga0307412_100479853 269
582 3300032004 Ga0307414_10015266 Ga0307414_100152664 269
583 3300049663 Ga0501223_003246 Ga0501223_003246_1398_2207 269
584 3300053093 Ga0500651_0001246 Ga0500651_0001246_5977_6786 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

78

151

0.98

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

209

280

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yh5-assembly1.cif.gz_A mazg(mycobacterium tuberculosis) 0.9223 8 102
7yh5-assembly2.cif.gz_D mazg(mycobacterium tuberculosis) 0.9171 8 102
3crc-assembly1.cif.gz_A crystal structure of escherichia coli mazg, the regulator of nutritional stress response 0.8836 17 269
2yxh-assembly1.cif.gz_B crystal structure of mazg-related protein from thermotoga maritima 0.8799 18 130
3crc-assembly1.cif.gz_A crystal structure of escherichia coli mazg, the regulator of nutritional stress response 0.8727 17 269
ID Description Score Start End Superfamily
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9785 17 132 1.10.287.1080
af_Q2G0R6_232_355_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9616 17 133 1.10.287.1080
3crcA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9586 17 107 1.10.287.1080
3craB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9538 136 268 1.10.287.1080
3crcB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9512 136 267 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A369QVU3-F1-model_v4 XTP/dITP diphosphatase (EC 3.6.1.66) 0.9959 14 125 GO:0006203
GO:0035870
GO:0036220
GO:0036222
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
AF-A0A059X1M9-F1-model_v4 MazG nucleotide pyrophosphohydrolase domain protein 0.9926 14 130 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A4R1M1V9-F1-model_v4 XTP/dITP diphosphohydrolase 0.9915 3 269 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A3HVF7-F1-model_v4 MazG family protein 0.9879 14 267 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A2G6GRL6-F1-model_v4 Nucleoside triphosphate pyrophosphohydrolase 0.9866 14 130 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429

Feature Viewer

pLDDT pTM Quality
89.78 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map