F466310

General Info

Members Datasets Scaffolds Average Seq Length
583 361 473 400

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0175612|Ga0496102_0175612_372_1721
Length 449
Sequence MARQPAGCLPQAVIGQRARRAAQDVPTNVAEPFQSRIHSLRISRWAGIFMNKLSLPLSGIRVLDLSRVLAGPSCAMVLGDFGAEVIKVEHPRRGDDTRDWGSRIGSTQTAYFNSVNRNKRSVTLDLQTDEGQRLALALAAQCDVVIQNFKAGGAEKMGLGYAQIKAVRPDVVYCSISGYDRTGPEAARPGYDLLVQGEAGLMAMNGKADQPPLKFGVAVVDLFTGMYAAQAVLAALFERRRTGDGRHLEMALYDCGIMVTTYYGLEALLLEKDPPRYGNSHPSIVPYGVFDAADGPLVITVGNNSQFGRFCREVIERPELADDERFKTNVLRTANRAALLSQIVPALRCQPRSELMQRLASAGIPCGEVLGLHEALTSERTARGGLVTQQPHPEVGSVQVLAPPYRLDGERLPVRRPPPVLGEGVQDVLSGLLGLDQAELQHLKANGVI

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
12 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
13 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
14 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
15 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
16 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
17 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
18 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
19 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
20 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
21 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
22 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
23 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
24 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
25 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
26 2643221658 Variovorax sp. Root411 Isolate Unclassified
27 2643221672 Variovorax sp. Root434 Isolate Unclassified
28 2643221683 Variovorax sp. Root473 Isolate Unclassified
29 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
30 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
31 2738541277 Variovorax sp. GV051 Isolate Unclassified
32 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
33 2738541307 Variovorax sp. GV008 Isolate Unclassified
34 2738543019 Variovorax sp. GV040 Isolate Unclassified
35 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
36 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
37 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
38 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
39 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
40 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
41 2818991446 Variovorax sp. 1180 Isolate Unclassified
42 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
43 2818991452 Burkholderia cepacia 561 Isolate Unclassified
44 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
45 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
46 2842677519 Variovorax sp. R-72495 Isolate Unclassified
47 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
48 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
49 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
50 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
51 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
52 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
53 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
54 2885198086 Variovorax sp. 679 Isolate Unclassified
55 2885211737 Variovorax sp. 553 Isolate Unclassified
56 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
57 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
58 2899924645 Variovorax sp. 369 Isolate Unclassified
59 2902330777 Methylobacterium sp. 2A Isolate Unclassified
60 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
61 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
62 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
63 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
64 2904456579 Variovorax sp. 2002 Isolate Unclassified
65 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
66 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
67 2904564687 Burkholderia sp. 571 Isolate Unclassified
68 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
69 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
70 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
71 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
72 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
73 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
74 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
75 2928037797 Variovorax sp. 1126 Isolate Unclassified
76 2928044640 Variovorax sp. 1128 Isolate Unclassified
77 2928051484 Variovorax sp. 1133 Isolate Unclassified
78 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
79 2928070936 Variovorax gossypii 1167 Isolate Unclassified
80 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
81 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
82 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
83 2928163908 Burkholderia sp. 567 Isolate Unclassified
84 2928170801 Burkholderia sp. 572 Isolate Unclassified
85 2928536128 Burkholderia sola 565 Isolate Unclassified
86 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
87 2929520902 Variovorax beijingensis 502 Isolate Unclassified
88 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
89 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
90 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
91 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
92 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
93 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
94 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
95 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
96 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
97 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
98 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
99 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
100 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
101 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
102 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
103 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
104 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
105 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
106 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
107 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
108 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
109 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
110 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
111 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
112 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
113 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
114 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
115 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
116 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
117 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
118 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
122 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
126 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
130 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
135 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
136 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
159 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
226 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
229 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
230 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
345 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
346 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
354 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
355 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
356 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
357 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
358 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
359 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
360 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
361 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.96
Metatranscriptomes 0.17
Isolates 18.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.5
Nodule 2.23
Rhizoplane 5.32
Rhizosphere 56.26
Stem 0
Stem Tuber 0
Unclassified 12.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000280 3300002067 Bacteria 17853
2 JGI24735J21928_10011278 3300002067 Bacteria 2837
3 JGI25158J39367_1010721 3300002739 Bacteria 1233
4 JGI25152J39213_1011320 3300002773 Bacteria 1980
5 JGI25151J46595_10006142 3300003187 Bacteria 6089
6 rootL2_10056961 3300003322 Bacteria 3501
7 Ga0006562J51391_1042127 3300003578 Bacteria 4725
8 Ga0055538_1000008 3300003751 Bacteria 398547
9 Ga0055539_1000012 3300003752 Bacteria 398547
10 Ga0055533_1000015 3300003756 Bacteria 398547
11 Ga0055532_1002124 3300003758 Bacteria 4483
12 Ga0055525_1000017 3300003759 Bacteria 398547
13 Ga0055527_1001629 3300003760 Bacteria 4483
14 Ga0055535_1000108 3300003761 Bacteria 89707
15 Ga0055535_1003412 3300003761 Bacteria 4525
16 Ga0055535_1003416 3300003761 Bacteria 4523
17 Ga0055542_1000051 3300003762 Bacteria 175242
18 Ga0055542_1001092 3300003762 Bacteria 16477
19 Ga0055529_1000997 3300003763 Bacteria 13856
20 Ga0055537_1000792 3300003773 Bacteria 15832
21 Ga0055524_1005278 3300003775 Bacteria 5803
22 Ga0055534_1000290 3300003784 Bacteria 33979
23 Ga0055528_1000928 3300003790 Bacteria 19583
24 Ga0055528_1004786 3300003790 Bacteria 6445
25 Ga0055530_10025794 3300003791 Bacteria 1635
26 Ga0055540_1000796 3300003792 Bacteria 21352
27 Ga0055540_1002763 3300003792 Bacteria 8996
28 Ga0055531_10013040 3300003794 Bacteria 3860
29 Ga0055541_1000009 3300003841 Bacteria 398547
30 Ga0058692_1001352 3300003856 Bacteria 9128
31 Ga0055543_1000879 3300004625 Bacteria 14320
32 Ga0055543_1001495 3300004625 Bacteria 9195
33 Ga0065165_1007299 3300005262 Bacteria 5482
34 Ga0070658_10130798 3300005327 Bacteria 2092
35 Ga0070666_10006477 3300005335 Bacteria 7196
36 Ga0070666_10113956 3300005335 Bacteria 1871
37 Ga0070660_100000001 3300005339 Bacteria 190487
38 Ga0070659_100000189 3300005366 Bacteria 47370
39 Ga0070667_100153562 3300005367 Bacteria 2024
40 Ga0070663_100004388 3300005455 Bacteria 8283
41 Ga0068867_100116154 3300005459 Bacteria 2062
42 Ga0068853_100027855 3300005539 Bacteria 4750
43 Ga0068853_100142351 3300005539 Bacteria 2153
44 Ga0070672_100109592 3300005543 Bacteria 2249
45 Ga0068855_100152728 3300005563 Bacteria 2625
46 Ga0070664_100030611 3300005564 Bacteria 4490
47 Ga0070664_100047629 3300005564 Bacteria 3621
48 Ga0068857_100050592 3300005577 Bacteria 3685
49 Ga0068854_100012898 3300005578 Bacteria 5473
50 Ga0068854_100106897 3300005578 Bacteria 2106
51 Ga0068856_100395006 3300005614 Bacteria 1403
52 Ga0068852_100094955 3300005616 Bacteria 2677
53 Ga0068851_10052761 3300005834 Bacteria 2068
54 Ga0075365_10010345 3300006038 Bacteria 5426
55 Ga0075363_100101022 3300006048 Bacteria 1596
56 Ga0075364_10009672 3300006051 Bacteria 5794
57 Ga0075364_10015062 3300006051 Bacteria 4788
58 Ga0075362_10002848 3300006177 Bacteria 5908
59 Ga0075370_10002516 3300006353 Bacteria 8512
60 Ga0075370_10012527 3300006353 Bacteria 4485
61 Ga0099826_10000541 3300006948 Bacteria 18746
62 Ga0105244_10004724 3300009036 Bacteria 9268
63 Ga0105250_10035743 3300009092 Bacteria 1994
64 Ga0105240_10005282 3300009093 Bacteria 19283
65 Ga0105240_10037846 3300009093 Bacteria 6196
66 Ga0105240_10211351 3300009093 Bacteria 2267
67 Ga0105245_10206042 3300009098 Bacteria 1891
68 Ga0105243_10000101 3300009148 Bacteria 98298
69 Ga0105243_10000838 3300009148 Bacteria 29247
70 Ga0105243_10007790 3300009148 Bacteria 8235
71 Ga0105243_10026518 3300009148 Bacteria 4436
72 Ga0105242_10345102 3300009176 Bacteria 1373
73 Ga0105237_10023372 3300009545 Bacteria 6335
74 Ga0105237_10061060 3300009545 Bacteria 3769
75 Ga0105237_10236642 3300009545 Bacteria 1827
76 Ga0105238_10000111 3300009551 Bacteria 89931
77 Ga0105238_10016342 3300009551 Bacteria 7511
78 Ga0105239_10164483 3300010375 Bacteria 2480
79 Ga0157371_10000128 3300013102 Bacteria 116349
80 Ga0157371_10059094 3300013102 Bacteria 2719
81 Ga0157369_10068093 3300013105 Bacteria 3824
82 Ga0182008_10012589 3300014497 Bacteria 4465
83 Ga0182008_10020360 3300014497 Bacteria 3418
84 Ga0182008_10032377 3300014497 Bacteria 2627
85 Ga0182007_10004704 3300015262 Bacteria 6151
86 Ga0182007_10016587 3300015262 Bacteria 2714
87 Ga0182007_10017331 3300015262 Bacteria 2633
88 Ga0182007_10026078 3300015262 Bacteria 2030
89 Ga0182005_1027395 3300015265 Bacteria 1554
90 Ga0183362_10002 3300015683 Bacteria 1432711
91 Ga0163161_10001574 3300017792 Bacteria 16836
92 Ga0163161_10004673 3300017792 Bacteria 9522
93 Ga0163161_10023680 3300017792 Bacteria 4333
94 Ga0213872_10002340 3300021361 Bacteria 11262
95 Ga0213872_10010050 3300021361 Bacteria 4515
96 Ga0209436_101494 3300025208 Bacteria 8085
97 Ga0209784_100005 3300025224 Bacteria 1040422
98 Ga0209566_100005 3300025225 Bacteria 1040422
99 Ga0209566_101253 3300025225 Bacteria 8612
100 Ga0209674_100009 3300025226 Bacteria 1040422
101 Ga0209672_100046 3300025228 Bacteria 264244
102 Ga0209672_100088 3300025228 Bacteria 121401
103 Ga0209672_102154 3300025228 Bacteria 5197
104 Ga0209147_100043 3300025229 Bacteria 300460
105 Ga0209147_100130 3300025229 Bacteria 121401
106 Ga0209147_100451 3300025229 Bacteria 25804
107 Ga0209147_100476 3300025229 Bacteria 24510
108 Ga0209563_100012 3300025230 Bacteria 1040422
109 Ga0209258_100023 3300025242 Bacteria 547286
110 Ga0209258_100132 3300025242 Bacteria 175292
111 Ga0209258_100204 3300025242 Bacteria 121401
112 Ga0207425_1009114 3300025245 Bacteria 2490
113 Ga0209677_100006 3300025253 Bacteria 1040422
114 Ga0209148_1000007 3300025254 Bacteria 1592273
115 Ga0209148_1000029 3300025254 Bacteria 579199
116 Ga0209148_1002080 3300025254 Bacteria 7632
117 Ga0209759_1013884 3300025256 Bacteria 2158
118 Ga0209129_1000084 3300025258 Bacteria 182554
119 Ga0209129_1000974 3300025258 Bacteria 17211
120 Ga0209129_1001931 3300025258 Bacteria 10864
121 Ga0209565_1000285 3300025263 Bacteria 49572
122 Ga0209565_1000526 3300025263 Bacteria 27114
123 Ga0209565_1000658 3300025263 Bacteria 22142
124 Ga0209565_1001335 3300025263 Bacteria 11232
125 Ga0209565_1003712 3300025263 Bacteria 4848
126 Ga0209455_1000064 3300025272 Bacteria 332404
127 Ga0209455_1005283 3300025272 Bacteria 4028
128 Ga0209673_1000084 3300025273 Bacteria 215878
129 Ga0209673_1000114 3300025273 Bacteria 178557
130 Ga0209673_1000857 3300025273 Bacteria 39554
131 Ga0209673_1001172 3300025273 Bacteria 28386
132 Ga0209673_1001325 3300025273 Bacteria 24865
133 Ga0209673_1007829 3300025273 Bacteria 4846
134 Ga0209130_1000124 3300025284 Bacteria 124578
135 Ga0209130_1000323 3300025284 Bacteria 56069
136 Ga0209130_1000937 3300025284 Bacteria 23294
137 Ga0209130_1001647 3300025284 Bacteria 13692
138 Ga0209675_1000062 3300025291 Bacteria 178557
139 Ga0209675_1001395 3300025291 Bacteria 14042
140 Ga0209675_1004044 3300025291 Bacteria 6680
141 Ga0209675_1006226 3300025291 Bacteria 4830
142 Ga0209676_1000112 3300025292 Bacteria 208328
143 Ga0209676_1001058 3300025292 Bacteria 31511
144 Ga0209676_1003050 3300025292 Bacteria 10810
145 Ga0209676_1010622 3300025292 Bacteria 3805
146 Ga0209676_1016526 3300025292 Bacteria 2658
147 Ga0209025_1001103 3300025294 Bacteria 38867
148 Ga0209025_1003528 3300025294 Bacteria 14680
149 Ga0209025_1007104 3300025294 Bacteria 8468
150 Ga0209025_1015410 3300025294 Bacteria 4609
151 Ga0209025_1021136 3300025294 Bacteria 3521
152 Ga0209025_1026558 3300025294 Bacteria 2901
153 Ga0209025_1028828 3300025294 Bacteria 2706
154 Ga0209564_1000108 3300025295 Bacteria 213699
155 Ga0209564_1000320 3300025295 Bacteria 93338
156 Ga0209564_1000357 3300025295 Bacteria 85402
157 Ga0209758_1000184 3300025297 Bacteria 140021
158 Ga0209758_1008503 3300025297 Bacteria 6624
159 Ga0209050_1000052 3300025298 Bacteria 351785
160 Ga0209050_1000445 3300025298 Bacteria 74894
161 Ga0209050_1005240 3300025298 Bacteria 8268
162 Ga0209256_1000101 3300025299 Bacteria 200246
163 Ga0209256_1000156 3300025299 Bacteria 144277
164 Ga0209256_1000226 3300025299 Bacteria 103682
165 Ga0207426_1000049 3300025302 Bacteria 401954
166 Ga0207426_1000086 3300025302 Bacteria 292089
167 Ga0207426_1000219 3300025302 Bacteria 135057
168 Ga0209051_1000161 3300025303 Bacteria 125704
169 Ga0209051_1000220 3300025303 Bacteria 96404
170 Ga0209051_1000365 3300025303 Bacteria 66149
171 Ga0209051_1000634 3300025303 Bacteria 40443
172 Ga0209051_1004720 3300025303 Bacteria 8267
173 Ga0209257_1000037 3300025304 Bacteria 612915
174 Ga0209257_1000411 3300025304 Bacteria 83024
175 Ga0209257_1012221 3300025304 Bacteria 4003
176 Ga0207656_10030912 3300025321 Bacteria 2215
177 Ga0207655_1002549 3300025728 Bacteria 14584
178 Ga0207713_1037917 3300025735 Bacteria 2050
179 Ga0207680_10180021 3300025903 Bacteria 1429
180 Ga0207705_10072048 3300025909 Bacteria 2506
181 Ga0207695_10000769 3300025913 Bacteria 61134
182 Ga0207695_10001169 3300025913 Bacteria 45284
183 Ga0207695_10045611 3300025913 Bacteria 4651
184 Ga0207695_10092630 3300025913 Bacteria 3032
185 Ga0207695_10246160 3300025913 Bacteria 1688
186 Ga0207657_10000022 3300025919 Bacteria 154101
187 Ga0207694_10000199 3300025924 Bacteria 60220
188 Ga0207690_10000010 3300025932 Bacteria 330298
189 Ga0207709_10000103 3300025935 Bacteria 131589
190 Ga0207709_10000621 3300025935 Bacteria 29102
191 Ga0207709_10002926 3300025935 Bacteria 10429
192 Ga0207709_10006718 3300025935 Bacteria 6444
193 Ga0207709_10007395 3300025935 Bacteria 6118
194 Ga0207667_10009007 3300025949 Bacteria 11806
195 Ga0207658_10015657 3300025986 Bacteria 5206
196 Ga0207678_10000013 3300026067 Bacteria 141619
197 Ga0207648_10094837 3300026089 Bacteria 2609
198 Ga0207674_10097955 3300026116 Bacteria 2916
199 Ga0207698_10068776 3300026142 Bacteria 2798
200 Ga0207698_10122203 3300026142 Bacteria 2206
201 Ga0209371_1000526 3300027312 Bacteria 36476
202 Ga0209282_1000282 3300027666 Bacteria 25169
203 Ga0268265_10060906 3300028380 Bacteria 2894
204 Ga0268256_1001282 3300030500 Bacteria 15565
205 Ga0314311_1006183 3300030733 Bacteria 1633
206 Ga0316178_1012286 3300030735 Bacteria 5502
207 Ga0316181_1113472 3300030744 Bacteria 3605
208 Ga0316182_1060776 3300030745 Bacteria 3338
209 Ga0265327_10004544 3300031251 Bacteria 12232
210 Ga0307408_100000067 3300031548 Bacteria 120790
211 Ga0307514_10011789 3300031649 Bacteria 7272
212 Ga0316579_10020503 3300031691 Bacteria 2934
213 Ga0307405_10052165 3300031731 Bacteria 2541
214 Ga0307405_10112014 3300031731 Bacteria 1850
215 Ga0307405_10155461 3300031731 Bacteria 1613
216 Ga0307410_10081902 3300031852 Bacteria 2269
217 Ga0307406_10000778 3300031901 Bacteria 17868
218 Ga0307406_10171772 3300031901 Bacteria 1569
219 Ga0307414_10060296 3300032004 Bacteria 2682
220 Ga0307414_10157563 3300032004 Bacteria 1799
221 Ga0395899_0033609 3300037312 Bacteria 3851
222 Ga0395899_0113319 3300037312 Bacteria 1948
223 Ga0395900_0002787 3300037418 Bacteria 19106
224 Ga0395900_0026536 3300037418 Bacteria 5931
225 Ga0395900_0027639 3300037418 Bacteria 5811
226 Ga0395900_0143106 3300037418 Bacteria 2447
227 Ga0395900_0152317 3300037418 Bacteria 2362
228 Ga0395898_0005973 3300037466 Bacteria 13076
229 Ga0395898_0074277 3300037466 Bacteria 3284
230 Ga0395905_0014810 3300037471 Bacteria 7435
231 Ga0395905_0045244 3300037471 Bacteria 4128
232 Ga0395905_0077262 3300037471 Bacteria 3119
233 Ga0395901_0000011 3300038443 Bacteria 400724
234 Ga0395901_0008524 3300038443 Bacteria 10356
235 Ga0395901_0078284 3300038443 Bacteria 3452
236 Ga0395901_0183458 3300038443 Bacteria 2195
237 Ga0436361_0271890 3300039447 Bacteria 3795
238 Ga0436361_0548351 3300039447 Bacteria 10954
239 Ga0436361_0682271 3300039447 Bacteria 5628
240 Ga0439465_0021136 3300041413 Bacteria 2041
241 Ga0439442_003588 3300042002 Bacteria 3071
242 Ga0450911_000181 3300042115 Bacteria 24977
243 Ga0450898_004926 3300042134 Bacteria 1995
244 Ga0450906_004940 3300042145 Bacteria 2768
245 Ga0439459_0013526 3300042438 Bacteria 1470
246 Ga0450918_000577 3300042531 Bacteria 7804
247 Ga0450918_002858 3300042531 Bacteria 3241
248 Ga0451577_0005754 3300042876 Bacteria 12569
249 Ga0453683_0005073 3300044673 Bacteria 9238
250 Ga0466966_0049446 3300044684 Bacteria 2678
251 Ga0466961_0034779 3300044693 Bacteria 3235
252 Ga0453684_0004829 3300044712 Bacteria 27681
253 Ga0466957_0006466 3300044842 Bacteria 6616
254 Ga0466959_0118248 3300045049 Bacteria 1886
255 Ga0451576_0034877 3300045051 Bacteria 5342
256 Ga0451576_0064781 3300045051 Bacteria 3806
257 Ga0466958_0000289 3300045836 Bacteria 19621
258 Ga0466967_0123181 3300045976 Bacteria 2398
259 Ga0495617_043705 3300046452 Bacteria 1496
260 Ga0495603_0002112 3300046455 Bacteria 11689
261 Ga0495590_0000737 3300046457 Bacteria 14905
262 Ga0495590_0006032 3300046457 Bacteria 4751
263 Ga0495591_036637 3300046458 Bacteria 1426
264 Ga0495629_0000819 3300046459 Bacteria 25210
265 Ga0495629_0001899 3300046459 Bacteria 16271
266 Ga0495629_0004676 3300046459 Bacteria 10256
267 Ga0495629_0156099 3300046459 Bacteria 1585
268 Ga0495638_0000574 3300046460 Bacteria 41469
269 Ga0495651_0152200 3300046462 Bacteria 1666
270 Ga0495653_0000429 3300046463 Bacteria 33193
271 Ga0495653_0001077 3300046463 Bacteria 21056
272 Ga0495653_0002383 3300046463 Bacteria 14960
273 Ga0495653_0006584 3300046463 Bacteria 9539
274 Ga0495650_0008974 3300046471 Bacteria 5749
275 Ga0495580_0000658 3300046472 Bacteria 29321
276 Ga0495580_0011928 3300046472 Bacteria 6697
277 Ga0495580_0019615 3300046472 Bacteria 5021
278 Ga0495580_0049940 3300046472 Bacteria 2958
279 Ga0495580_0050571 3300046472 Bacteria 2939
280 Ga0495580_0103580 3300046472 Bacteria 1978
281 Ga0495582_0022956 3300046473 Bacteria 3412
282 Ga0495605_0012074 3300046474 Bacteria 4801
283 Ga0495639_0008628 3300046475 Bacteria 4371
284 Ga0495662_0107977 3300046476 Bacteria 1363
285 Ga0495664_0000315 3300046477 Bacteria 23220
286 Ga0495664_0122475 3300046477 Bacteria 1572
287 Ga0495584_0007822 3300046491 Bacteria 5561
288 Ga0495584_0037341 3300046491 Bacteria 2454
289 Ga0495584_0044975 3300046491 Bacteria 2227
290 Ga0495585_0001299 3300046492 Bacteria 19924
291 Ga0495585_0013098 3300046492 Bacteria 4861
292 Ga0495596_0011599 3300046500 Bacteria 3795
293 Ga0495583_0001225 3300046506 Bacteria 27299
294 Ga0495583_0003075 3300046506 Bacteria 13222
295 Ga0495583_0033651 3300046506 Bacteria 2463
296 Ga0495606_0001644 3300046507 Bacteria 29139
297 Ga0495606_0002545 3300046507 Bacteria 20974
298 Ga0495606_0039957 3300046507 Bacteria 3156
299 Ga0495606_0055543 3300046507 Bacteria 2560
300 Ga0495606_0064868 3300046507 Bacteria 2322
301 Ga0495616_0000114 3300046513 Bacteria 70661
302 Ga0495618_0000718 3300046514 Bacteria 23126
303 Ga0495628_0002855 3300046516 Bacteria 15482
304 Ga0495628_0056822 3300046516 Bacteria 3079
305 Ga0495630_0001648 3300046517 Bacteria 15520
306 Ga0495631_0001853 3300046518 Bacteria 12484
307 Ga0495631_0003405 3300046518 Bacteria 8706
308 Ga0495631_0014221 3300046518 Bacteria 3846
309 Ga0495643_0000127 3300046522 Bacteria 123390
310 Ga0495643_0085995 3300046522 Bacteria 1629
311 Ga0495648_0003795 3300046524 Bacteria 13141
312 Ga0495648_0004920 3300046524 Bacteria 11238
313 Ga0495648_0010695 3300046524 Bacteria 6970
314 Ga0495648_0013584 3300046524 Bacteria 6007
315 Ga0495666_0013115 3300046526 Bacteria 4129
316 Ga0495666_0018073 3300046526 Bacteria 3511
317 Ga0495642_0002942 3300046528 Bacteria 6788
318 Ga0495642_0012579 3300046528 Bacteria 3262
319 Ga0495652_0027307 3300046529 Bacteria 5030
320 Ga0495654_0030645 3300046530 Bacteria 2735
321 Ga0495665_0000097 3300046531 Bacteria 40415
322 Ga0495665_0000155 3300046531 Bacteria 34013
323 Ga0495665_0016754 3300046531 Bacteria 3945
324 Ga0495665_0027610 3300046531 Bacteria 3046
325 Ga0495665_0029158 3300046531 Bacteria 2957
326 Ga0495665_0031260 3300046531 Bacteria 2849
327 Ga0495586_0007802 3300046535 Bacteria 5706
328 Ga0495586_0011759 3300046535 Bacteria 4654
329 Ga0495587_0045964 3300046536 Bacteria 2593
330 Ga0495609_0013004 3300046538 Bacteria 3938
331 Ga0495597_0013439 3300046542 Bacteria 3921
332 Ga0495645_0006438 3300046543 Bacteria 8147
333 Ga0495645_0006965 3300046543 Bacteria 7857
334 Ga0495645_0045845 3300046543 Bacteria 3189
335 Ga0495633_0001124 3300046558 Bacteria 21488
336 Ga0495667_0014469 3300046559 Bacteria 5331
337 Ga0495656_0006514 3300046615 Bacteria 4098
338 Ga0495656_0027331 3300046615 Bacteria 2278
339 Ga0495668_0013733 3300046616 Bacteria 4766
340 Ga0495611_0009019 3300046648 Bacteria 4219
341 Ga0495625_0000297 3300046660 Bacteria 76945
342 Ga0495625_0079410 3300046660 Bacteria 2288
343 Ga0495635_0050193 3300046663 Bacteria 2876
344 Ga0495661_0000971 3300046665 Bacteria 25999
345 Ga0495661_0022234 3300046665 Bacteria 4126
346 Ga0495661_0162820 3300046665 Bacteria 1196
347 Ga0495588_0064561 3300046674 Bacteria 1899
348 Ga0495588_0070489 3300046674 Bacteria 1817
349 Ga0495623_0002326 3300046679 Bacteria 12676
350 Ga0495623_0004421 3300046679 Bacteria 9238
351 Ga0495646_0000284 3300046680 Bacteria 25889
352 Ga0495646_0001781 3300046680 Bacteria 12946
353 Ga0495646_0017436 3300046680 Bacteria 4555
354 Ga0495646_0026460 3300046680 Bacteria 3643
355 Ga0495613_0097918 3300046689 Bacteria 2119
356 Ga0495624_0000486 3300046690 Bacteria 30963
357 Ga0495624_0000554 3300046690 Bacteria 29318
358 Ga0495624_0011431 3300046690 Bacteria 6099
359 Ga0495624_0012294 3300046690 Bacteria 5856
360 Ga0495624_0023331 3300046690 Bacteria 4081
361 Ga0495670_0000127 3300046691 Bacteria 32865
362 Ga0495671_0004162 3300046692 Bacteria 8718
363 Ga0495671_0030102 3300046692 Bacteria 2783
364 Ga0495649_0004419 3300046694 Bacteria 9190
365 Ga0495649_0004642 3300046694 Bacteria 8933
366 Ga0495649_0025012 3300046694 Bacteria 3327
367 Ga0495589_0005249 3300046794 Bacteria 6848
368 Ga0495600_0043072 3300046809 Bacteria 2943
369 Ga0495581_0015819 3300047315 Bacteria 4381
370 Ga0495604_0005373 3300047317 Bacteria 10158
371 Ga0495604_0014717 3300047317 Bacteria 6235
372 Ga0495674_0000647 3300047319 Bacteria 32685
373 Ga0495674_0001534 3300047319 Bacteria 22578
374 Ga0495674_0005453 3300047319 Bacteria 12220
375 Ga0495674_0014132 3300047319 Bacteria 7479
376 Ga0495674_0100129 3300047319 Bacteria 2466
377 Ga0495674_0104487 3300047319 Bacteria 2408
378 Ga0495672_0006454 3300047320 Bacteria 9077
379 Ga0495672_0008707 3300047320 Bacteria 7444
380 Ga0495672_0084843 3300047320 Bacteria 1756
381 Ga0495676_0021056 3300047321 Bacteria 5707
382 Ga0495676_0048272 3300047321 Bacteria 3434
383 Ga0495676_0175065 3300047321 Bacteria 1507
384 Ga0495680_0003266 3300047322 Bacteria 16080
385 Ga0495680_0008834 3300047322 Bacteria 9118
386 Ga0495683_0000523 3300047323 Bacteria 29254
387 Ga0495683_0001560 3300047323 Bacteria 14830
388 Ga0495683_0002605 3300047323 Bacteria 10831
389 Ga0495683_0085333 3300047323 Bacteria 1535
390 Ga0495687_013335 3300047443 Bacteria 4300
391 Ga0495687_016072 3300047443 Bacteria 3776
392 Ga0495677_0000684 3300047445 Bacteria 13755
393 Ga0495679_012476 3300047446 Bacteria 3232
394 Ga0495673_0009825 3300047469 Bacteria 5257
395 Ga0495673_0022858 3300047469 Bacteria 3056
396 Ga0495673_0027674 3300047469 Bacteria 2694
397 Ga0495681_0000729 3300047470 Bacteria 25247
398 Ga0495684_0011101 3300047471 Bacteria 6963
399 Ga0495593_0000207 3300047673 Bacteria 31075
400 Ga0495593_0000861 3300047673 Bacteria 17571
401 Ga0495593_0001333 3300047673 Bacteria 14431
402 Ga0495593_0001795 3300047673 Bacteria 12736
403 Ga0495593_0003929 3300047673 Bacteria 8877
404 Ga0495593_0012080 3300047673 Bacteria 4947
405 Ga0495602_0001137 3300048088 Bacteria 26030
406 Ga0495602_0006588 3300048088 Bacteria 12171
407 Ga0495602_0011607 3300048088 Bacteria 9101
408 Ga0496100_0014163 3300048903 Bacteria 4622
409 Ga0496100_0071617 3300048903 Bacteria 2315
410 Ga0496100_0249117 3300048903 Bacteria 1313
411 Ga0496101_0010002 3300048904 Bacteria 6250
412 Ga0496101_0014112 3300048904 Bacteria 5364
413 Ga0496101_0028785 3300048904 Bacteria 3882
414 Ga0496102_0028256 3300048905 Bacteria 5009
415 Ga0496102_0175612 3300048905 Bacteria 2017
416 Ga0496104_0020536 3300048907 Bacteria 6055
417 Ga0496104_0296471 3300048907 Bacteria 1529
418 Ga0496105_0011544 3300048908 Bacteria 6984
419 Ga0496105_0016382 3300048908 Bacteria 5916
420 Ga0496105_0034177 3300048908 Bacteria 4181
421 Ga0496106_0138929 3300048909 Bacteria 1910
422 Ga0496107_0105256 3300048910 Bacteria 2071
423 Ga0496109_0003895 3300048912 Bacteria 12468
424 Ga0496110_0004135 3300048913 Bacteria 11217
425 Ga0496110_0039023 3300048913 Bacteria 4134
426 Ga0496110_0084210 3300048913 Bacteria 2838
427 Ga0496111_0074009 3300048914 Bacteria 2481
428 Ga0496112_0002367 3300048915 Bacteria 15148
429 Ga0496113_0003751 3300048916 Bacteria 9166
430 Ga0496113_0019242 3300048916 Bacteria 4773
431 Ga0496114_0001072 3300048917 Bacteria 20590
432 Ga0496117_0018131 3300048920 Bacteria 5850
433 Ga0496117_0042213 3300048920 Bacteria 3330
434 Ga0496117_0049074 3300048920 Bacteria 3007
435 Ga0496118_0037018 3300048921 Bacteria 3934
436 Ga0496118_0048254 3300048921 Bacteria 3291
437 Ga0496121_0006535 3300048924 Bacteria 14408
438 Ga0496121_0019785 3300048924 Bacteria 6709
439 Ga0496121_0139918 3300048924 Bacteria 1797
440 Ga0496122_0045701 3300048925 Bacteria 3400
441 Ga0496123_0022217 3300048926 Bacteria 4898
442 Ga0496124_0035100 3300048927 Bacteria 4391
443 Ga0496125_0086465 3300048928 Bacteria 2371
444 Ga0496125_0118214 3300048928 Bacteria 1899
445 Ga0496126_0247236 3300048929 Bacteria 1487
446 Ga0501034_0224053 3300049571 Bacteria 1832
447 Ga0501034_0458827 3300049571 Bacteria 1191
448 Ga0501262_000431 3300049759 Bacteria 5031
449 Ga0501035_0021951 3300049822 Bacteria 5865
450 Ga0501044_0003206 3300049823 Bacteria 18437
451 nmdc:mga03n38_93451_c1 3300050490 Bacteria 1437
452 nmdc:mga00v17_7557_c1 3300050491 Bacteria 5804
453 nmdc:mga0yw44_4295_c1 3300050492 Bacteria 6503
454 nmdc:mga0k408_19785_c1 3300050493 Bacteria 3766
455 nmdc:mga07m45_124926_c1 3300050496 Bacteria 1488
456 nmdc:mga07m45_18343_c1 3300050496 Bacteria 3775
457 nmdc:mga07m45_3226_c1 3300050496 Bacteria 7828
458 nmdc:mga07m45_54144_c1 3300050496 Bacteria 2268
459 Ga0500610_0000551 3300053079 Bacteria 11547
460 Ga0500610_0003312 3300053079 Bacteria 6151
461 Ga0500644_0008259 3300053088 Bacteria 2743
462 Ga0500651_0002027 3300053093 Bacteria 10517
463 Ga0500607_004085 3300053121 Bacteria 10221
464 Ga0500658_0001187 3300053134 Bacteria 10625
465 Ga0500658_0003178 3300053134 Bacteria 6266
466 Ga0500559_0002100 3300053136 Bacteria 10621
467 Ga0500568_0004258 3300053139 Bacteria 7687
468 Ga0500616_0000108 3300053153 Bacteria 152917
469 Ga0500616_0125572 3300053153 Bacteria 1219
470 Ga0500622_0000937 3300053156 Bacteria 24806
471 Ga0500634_0033327 3300053161 Bacteria 2808
472 Ga0500636_0018717 3300053177 Bacteria 4095
473 Ga0466962_0017070 3300061719 Bacteria 3498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0458827 Ga0501034_0458827_97_1179 346
2 3300003792 Ga0055540_1002763 Ga0055540_10027635 363
3 3300009148 Ga0105243_10007790 Ga0105243_100077904 363
4 3300025292 Ga0209676_1003050 Ga0209676_10030505 363
5 3300025303 Ga0209051_1000634 Ga0209051_100063433 363
6 3300025304 Ga0209257_1012221 Ga0209257_10122212 363
7 3300025935 Ga0207709_10002926 Ga0207709_100029265 363
8 3300048913 Ga0496110_0039023 Ga0496110_0039023_1680_2771 363
9 3300031691 Ga0316579_10020503 Ga0316579_100205033 368
10 3300037418 Ga0395900_0027639 Ga0395900_0027639_3241_4350 368
11 3300037466 Ga0395898_0005973 Ga0395898_0005973_5761_6870 368
12 3300037471 Ga0395905_0014810 Ga0395905_0014810_4647_5756 368
13 3300038443 Ga0395901_0008524 Ga0395901_0008524_2500_3609 368
14 3300048912 Ga0496109_0003895 Ga0496109_0003895_1899_3014 371
15 3300053153 Ga0500616_0125572 Ga0500616_0125572_85_1203 371
16 3300049822 Ga0501035_0021951 Ga0501035_0021951_1839_3005 372
17 3300049823 Ga0501044_0003206 Ga0501044_0003206_9188_10354 372
18 3300046452 Ga0495617_043705 Ga0495617_043705_93_1217 374
19 3300046462 Ga0495651_0152200 Ga0495651_0152200_48_1172 374
20 3300046473 Ga0495582_0022956 Ga0495582_0022956_2259_3383 374
21 3300046476 Ga0495662_0107977 Ga0495662_0107977_180_1304 374
22 3300046518 Ga0495631_0014221 Ga0495631_0014221_381_1505 374
23 3300046522 Ga0495643_0085995 Ga0495643_0085995_404_1528 374
24 3300046665 Ga0495661_0162820 Ga0495661_0162820_23_1147 374
25 3300047323 Ga0495683_0001560 Ga0495683_0001560_7306_8430 374
26 3300047469 Ga0495673_0027674 Ga0495673_0027674_1412_2536 374
27 3300050496 nmdc:mga07m45_124926_c1 nmdc:mga07m45_124926_c1_32_1156 374
28 3300042134 Ga0450898_004926 Ga0450898_004926_842_1975 377
29 3300042876 Ga0451577_0005754 Ga0451577_0005754_1547_2704 380
30 3300044673 Ga0453683_0005073 Ga0453683_0005073_1617_2774 380
31 3300025245 Ga0207425_1009114 Ga0207425_10091142 381
32 3300025258 Ga0209129_1000974 Ga0209129_10009749 381
33 3300025263 Ga0209565_1001335 Ga0209565_10013354 381
34 3300025263 Ga0209565_1003712 Ga0209565_10037123 381
35 3300025297 Ga0209758_1008503 Ga0209758_10085032 381
36 3300042145 Ga0450906_004940 Ga0450906_004940_1586_2734 382
37 3300048913 Ga0496110_0084210 Ga0496110_0084210_137_1285 382
38 3300005335 Ga0070666_10006477 Ga0070666_100064774 383
39 3300005367 Ga0070667_100153562 Ga0070667_1001535622 383
40 3300042115 Ga0450911_000181 Ga0450911_000181_21380_22543 385
41 3300048924 Ga0496121_0006535 Ga0496121_0006535_10862_12025 385
42 3300048929 Ga0496126_0247236 Ga0496126_0247236_310_1473 385
43 3300009148 Ga0105243_10000101 Ga0105243_1000010178 386
44 3300025935 Ga0207709_10000103 Ga0207709_1000010323 386
45 3300046460 Ga0495638_0000574 Ga0495638_0000574_1622_2821 386
46 3300046514 Ga0495618_0000718 Ga0495618_0000718_21120_22295 386
47 3300046809 Ga0495600_0043072 Ga0495600_0043072_1649_2824 386
48 3300053088 Ga0500644_0008259 Ga0500644_0008259_1419_2582 386
49 3300053136 Ga0500559_0002100 Ga0500559_0002100_4813_5976 386
50 3300053153 Ga0500616_0000108 Ga0500616_0000108_23474_24637 386
51 3300053156 Ga0500622_0000937 Ga0500622_0000937_2188_3351 386
52 iso_pu_bacteria 2902330777 2902332097 386
53 3300044693 Ga0466961_0034779 Ga0466961_0034779_63_1241 387
54 3300044842 Ga0466957_0006466 Ga0466957_0006466_5156_6334 387
55 3300045049 Ga0466959_0118248 Ga0466959_0118248_572_1750 387
56 3300045976 Ga0466967_0123181 Ga0466967_0123181_255_1433 387
57 3300061719 Ga0466962_0017070 Ga0466962_0017070_1127_2305 387
58 3300003792 Ga0055540_1000796 Ga0055540_10007963 388
59 3300025303 Ga0209051_1000161 Ga0209051_1000161100 388
60 3300049571 Ga0501034_0224053 Ga0501034_0224053_381_1574 393
61 iso_pu_bacteria 2889306138 2889306520 393
62 iso_pu_bacteria 2902405164 2902411454 393
63 3300005335 Ga0070666_10113956 Ga0070666_101139561 394
64 3300025903 Ga0207680_10180021 Ga0207680_101800211 394
65 3300031901 Ga0307406_10171772 Ga0307406_101717721 394
66 3300037418 Ga0395900_0143106 Ga0395900_0143106_550_1746 394
67 3300037466 Ga0395898_0074277 Ga0395898_0074277_975_2171 394
68 3300038443 Ga0395901_0078284 Ga0395901_0078284_153_1349 394
69 3300042438 Ga0439459_0013526 Ga0439459_0013526_158_1354 394
70 3300045051 Ga0451576_0034877 Ga0451576_0034877_1326_2510 394
71 iso_pu_bacteria 2595698237 2596374918 394
72 iso_pu_bacteria 2881101125 2881101438 394
73 iso_pu_bacteria 2902330777 2902332372 394
74 iso_pu_bacteria 2928125067 2928129841 394
75 3300037312 Ga0395899_0113319 Ga0395899_0113319_671_1858 395
76 3300037418 Ga0395900_0152317 Ga0395900_0152317_767_1954 395
77 3300037471 Ga0395905_0077262 Ga0395905_0077262_1700_2887 395
78 3300044712 Ga0453684_0004829 Ga0453684_0004829_23809_25002 395
79 3300046459 Ga0495629_0001899 Ga0495629_0001899_12909_14096 395
80 3300046663 Ga0495635_0050193 Ga0495635_0050193_1229_2416 395
81 3300050491 nmdc:mga00v17_7557_c1 nmdc:mga00v17_7557_c1_819_2009 395
82 iso_pu_bacteria 2738541281 2738747439 395
83 iso_pu_bacteria 2738543032 2739356721 395
84 3300050496 nmdc:mga07m45_18343_c1 nmdc:mga07m45_18343_c1_315_1508 397
85 iso_pu_bacteria 2510917014 2511100483 397
86 iso_pu_bacteria 2510917015 2511105853 397
87 iso_pu_bacteria 2599185239 2599740170 397
88 iso_pu_bacteria 2599185240 2599744158 397
89 iso_pu_bacteria 2599185355 2600206195 397
90 iso_pu_bacteria 2675903129 2676743491 397
91 iso_pu_bacteria 2818991452 2819633632 397
92 iso_pu_bacteria 2856287931 2856289509 397
93 iso_pu_bacteria 2857357740 2857363977 397
94 iso_pu_bacteria 2863421361 2863427237 397
95 iso_pu_bacteria 2870068957 2870070038 397
96 iso_pu_bacteria 2904564687 2904567736 397
97 iso_pu_bacteria 2904571731 2904574862 397
98 iso_pu_bacteria 2928157003 2928161974 397
99 iso_pu_bacteria 2928163908 2928169226 397
100 iso_pu_bacteria 2928170801 2928178619 397
101 iso_pu_bacteria 2928536128 2928539047 397
102 iso_pu_bacteria 2981990288 2981992862 397
103 iso_pu_bacteria 8018845410 8018846333 397
104 iso_pu_bacteria 8020938398 8020939951 397
105 iso_pu_bacteria 8020945358 8020951581 397
106 iso_pu_bacteria 8020953355 8020954770 397
107 iso_pu_bacteria 8021120328 8021128270 397
108 iso_pu_bacteria 8039098773 8039104577 397
109 3300005543 Ga0070672_100109592 Ga0070672_1001095922 398
110 3300009176 Ga0105242_10345102 Ga0105242_103451021 398
111 3300009545 Ga0105237_10061060 Ga0105237_100610603 398
112 3300014497 Ga0182008_10020360 Ga0182008_100203602 398
113 3300014497 Ga0182008_10032377 Ga0182008_100323772 398
114 3300015262 Ga0182007_10017331 Ga0182007_100173313 398
115 3300017792 Ga0163161_10023680 Ga0163161_100236803 398
116 3300025986 Ga0207658_10015657 Ga0207658_100156572 398
117 3300031251 Ga0265327_10004544 Ga0265327_100045446 398
118 3300041413 Ga0439465_0021136 Ga0439465_0021136_150_1352 398
119 3300042531 Ga0450918_000577 Ga0450918_000577_2790_3992 398
120 3300045051 Ga0451576_0064781 Ga0451576_0064781_1172_2371 398
121 3300046463 Ga0495653_0006584 Ga0495653_0006584_286_1485 398
122 3300046475 Ga0495639_0008628 Ga0495639_0008628_1724_2923 398
123 3300046491 Ga0495584_0037341 Ga0495584_0037341_429_1625 398
124 3300046528 Ga0495642_0012579 Ga0495642_0012579_1867_3063 398
125 3300046530 Ga0495654_0030645 Ga0495654_0030645_1137_2333 398
126 3300046538 Ga0495609_0013004 Ga0495609_0013004_2497_3693 398
127 3300046542 Ga0495597_0013439 Ga0495597_0013439_2024_3220 398
128 3300046615 Ga0495656_0006514 Ga0495656_0006514_1583_2782 398
129 3300046615 Ga0495656_0027331 Ga0495656_0027331_15_1214 398
130 3300046660 Ga0495625_0000297 Ga0495625_0000297_70673_71875 398
131 3300046665 Ga0495661_0022234 Ga0495661_0022234_626_1825 398
132 3300046679 Ga0495623_0002326 Ga0495623_0002326_5366_6565 398
133 3300046680 Ga0495646_0026460 Ga0495646_0026460_1412_2611 398
134 3300046794 Ga0495589_0005249 Ga0495589_0005249_3808_5004 398
135 3300047317 Ga0495604_0005373 Ga0495604_0005373_6944_8143 398
136 3300047319 Ga0495674_0100129 Ga0495674_0100129_923_2122 398
137 3300047320 Ga0495672_0006454 Ga0495672_0006454_1605_2801 398
138 3300048903 Ga0496100_0249117 Ga0496100_0249117_17_1216 398
139 3300048907 Ga0496104_0020536 Ga0496104_0020536_3227_4426 398
140 3300048908 Ga0496105_0016382 Ga0496105_0016382_3207_4406 398
141 3300049759 Ga0501262_000431 Ga0501262_000431_182_1384 398
142 3300050490 nmdc:mga03n38_93451_c1 nmdc:mga03n38_93451_c1_12_1214 398
143 3300050493 nmdc:mga0k408_19785_c1 nmdc:mga0k408_19785_c1_888_2090 398
144 3300050496 nmdc:mga07m45_3226_c1 nmdc:mga07m45_3226_c1_2081_3283 398
145 3300053177 Ga0500636_0018717 Ga0500636_0018717_2458_3663 398
146 iso_pu_bacteria 2501025502 2501085010 398
147 iso_pu_bacteria 2510917013 2511090438 398
148 iso_pu_bacteria 2512047030 2512348803 398
149 iso_pu_bacteria 2512047030 2512352450 398
150 iso_pu_bacteria 2513020051 2513231269 398
151 iso_pu_bacteria 2513237082 2513551757 398
152 iso_pu_bacteria 2513237083 2513561894 398
153 iso_pu_bacteria 2513237150 2513953552 398
154 iso_pu_bacteria 2513237165 2514044241 398
155 iso_pu_bacteria 2515154189 2516017641 398
156 iso_pu_bacteria 2521172590 2521557039 398
157 iso_pu_bacteria 2551306416 2553004834 398
158 iso_pu_bacteria 2562617112 2563064859 398
159 iso_pu_bacteria 2599185214 2599620980 398
160 iso_pu_bacteria 2599185226 2599674214 398
161 iso_pu_bacteria 2599185227 2599678404 398
162 iso_pu_bacteria 2599185229 2599690491 398
163 iso_pu_bacteria 2643221628 2644161272 398
164 iso_pu_bacteria 2643221658 2644326176 398
165 iso_pu_bacteria 2643221672 2644400842 398
166 iso_pu_bacteria 2643221683 2644466071 398
167 iso_pu_bacteria 2711768613 2713482152 398
168 iso_pu_bacteria 2738541277 2738720821 398
169 iso_pu_bacteria 2738541307 2738882418 398
170 iso_pu_bacteria 2738543019 2739280020 398
171 iso_pu_bacteria 2744054900 2746087123 398
172 iso_pu_bacteria 2744054901 2746096056 398
173 iso_pu_bacteria 2751185846 2753566856 398
174 iso_pu_bacteria 2791355137 2792838305 398
175 iso_pu_bacteria 2808606418 2809145725 398
176 iso_pu_bacteria 2818991446 2819602091 398
177 iso_pu_bacteria 2818991449 2819616784 398
178 iso_pu_bacteria 2831265667 2831269939 398
179 iso_pu_bacteria 2838054893 2838055050 398
180 iso_pu_bacteria 2838054893 2838061367 398
181 iso_pu_bacteria 2842677519 2842681117 398
182 iso_pu_bacteria 2883087390 2883089974 398
183 iso_pu_bacteria 2885198086 2885201959 398
184 iso_pu_bacteria 2885211737 2885215331 398
185 iso_pu_bacteria 2885270888 2885275555 398
186 iso_pu_bacteria 2899924645 2899927141 398
187 iso_pu_bacteria 2904439833 2904440262 398
188 iso_pu_bacteria 2904449895 2904454074 398
189 iso_pu_bacteria 2904456579 2904462069 398
190 iso_pu_bacteria 2904530477 2904530827 398
191 iso_pu_bacteria 2904541872 2904546010 398
192 iso_pu_bacteria 2904584206 2904585760 398
193 iso_pu_bacteria 2904589729 2904592427 398
194 iso_pu_bacteria 2904601388 2904601438 398
195 iso_pu_bacteria 2919079590 2919082911 398
196 iso_pu_bacteria 2919462493 2919465322 398
197 iso_pu_bacteria 2919462493 2919466998 398
198 iso_pu_bacteria 2923510766 2923515666 398
199 iso_pu_bacteria 2928037797 2928043989 398
200 iso_pu_bacteria 2928044640 2928048637 398
201 iso_pu_bacteria 2928051484 2928054961 398
202 iso_pu_bacteria 2928064002 2928068396 398
203 iso_pu_bacteria 2928070936 2928073711 398
204 iso_pu_bacteria 2928084124 2928090717 398
205 iso_pu_bacteria 2929160207 2929161212 398
206 iso_pu_bacteria 2929520902 2929521805 398
207 iso_pu_bacteria 2945909444 2945911825 398
208 iso_pu_bacteria 2945909444 2945914315 398
209 iso_pu_bacteria 2945945610 2945949871 398
210 iso_pu_bacteria 2945972063 2945973874 398
211 iso_pu_bacteria 2945984333 2945990290 398
212 iso_pu_bacteria 2954767861 2954770521 398
213 iso_pu_bacteria 644736347 644750371 398
214 iso_pu_bacteria 8003955200 8003956923 398
215 iso_pu_bacteria 8055301274 8055302597 398
216 3300003758 Ga0055532_1002124 Ga0055532_10021243 399
217 3300003760 Ga0055527_1001629 Ga0055527_10016294 399
218 3300003761 Ga0055535_1003412 Ga0055535_10034123 399
219 3300003761 Ga0055535_1003416 Ga0055535_10034163 399
220 3300003762 Ga0055542_1001092 Ga0055542_10010924 399
221 3300003763 Ga0055529_1000997 Ga0055529_10009973 399
222 3300003790 Ga0055528_1004786 Ga0055528_10047863 399
223 3300003856 Ga0058692_1001352 Ga0058692_10013523 399
224 3300005327 Ga0070658_10130798 Ga0070658_101307982 399
225 3300005339 Ga0070660_100000001 Ga0070660_100000001114 399
226 3300005366 Ga0070659_100000189 Ga0070659_10000018943 399
227 3300005455 Ga0070663_100004388 Ga0070663_1000043884 399
228 3300005564 Ga0070664_100030611 Ga0070664_1000306112 399
229 3300005614 Ga0068856_100395006 Ga0068856_1003950061 399
230 3300009092 Ga0105250_10035743 Ga0105250_100357431 399
231 3300009093 Ga0105240_10005282 Ga0105240_1000528212 399
232 3300009093 Ga0105240_10211351 Ga0105240_102113511 399
233 3300009551 Ga0105238_10016342 Ga0105238_100163423 399
234 3300010375 Ga0105239_10164483 Ga0105239_101644832 399
235 3300015262 Ga0182007_10016587 Ga0182007_100165872 399
236 3300025225 Ga0209566_101253 Ga0209566_1012533 399
237 3300025228 Ga0209672_100046 Ga0209672_1000468 399
238 3300025228 Ga0209672_100088 Ga0209672_10008811 399
239 3300025229 Ga0209147_100043 Ga0209147_100043256 399
240 3300025229 Ga0209147_100130 Ga0209147_10013011 399
241 3300025229 Ga0209147_100476 Ga0209147_10047611 399
242 3300025242 Ga0209258_100023 Ga0209258_100023455 399
243 3300025242 Ga0209258_100204 Ga0209258_10020411 399
244 3300025254 Ga0209148_1000029 Ga0209148_1000029522 399
245 3300025254 Ga0209148_1002080 Ga0209148_10020804 399
246 3300025256 Ga0209759_1013884 Ga0209759_10138843 399
247 3300025272 Ga0209455_1000064 Ga0209455_1000064251 399
248 3300025272 Ga0209455_1005283 Ga0209455_10052833 399
249 3300025273 Ga0209673_1000084 Ga0209673_100008497 399
250 3300025909 Ga0207705_10072048 Ga0207705_100720482 399
251 3300025913 Ga0207695_10001169 Ga0207695_1000116913 399
252 3300025913 Ga0207695_10045611 Ga0207695_100456113 399
253 3300025919 Ga0207657_10000022 Ga0207657_1000002279 399
254 3300025932 Ga0207690_10000010 Ga0207690_10000010232 399
255 3300026067 Ga0207678_10000013 Ga0207678_10000013113 399
256 3300026116 Ga0207674_10097955 Ga0207674_100979552 399
257 3300026142 Ga0207698_10122203 Ga0207698_101222032 399
258 3300027312 Ga0209371_1000526 Ga0209371_10005265 399
259 3300030500 Ga0268256_1001282 Ga0268256_10012828 399
260 3300039447 Ga0436361_0548351 Ga0436361_0548351_3299_4507 399
261 3300044684 Ga0466966_0049446 Ga0466966_0049446_86_1306 399
262 3300046457 Ga0495590_0000737 Ga0495590_0000737_4749_5957 399
263 3300046491 Ga0495584_0007822 Ga0495584_0007822_1134_2339 399
264 3300046491 Ga0495584_0044975 Ga0495584_0044975_495_1700 399
265 3300046492 Ga0495585_0001299 Ga0495585_0001299_6508_7713 399
266 3300046492 Ga0495585_0013098 Ga0495585_0013098_678_1883 399
267 3300046506 Ga0495583_0001225 Ga0495583_0001225_13038_14243 399
268 3300046513 Ga0495616_0000114 Ga0495616_0000114_12948_14153 399
269 3300046518 Ga0495631_0001853 Ga0495631_0001853_6450_7655 399
270 3300046522 Ga0495643_0000127 Ga0495643_0000127_66153_67358 399
271 3300046558 Ga0495633_0001124 Ga0495633_0001124_17764_18969 399
272 3300046616 Ga0495668_0013733 Ga0495668_0013733_1728_2933 399
273 3300046648 Ga0495611_0009019 Ga0495611_0009019_1333_2538 399
274 3300046665 Ga0495661_0000971 Ga0495661_0000971_4820_6025 399
275 3300046691 Ga0495670_0000127 Ga0495670_0000127_19170_20375 399
276 3300047320 Ga0495672_0084843 Ga0495672_0084843_272_1477 399
277 3300047321 Ga0495676_0021056 Ga0495676_0021056_3752_4957 399
278 3300047445 Ga0495677_0000684 Ga0495677_0000684_10271_11476 399
279 3300047470 Ga0495681_0000729 Ga0495681_0000729_19182_20387 399
280 iso_pu_bacteria 2902682994 2902688601 399
281 3300002067 JGI24735J21928_10011278 JGI24735J21928_100112782 400
282 3300002739 JGI25158J39367_1010721 JGI25158J39367_10107211 400
283 3300002773 JGI25152J39213_1011320 JGI25152J39213_10113201 400
284 3300003187 JGI25151J46595_10006142 JGI25151J46595_100061424 400
285 3300003322 rootL2_10056961 rootL2_100569613 400
286 3300003578 Ga0006562J51391_1042127 Ga0006562J51391_10421272 400
287 3300003751 Ga0055538_1000008 Ga0055538_1000008330 400
288 3300003752 Ga0055539_1000012 Ga0055539_1000012330 400
289 3300003756 Ga0055533_1000015 Ga0055533_1000015330 400
290 3300003759 Ga0055525_1000017 Ga0055525_100001713 400
291 3300003761 Ga0055535_1000108 Ga0055535_100010886 400
292 3300003762 Ga0055542_1000051 Ga0055542_10000514 400
293 3300003773 Ga0055537_1000792 Ga0055537_100079213 400
294 3300003784 Ga0055534_1000290 Ga0055534_100029016 400
295 3300003790 Ga0055528_1000928 Ga0055528_10009285 400
296 3300003791 Ga0055530_10025794 Ga0055530_100257942 400
297 3300003794 Ga0055531_10013040 Ga0055531_100130403 400
298 3300003841 Ga0055541_1000009 Ga0055541_1000009330 400
299 3300004625 Ga0055543_1001495 Ga0055543_10014954 400
300 3300005459 Ga0068867_100116154 Ga0068867_1001161542 400
301 3300005539 Ga0068853_100027855 Ga0068853_1000278554 400
302 3300005539 Ga0068853_100142351 Ga0068853_1001423512 400
303 3300005563 Ga0068855_100152728 Ga0068855_1001527282 400
304 3300005564 Ga0070664_100047629 Ga0070664_1000476293 400
305 3300005577 Ga0068857_100050592 Ga0068857_1000505922 400
306 3300005578 Ga0068854_100012898 Ga0068854_1000128981 400
307 3300005578 Ga0068854_100106897 Ga0068854_1001068972 400
308 3300005616 Ga0068852_100094955 Ga0068852_1000949553 400
309 3300005834 Ga0068851_10052761 Ga0068851_100527611 400
310 3300006038 Ga0075365_10010345 Ga0075365_100103454 400
311 3300006048 Ga0075363_100101022 Ga0075363_1001010222 400
312 3300006051 Ga0075364_10009672 Ga0075364_100096728 400
313 3300006051 Ga0075364_10015062 Ga0075364_100150624 400
314 3300006177 Ga0075362_10002848 Ga0075362_100028483 400
315 3300006353 Ga0075370_10002516 Ga0075370_100025165 400
316 3300006353 Ga0075370_10012527 Ga0075370_100125274 400
317 3300006948 Ga0099826_10000541 Ga0099826_1000054110 400
318 3300009036 Ga0105244_10004724 Ga0105244_100047243 400
319 3300009093 Ga0105240_10037846 Ga0105240_100378463 400
320 3300009098 Ga0105245_10206042 Ga0105245_102060422 400
321 3300009148 Ga0105243_10000838 Ga0105243_1000083820 400
322 3300009148 Ga0105243_10026518 Ga0105243_100265183 400
323 3300009545 Ga0105237_10023372 Ga0105237_100233725 400
324 3300009545 Ga0105237_10236642 Ga0105237_102366421 400
325 3300009551 Ga0105238_10000111 Ga0105238_1000011160 400
326 3300013102 Ga0157371_10000128 Ga0157371_1000012890 400
327 3300013102 Ga0157371_10059094 Ga0157371_100590942 400
328 3300013105 Ga0157369_10068093 Ga0157369_100680933 400
329 3300014497 Ga0182008_10012589 Ga0182008_100125893 400
330 3300015262 Ga0182007_10004704 Ga0182007_100047043 400
331 3300015262 Ga0182007_10026078 Ga0182007_100260783 400
332 3300015265 Ga0182005_1027395 Ga0182005_10273951 400
333 3300015683 Ga0183362_10002 Ga0183362_10002253 400
334 3300017792 Ga0163161_10001574 Ga0163161_100015744 400
335 3300017792 Ga0163161_10004673 Ga0163161_100046735 400
336 3300021361 Ga0213872_10002340 Ga0213872_100023407 400
337 3300025224 Ga0209784_100005 Ga0209784_100005327 400
338 3300025225 Ga0209566_100005 Ga0209566_100005327 400
339 3300025226 Ga0209674_100009 Ga0209674_100009327 400
340 3300025228 Ga0209672_102154 Ga0209672_1021544 400
341 3300025229 Ga0209147_100451 Ga0209147_10045116 400
342 3300025230 Ga0209563_100012 Ga0209563_100012327 400
343 3300025242 Ga0209258_100132 Ga0209258_1001325 400
344 3300025253 Ga0209677_100006 Ga0209677_100006327 400
345 3300025254 Ga0209148_1000007 Ga0209148_10000071342 400
346 3300025258 Ga0209129_1000084 Ga0209129_1000084123 400
347 3300025258 Ga0209129_1001931 Ga0209129_10019314 400
348 3300025263 Ga0209565_1000285 Ga0209565_100028524 400
349 3300025263 Ga0209565_1000526 Ga0209565_10005267 400
350 3300025263 Ga0209565_1000658 Ga0209565_100065814 400
351 3300025273 Ga0209673_1000114 Ga0209673_100011483 400
352 3300025273 Ga0209673_1001172 Ga0209673_100117224 400
353 3300025273 Ga0209673_1001325 Ga0209673_10013253 400
354 3300025273 Ga0209673_1007829 Ga0209673_10078293 400
355 3300025284 Ga0209130_1000323 Ga0209130_10003236 400
356 3300025284 Ga0209130_1001647 Ga0209130_10016477 400
357 3300025291 Ga0209675_1000062 Ga0209675_100006283 400
358 3300025291 Ga0209675_1001395 Ga0209675_100139511 400
359 3300025291 Ga0209675_1004044 Ga0209675_10040442 400
360 3300025291 Ga0209675_1006226 Ga0209675_10062263 400
361 3300025292 Ga0209676_1000112 Ga0209676_100011229 400
362 3300025292 Ga0209676_1001058 Ga0209676_100105827 400
363 3300025292 Ga0209676_1010622 Ga0209676_10106222 400
364 3300025294 Ga0209025_1001103 Ga0209025_100110335 400
365 3300025294 Ga0209025_1003528 Ga0209025_10035282 400
366 3300025294 Ga0209025_1007104 Ga0209025_10071044 400
367 3300025294 Ga0209025_1015410 Ga0209025_10154103 400
368 3300025294 Ga0209025_1021136 Ga0209025_10211362 400
369 3300025294 Ga0209025_1026558 Ga0209025_10265583 400
370 3300025295 Ga0209564_1000108 Ga0209564_1000108150 400
371 3300025295 Ga0209564_1000357 Ga0209564_100035722 400
372 3300025297 Ga0209758_1000184 Ga0209758_100018485 400
373 3300025298 Ga0209050_1000052 Ga0209050_1000052145 400
374 3300025298 Ga0209050_1000445 Ga0209050_100044529 400
375 3300025298 Ga0209050_1005240 Ga0209050_10052405 400
376 3300025299 Ga0209256_1000101 Ga0209256_10001018 400
377 3300025299 Ga0209256_1000156 Ga0209256_100015677 400
378 3300025302 Ga0207426_1000049 Ga0207426_100004961 400
379 3300025302 Ga0207426_1000086 Ga0207426_1000086138 400
380 3300025303 Ga0209051_1000220 Ga0209051_100022059 400
381 3300025303 Ga0209051_1000365 Ga0209051_100036529 400
382 3300025303 Ga0209051_1004720 Ga0209051_10047204 400
383 3300025304 Ga0209257_1000037 Ga0209257_1000037154 400
384 3300025304 Ga0209257_1000411 Ga0209257_100041147 400
385 3300025321 Ga0207656_10030912 Ga0207656_100309122 400
386 3300025728 Ga0207655_1002549 Ga0207655_10025499 400
387 3300025735 Ga0207713_1037917 Ga0207713_10379172 400
388 3300025913 Ga0207695_10000769 Ga0207695_1000076951 400
389 3300025913 Ga0207695_10092630 Ga0207695_100926303 400
390 3300025913 Ga0207695_10246160 Ga0207695_102461602 400
391 3300025924 Ga0207694_10000199 Ga0207694_1000019931 400
392 3300025935 Ga0207709_10000621 Ga0207709_1000062120 400
393 3300025935 Ga0207709_10006718 Ga0207709_100067184 400
394 3300025935 Ga0207709_10007395 Ga0207709_100073956 400
395 3300025949 Ga0207667_10009007 Ga0207667_1000900712 400
396 3300026089 Ga0207648_10094837 Ga0207648_100948372 400
397 3300026142 Ga0207698_10068776 Ga0207698_100687762 400
398 3300027666 Ga0209282_1000282 Ga0209282_100028216 400
399 3300028380 Ga0268265_10060906 Ga0268265_100609062 400
400 3300030733 Ga0314311_1006183 Ga0314311_10061832 400
401 3300030735 Ga0316178_1012286 Ga0316178_10122863 400
402 3300030744 Ga0316181_1113472 Ga0316181_11134723 400
403 3300030745 Ga0316182_1060776 Ga0316182_10607763 400
404 3300031649 Ga0307514_10011789 Ga0307514_100117894 400
405 3300031731 Ga0307405_10052165 Ga0307405_100521652 400
406 3300031731 Ga0307405_10112014 Ga0307405_101120142 400
407 3300031731 Ga0307405_10155461 Ga0307405_101554611 400
408 3300031852 Ga0307410_10081902 Ga0307410_100819022 400
409 3300031901 Ga0307406_10000778 Ga0307406_100007786 400
410 3300032004 Ga0307414_10060296 Ga0307414_100602963 400
411 3300032004 Ga0307414_10157563 Ga0307414_101575631 400
412 3300037312 Ga0395899_0033609 Ga0395899_0033609_1046_2284 400
413 3300037418 Ga0395900_0026536 Ga0395900_0026536_4069_5307 400
414 3300037471 Ga0395905_0045244 Ga0395905_0045244_350_1564 400
415 3300038443 Ga0395901_0000011 Ga0395901_0000011_161232_162452 400
416 3300039447 Ga0436361_0682271 Ga0436361_0682271_765_1973 400
417 3300042002 Ga0439442_003588 Ga0439442_003588_1104_2312 400
418 3300042531 Ga0450918_002858 Ga0450918_002858_1536_2744 400
419 3300045836 Ga0466958_0000289 Ga0466958_0000289_10828_12048 400
420 3300046455 Ga0495603_0002112 Ga0495603_0002112_3335_4543 400
421 3300046457 Ga0495590_0006032 Ga0495590_0006032_1154_2362 400
422 3300046458 Ga0495591_036637 Ga0495591_036637_21_1229 400
423 3300046459 Ga0495629_0000819 Ga0495629_0000819_20520_21728 400
424 3300046459 Ga0495629_0004676 Ga0495629_0004676_2304_3524 400
425 3300046459 Ga0495629_0156099 Ga0495629_0156099_305_1513 400
426 3300046463 Ga0495653_0000429 Ga0495653_0000429_10510_11718 400
427 3300046463 Ga0495653_0001077 Ga0495653_0001077_11686_12894 400
428 3300046463 Ga0495653_0002383 Ga0495653_0002383_7574_8782 400
429 3300046471 Ga0495650_0008974 Ga0495650_0008974_1317_2525 400
430 3300046472 Ga0495580_0000658 Ga0495580_0000658_18822_20030 400
431 3300046472 Ga0495580_0011928 Ga0495580_0011928_1590_2798 400
432 3300046472 Ga0495580_0019615 Ga0495580_0019615_2862_4070 400
433 3300046472 Ga0495580_0049940 Ga0495580_0049940_700_1908 400
434 3300046472 Ga0495580_0050571 Ga0495580_0050571_1463_2671 400
435 3300046472 Ga0495580_0103580 Ga0495580_0103580_350_1558 400
436 3300046474 Ga0495605_0012074 Ga0495605_0012074_3396_4604 400
437 3300046477 Ga0495664_0000315 Ga0495664_0000315_14242_15450 400
438 3300046477 Ga0495664_0122475 Ga0495664_0122475_54_1274 400
439 3300046500 Ga0495596_0011599 Ga0495596_0011599_817_2025 400
440 3300046506 Ga0495583_0003075 Ga0495583_0003075_4402_5610 400
441 3300046506 Ga0495583_0033651 Ga0495583_0033651_1225_2433 400
442 3300046507 Ga0495606_0001644 Ga0495606_0001644_16460_17668 400
443 3300046507 Ga0495606_0002545 Ga0495606_0002545_11016_12224 400
444 3300046507 Ga0495606_0039957 Ga0495606_0039957_952_2160 400
445 3300046507 Ga0495606_0055543 Ga0495606_0055543_998_2206 400
446 3300046507 Ga0495606_0064868 Ga0495606_0064868_970_2190 400
447 3300046516 Ga0495628_0002855 Ga0495628_0002855_259_1467 400
448 3300046516 Ga0495628_0056822 Ga0495628_0056822_668_1876 400
449 3300046517 Ga0495630_0001648 Ga0495630_0001648_3527_4735 400
450 3300046518 Ga0495631_0003405 Ga0495631_0003405_3090_4298 400
451 3300046524 Ga0495648_0003795 Ga0495648_0003795_4416_5624 400
452 3300046524 Ga0495648_0004920 Ga0495648_0004920_8374_9582 400
453 3300046524 Ga0495648_0010695 Ga0495648_0010695_5126_6334 400
454 3300046524 Ga0495648_0013584 Ga0495648_0013584_4314_5522 400
455 3300046526 Ga0495666_0013115 Ga0495666_0013115_2543_3751 400
456 3300046526 Ga0495666_0018073 Ga0495666_0018073_220_1428 400
457 3300046528 Ga0495642_0002942 Ga0495642_0002942_2999_4207 400
458 3300046529 Ga0495652_0027307 Ga0495652_0027307_1590_2798 400
459 3300046531 Ga0495665_0000097 Ga0495665_0000097_4338_5558 400
460 3300046531 Ga0495665_0000155 Ga0495665_0000155_7218_8426 400
461 3300046531 Ga0495665_0016754 Ga0495665_0016754_409_1617 400
462 3300046531 Ga0495665_0027610 Ga0495665_0027610_214_1422 400
463 3300046531 Ga0495665_0029158 Ga0495665_0029158_711_1919 400
464 3300046531 Ga0495665_0031260 Ga0495665_0031260_765_1973 400
465 3300046535 Ga0495586_0007802 Ga0495586_0007802_3009_4217 400
466 3300046535 Ga0495586_0011759 Ga0495586_0011759_1222_2430 400
467 3300046536 Ga0495587_0045964 Ga0495587_0045964_1356_2564 400
468 3300046543 Ga0495645_0006438 Ga0495645_0006438_3723_4931 400
469 3300046543 Ga0495645_0006965 Ga0495645_0006965_18_1226 400
470 3300046543 Ga0495645_0045845 Ga0495645_0045845_1845_3053 400
471 3300046559 Ga0495667_0014469 Ga0495667_0014469_2501_3709 400
472 3300046660 Ga0495625_0079410 Ga0495625_0079410_808_2016 400
473 3300046674 Ga0495588_0064561 Ga0495588_0064561_330_1538 400
474 3300046674 Ga0495588_0070489 Ga0495588_0070489_40_1248 400
475 3300046679 Ga0495623_0004421 Ga0495623_0004421_1547_2755 400
476 3300046680 Ga0495646_0000284 Ga0495646_0000284_11314_12522 400
477 3300046680 Ga0495646_0001781 Ga0495646_0001781_4076_5284 400
478 3300046680 Ga0495646_0017436 Ga0495646_0017436_1087_2295 400
479 3300046689 Ga0495613_0097918 Ga0495613_0097918_37_1245 400
480 3300046690 Ga0495624_0000486 Ga0495624_0000486_7688_8896 400
481 3300046690 Ga0495624_0000554 Ga0495624_0000554_18822_20030 400
482 3300046690 Ga0495624_0011431 Ga0495624_0011431_2518_3738 400
483 3300046690 Ga0495624_0012294 Ga0495624_0012294_3773_4981 400
484 3300046690 Ga0495624_0023331 Ga0495624_0023331_959_2167 400
485 3300046692 Ga0495671_0004162 Ga0495671_0004162_5201_6409 400
486 3300046692 Ga0495671_0030102 Ga0495671_0030102_1323_2531 400
487 3300046694 Ga0495649_0004419 Ga0495649_0004419_5470_6678 400
488 3300046694 Ga0495649_0004642 Ga0495649_0004642_415_1623 400
489 3300046694 Ga0495649_0025012 Ga0495649_0025012_437_1645 400
490 3300047315 Ga0495581_0015819 Ga0495581_0015819_348_1556 400
491 3300047317 Ga0495604_0014717 Ga0495604_0014717_1732_2940 400
492 3300047319 Ga0495674_0000647 Ga0495674_0000647_18820_20028 400
493 3300047319 Ga0495674_0001534 Ga0495674_0001534_5940_7154 400
494 3300047319 Ga0495674_0005453 Ga0495674_0005453_8944_10152 400
495 3300047319 Ga0495674_0014132 Ga0495674_0014132_1008_2216 400
496 3300047319 Ga0495674_0104487 Ga0495674_0104487_163_1371 400
497 3300047320 Ga0495672_0008707 Ga0495672_0008707_2034_3242 400
498 3300047321 Ga0495676_0048272 Ga0495676_0048272_1517_2725 400
499 3300047321 Ga0495676_0175065 Ga0495676_0175065_201_1409 400
500 3300047322 Ga0495680_0003266 Ga0495680_0003266_6586_7794 400
501 3300047322 Ga0495680_0008834 Ga0495680_0008834_415_1623 400
502 3300047323 Ga0495683_0000523 Ga0495683_0000523_11396_12604 400
503 3300047323 Ga0495683_0002605 Ga0495683_0002605_6335_7543 400
504 3300047323 Ga0495683_0085333 Ga0495683_0085333_209_1417 400
505 3300047443 Ga0495687_013335 Ga0495687_013335_1774_2982 400
506 3300047443 Ga0495687_016072 Ga0495687_016072_1252_2460 400
507 3300047446 Ga0495679_012476 Ga0495679_012476_1357_2565 400
508 3300047469 Ga0495673_0009825 Ga0495673_0009825_3305_4513 400
509 3300047469 Ga0495673_0022858 Ga0495673_0022858_84_1292 400
510 3300047471 Ga0495684_0011101 Ga0495684_0011101_4004_5212 400
511 3300047673 Ga0495593_0000207 Ga0495593_0000207_12033_13241 400
512 3300047673 Ga0495593_0000861 Ga0495593_0000861_8425_9633 400
513 3300047673 Ga0495593_0001333 Ga0495593_0001333_4739_5959 400
514 3300047673 Ga0495593_0001795 Ga0495593_0001795_7829_9037 400
515 3300047673 Ga0495593_0003929 Ga0495593_0003929_6287_7495 400
516 3300047673 Ga0495593_0012080 Ga0495593_0012080_3171_4454 400
517 3300048088 Ga0495602_0001137 Ga0495602_0001137_10534_11742 400
518 3300048088 Ga0495602_0006588 Ga0495602_0006588_5350_6570 400
519 3300048088 Ga0495602_0011607 Ga0495602_0011607_7497_8705 400
520 3300048903 Ga0496100_0014163 Ga0496100_0014163_2920_4128 400
521 3300048903 Ga0496100_0071617 Ga0496100_0071617_63_1271 400
522 3300048904 Ga0496101_0010002 Ga0496101_0010002_2721_3929 400
523 3300048904 Ga0496101_0014112 Ga0496101_0014112_3379_4599 400
524 3300048904 Ga0496101_0028785 Ga0496101_0028785_117_1325 400
525 3300048905 Ga0496102_0028256 Ga0496102_0028256_3132_4358 400
526 3300048905 Ga0496102_0175612 Ga0496102_0175612_372_1721 400
527 3300048907 Ga0496104_0296471 Ga0496104_0296471_53_1279 400
528 3300048908 Ga0496105_0011544 Ga0496105_0011544_88_1308 400
529 3300048908 Ga0496105_0034177 Ga0496105_0034177_1675_2883 400
530 3300048909 Ga0496106_0138929 Ga0496106_0138929_625_1833 400
531 3300048910 Ga0496107_0105256 Ga0496107_0105256_755_1963 400
532 3300048913 Ga0496110_0004135 Ga0496110_0004135_5335_6561 400
533 3300048914 Ga0496111_0074009 Ga0496111_0074009_44_1270 400
534 3300048915 Ga0496112_0002367 Ga0496112_0002367_11230_12438 400
535 3300048916 Ga0496113_0003751 Ga0496113_0003751_4737_5945 400
536 3300048916 Ga0496113_0019242 Ga0496113_0019242_1490_2716 400
537 3300048917 Ga0496114_0001072 Ga0496114_0001072_2452_3660 400
538 3300048920 Ga0496117_0018131 Ga0496117_0018131_1569_2855 400
539 3300048920 Ga0496117_0042213 Ga0496117_0042213_1940_3148 400
540 3300048920 Ga0496117_0049074 Ga0496117_0049074_1085_2293 400
541 3300048921 Ga0496118_0037018 Ga0496118_0037018_174_1382 400
542 3300048921 Ga0496118_0048254 Ga0496118_0048254_708_1916 400
543 3300048924 Ga0496121_0019785 Ga0496121_0019785_1860_3068 400
544 3300048924 Ga0496121_0139918 Ga0496121_0139918_552_1760 400
545 3300048925 Ga0496122_0045701 Ga0496122_0045701_1587_2813 400
546 3300048926 Ga0496123_0022217 Ga0496123_0022217_1837_3063 400
547 3300048927 Ga0496124_0035100 Ga0496124_0035100_1879_3105 400
548 3300048928 Ga0496125_0086465 Ga0496125_0086465_252_1460 400
549 3300048928 Ga0496125_0118214 Ga0496125_0118214_304_1530 400
550 3300050496 nmdc:mga07m45_54144_c1 nmdc:mga07m45_54144_c1_721_1929 400
551 3300053079 Ga0500610_0000551 Ga0500610_0000551_5398_6606 400
552 3300053079 Ga0500610_0003312 Ga0500610_0003312_3918_5126 400
553 3300053093 Ga0500651_0002027 Ga0500651_0002027_5077_6285 400
554 3300053121 Ga0500607_004085 Ga0500607_004085_5490_6698 400
555 3300053134 Ga0500658_0001187 Ga0500658_0001187_2560_3768 400
556 3300053134 Ga0500658_0003178 Ga0500658_0003178_2499_3707 400
557 3300053139 Ga0500568_0004258 Ga0500568_0004258_4741_5949 400
558 3300053161 Ga0500634_0033327 Ga0500634_0033327_980_2188 400
559 iso_pu_bacteria 2501025501 2501072431 400
560 iso_pu_bacteria 2501025504 2501413074 400
561 iso_pu_bacteria 2515154189 2516024820 400
562 iso_pu_bacteria 2867346516 2867346543 400
563 3300003775 Ga0055524_1005278 Ga0055524_10052783 401
564 3300004625 Ga0055543_1000879 Ga0055543_100087914 401
565 3300005262 Ga0065165_1007299 Ga0065165_10072992 401
566 3300025208 Ga0209436_101494 Ga0209436_1014944 401
567 3300025273 Ga0209673_1000857 Ga0209673_100085730 401
568 3300025284 Ga0209130_1000124 Ga0209130_1000124119 401
569 3300025284 Ga0209130_1000937 Ga0209130_10009372 401
570 3300025292 Ga0209676_1016526 Ga0209676_10165262 401
571 3300025294 Ga0209025_1028828 Ga0209025_10288282 401
572 3300025295 Ga0209564_1000320 Ga0209564_100032073 401
573 3300025299 Ga0209256_1000226 Ga0209256_100022614 401
574 3300025302 Ga0207426_1000219 Ga0207426_100021914 401
575 3300037418 Ga0395900_0002787 Ga0395900_0002787_17161_18366 401
576 3300038443 Ga0395901_0183458 Ga0395901_0183458_762_1967 401
577 3300050492 nmdc:mga0yw44_4295_c1 nmdc:mga0yw44_4295_c1_2957_4183 401
578 iso_pu_bacteria 2501025502 2501083879 404
579 iso_pu_bacteria 2510917013 2511087296 404
580 3300021361 Ga0213872_10010050 Ga0213872_100100503 405
581 3300031548 Ga0307408_100000067 Ga0307408_10000006782 405
582 3300039447 Ga0436361_0271890 Ga0436361_0271890_1826_3073 405
583 3300002067 JGI24735J21928_10000280 JGI24735J21928_1000028015 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

57

425

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9393 6 383
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9369 6 377
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9354 6 380
5yiy-assembly1.cif.gz_B crystal structure of d175a mutant of rv3272 from mycobacterium tuberculosis 0.9351 5 377
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9335 6 378
ID Description Score Start End Superfamily
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9728 6 286 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9704 28 239 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.964 231 318 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9626 6 286 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9604 229 321 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A2W7HCP5-F1-model_v4 deleted 0.9891 28 400
AF-F0G2Y9-F1-model_v4 L-carnitine dehydratase/bile aciD-inducible protein f 0.9846 1 241 GO:0008410
AF-A0A2W7HCP5-F1-model_v4 deleted 0.9838 28 400
AF-A0A379P538-F1-model_v4 deleted 0.981 6 337
AF-A0A7W0PUI8-F1-model_v4 CoA transferase 0.9797 6 199 GO:0008410

Feature Viewer

pLDDT pTM Quality
95.43 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map