F466249

General Info

Members Datasets Scaffolds Average Seq Length
583 307 1166 232

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100411131|Ga0070705_1004111312
Length 268
Sequence VLIKTRPLGITFEKWLGARLRCVASNSKTDETGEMLEDPLFWLLVLPGLLLGAYAQWQIKANVAKYSQLGTKDGITGAEVARKLLDSGGLQAVSVEATPGMLTDHYDPRSKILRLSQDVYFTPSVAAAGIAAHEAGHALQDAEDYLPMEARSYIVPVVQLASRIAPWLFVAGLMLQLSYLTWAGVILFGSSSLFAFLTLPVEFNASSRARKLLVSQGIIRGDEQIAGVEKVLGAAAWTYVAAAVAALGSWLFYVVLLISQTRSTSDRS

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
300 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
301 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
302 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
303 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
304 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
305 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
306 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
307 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 2.74
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 6.86
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 21.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100411131 3300005440 Bacteria 1004
2 JGI24739J22299_10050348 3300001989 Eukaryota 1347
3 JGI24738J21930_10015527 3300002075 Bacteria 1618
4 JGI25151J46595_10000200 3300003187 Bacteria 73683
5 rootH2_10032256 3300003320 Bacteria 5314
6 Ga0070658_10003114 3300005327 Bacteria 13686
7 Ga0070658_10087879 3300005327 Unclassified 2559
8 Ga0070683_100133048 3300005329 Bacteria 2354
9 Ga0070690_100000506 3300005330 Bacteria 19537
10 Ga0070670_100001094 3300005331 Bacteria 21528
11 Ga0068869_100291494 3300005334 Bacteria 1315
12 Ga0070666_10037175 3300005335 Bacteria 3236
13 Ga0070666_10051409 3300005335 Unclassified 2775
14 Ga0070680_100011526 3300005336 Bacteria 6840
15 Ga0070682_100004278 3300005337 Bacteria 7922
16 Ga0068868_100318871 3300005338 Bacteria 1324
17 Ga0070660_100008865 3300005339 Bacteria 7052
18 Ga0070689_100003864 3300005340 Bacteria 10041
19 Ga0070689_100430368 3300005340 Unclassified 1120
20 Ga0070691_10041683 3300005341 Unclassified 2171
21 Ga0070687_100010422 3300005343 Bacteria 4019
22 Ga0070687_100023854 3300005343 Bacteria 2912
23 Ga0070687_100033753 3300005343 Unclassified 2528
24 Ga0070661_100011974 3300005344 Bacteria 6059
25 Ga0070661_100429866 3300005344 Bacteria 1048
26 Ga0070668_100000692 3300005347 Bacteria 22968
27 Ga0070668_100052078 3300005347 Bacteria 3155
28 Ga0070668_100465913 3300005347 Unclassified 1089
29 Ga0070669_100000807 3300005353 Bacteria 22765
30 Ga0070671_100001121 3300005355 Bacteria 19883
31 Ga0070674_100011705 3300005356 Bacteria 5349
32 Ga0070674_100610040 3300005356 Bacteria 923
33 Ga0070674_100687579 3300005356 Unclassified 873
34 Ga0070673_100007414 3300005364 Bacteria 7230
35 Ga0070673_100483425 3300005364 Unclassified 1118
36 Ga0070688_100007125 3300005365 Bacteria 6018
37 Ga0070688_100232650 3300005365 Bacteria 1304
38 Ga0070659_100004099 3300005366 Bacteria 10385
39 Ga0070659_100606170 3300005366 Unclassified 941
40 Ga0070667_100011686 3300005367 Bacteria 7257
41 Ga0070667_100243526 3300005367 Unclassified 1606
42 Ga0070709_10000065 3300005434 Bacteria 82088
43 Ga0070709_10290886 3300005434 Bacteria 1190
44 Ga0070714_100018881 3300005435 Bacteria 5610
45 Ga0070714_100033329 3300005435 Bacteria 4305
46 Ga0070714_100088313 3300005435 Bacteria 2712
47 Ga0070714_100128556 3300005435 Bacteria 2262
48 Ga0070714_100513508 3300005435 Unclassified 1144
49 Ga0070713_100013217 3300005436 Bacteria 6086
50 Ga0070713_100173858 3300005436 Bacteria 1931
51 Ga0070710_10056231 3300005437 Bacteria 2226
52 Ga0070710_10176178 3300005437 Bacteria 1336
53 Ga0070701_10001644 3300005438 Bacteria 8357
54 Ga0070701_10036734 3300005438 Bacteria 2470
55 Ga0070701_10104249 3300005438 Unclassified 1575
56 Ga0070711_100011022 3300005439 Bacteria 5607
57 Ga0070711_100231628 3300005439 Unclassified 1440
58 Ga0070711_100405302 3300005439 Unclassified 1108
59 Ga0070711_100548653 3300005439 Bacteria 959
60 Ga0070705_100014276 3300005440 Bacteria 4082
61 Ga0070700_100002580 3300005441 Bacteria 9260
62 Ga0070700_100070695 3300005441 Bacteria 2226
63 Ga0070700_100211761 3300005441 Unclassified 1368
64 Ga0070694_100000874 3300005444 Bacteria 16965
65 Ga0070694_100042216 3300005444 Unclassified 3046
66 Ga0070694_100087863 3300005444 Bacteria 2175
67 Ga0070694_100156176 3300005444 Bacteria 1670
68 Ga0070694_100319676 3300005444 Bacteria 1194
69 Ga0070708_100184056 3300005445 Bacteria 1953
70 Ga0070708_100303092 3300005445 Bacteria 1504
71 Ga0070663_100001067 3300005455 Bacteria 15014
72 Ga0070678_100004274 3300005456 Bacteria 8074
73 Ga0070678_100267338 3300005456 Bacteria 1441
74 Ga0070662_100018135 3300005457 Bacteria 4757
75 Ga0070706_100051070 3300005467 Bacteria 3815
76 Ga0070706_100072592 3300005467 Bacteria 3185
77 Ga0070707_100022899 3300005468 Bacteria 5906
78 Ga0070698_100032679 3300005471 Bacteria 5388
79 Ga0070698_100163218 3300005471 Bacteria 2171
80 Ga0070698_100181765 3300005471 Unclassified 2041
81 Ga0070698_100425621 3300005471 Bacteria 1262
82 Ga0070698_100726378 3300005471 Bacteria 936
83 Ga0070698_100821921 3300005471 Unclassified 874
84 Ga0070699_100016143 3300005518 Bacteria 6410
85 Ga0070699_100068986 3300005518 Bacteria 3072
86 Ga0070699_100154022 3300005518 Unclassified 2034
87 Ga0070699_100155826 3300005518 Unclassified 2021
88 Ga0070679_100022615 3300005530 Bacteria 6146
89 Ga0070684_100037003 3300005535 Bacteria 4185
90 Ga0070697_100031204 3300005536 Bacteria 4285
91 Ga0070697_100087512 3300005536 Unclassified 2572
92 Ga0070697_100168543 3300005536 Bacteria 1852
93 Ga0070697_100397290 3300005536 Unclassified 1196
94 Ga0068853_100012685 3300005539 Bacteria 6861
95 Ga0068853_100521504 3300005539 Bacteria 1123
96 Ga0070672_100015764 3300005543 Bacteria 5396
97 Ga0070686_100001572 3300005544 Bacteria 12819
98 Ga0070686_100002911 3300005544 Bacteria 9394
99 Ga0070686_100030780 3300005544 Unclassified 3276
100 Ga0070695_100002038 3300005545 Bacteria 11541
101 Ga0070695_100025167 3300005545 Bacteria 3673
102 Ga0070695_100284304 3300005545 Bacteria 1217
103 Ga0070696_100231659 3300005546 Bacteria 1390
104 Ga0070693_100000326 3300005547 Bacteria 21830
105 Ga0070665_100000055 3300005548 Bacteria 242706
106 Ga0070665_100197866 3300005548 Bacteria 2010
107 Ga0070665_100350802 3300005548 Unclassified 1481
108 Ga0070665_100707342 3300005548 Bacteria 1021
109 Ga0070704_100027924 3300005549 Unclassified 3748
110 Ga0070704_100035822 3300005549 Bacteria 3376
111 Ga0070704_100051871 3300005549 Bacteria 2891
112 Ga0070704_100834230 3300005549 Bacteria 825
113 Ga0068855_100236135 3300005563 Bacteria 2045
114 Ga0070664_100007192 3300005564 Bacteria 8975
115 Ga0068857_100021460 3300005577 Bacteria 5684
116 Ga0068854_100023312 3300005578 Bacteria 4226
117 Ga0068854_100174667 3300005578 Unclassified 1674
118 Ga0068856_100002298 3300005614 Bacteria 19709
119 Ga0070702_100000139 3300005615 Bacteria 22443
120 Ga0070702_100087232 3300005615 Bacteria 1884
121 Ga0068852_100014126 3300005616 Bacteria 6133
122 Ga0068859_100361553 3300005617 Bacteria 1547
123 Ga0068864_100051849 3300005618 Bacteria 3535
124 Ga0068866_10197811 3300005718 Unclassified 1199
125 Ga0068861_100014073 3300005719 Bacteria 5611
126 Ga0068861_100338176 3300005719 Bacteria 1317
127 Ga0068861_101053456 3300005719 Unclassified 779
128 Ga0068863_100000314 3300005841 Bacteria 49103
129 Ga0068863_100000834 3300005841 Bacteria 30888
130 Ga0068858_100007131 3300005842 Bacteria 10857
131 Ga0068858_100069925 3300005842 Unclassified 3254
132 Ga0068858_100194334 3300005842 Bacteria 1917
133 Ga0068858_100286528 3300005842 Bacteria 1569
134 Ga0068860_100004777 3300005843 Bacteria 13804
135 Ga0068860_100256000 3300005843 Bacteria 1705
136 Ga0068862_100025211 3300005844 Bacteria 4992
137 Ga0068862_100042059 3300005844 Bacteria 3891
138 Ga0068862_100132727 3300005844 Bacteria 2204
139 Ga0081455_10000230 3300005937 Bacteria 72112
140 Ga0081455_10009500 3300005937 Bacteria 9994
141 Ga0081455_10015642 3300005937 Bacteria 7359
142 Ga0081455_10025614 3300005937 Bacteria 5440
143 Ga0081455_10270781 3300005937 Unclassified 1232
144 Ga0081538_10109781 3300005981 Bacteria 1358
145 Ga0081540_1000032 3300005983 Bacteria 144522
146 Ga0070717_10016731 3300006028 Bacteria 5691
147 Ga0070717_10908255 3300006028 Unclassified 802
148 Ga0075363_100348834 3300006048 Bacteria 864
149 Ga0070715_10002712 3300006163 Bacteria 5492
150 Ga0070715_10163523 3300006163 Bacteria 1102
151 Ga0070716_100222085 3300006173 Bacteria 1270
152 Ga0070712_100024461 3300006175 Bacteria 4003
153 Ga0070712_100109636 3300006175 Unclassified 2058
154 Ga0070712_100440019 3300006175 Bacteria 1084
155 Ga0075362_10000382 3300006177 Bacteria 12685
156 Ga0075366_10032523 3300006195 Bacteria 3070
157 Ga0097621_100339552 3300006237 Unclassified 1334
158 Ga0097621_100397841 3300006237 Bacteria 1233
159 Ga0075370_10010415 3300006353 Bacteria 4863
160 Ga0068871_100068608 3300006358 Bacteria 2912
161 Ga0068871_100110780 3300006358 Unclassified 2309
162 Ga0075428_100143059 3300006844 Bacteria 2600
163 Ga0075428_100829086 3300006844 Bacteria 982
164 Ga0075430_100075642 3300006846 Bacteria 2823
165 Ga0075430_100385686 3300006846 Unclassified 1156
166 Ga0075431_100035827 3300006847 Bacteria 5109
167 Ga0075431_100881012 3300006847 Unclassified 865
168 Ga0075433_10083554 3300006852 Bacteria 2818
169 Ga0075433_10194433 3300006852 Unclassified 1804
170 Ga0075433_10334441 3300006852 Bacteria 1339
171 Ga0075434_100007422 3300006871 Bacteria 10149
172 Ga0075434_100011276 3300006871 Bacteria 8418
173 Ga0075434_100051367 3300006871 Bacteria 4098
174 Ga0075429_100068369 3300006880 Bacteria 3091
175 Ga0075429_100224087 3300006880 Bacteria 1647
176 Ga0068865_100006104 3300006881 Bacteria 7348
177 Ga0068865_100642296 3300006881 Bacteria 901
178 Ga0075436_100081084 3300006914 Unclassified 2249
179 Ga0097620_100361543 3300006931 Bacteria 1547
180 Ga0075435_100204468 3300007076 Unclassified 1674
181 Ga0075435_100204545 3300007076 Bacteria 1673
182 Ga0105251_10029502 3300009011 Bacteria 2763
183 Ga0105250_10006956 3300009092 Bacteria 4894
184 Ga0105250_10108382 3300009092 Bacteria 1136
185 Ga0105240_10011000 3300009093 Bacteria 12670
186 Ga0105240_10106182 3300009093 Bacteria 3407
187 Ga0111539_10191805 3300009094 Bacteria 2384
188 Ga0111539_10223907 3300009094 Bacteria 2191
189 Ga0105245_10052229 3300009098 Bacteria 3666
190 Ga0105247_10013969 3300009101 Bacteria 4815
191 Ga0105247_10029246 3300009101 Unclassified 3338
192 Ga0105247_10032694 3300009101 Bacteria 3161
193 Ga0114129_10157303 3300009147 Bacteria 3107
194 Ga0105243_10001724 3300009148 Bacteria 18831
195 Ga0105243_10275819 3300009148 Bacteria 1512
196 Ga0105243_10806841 3300009148 Unclassified 925
197 Ga0105241_10002591 3300009174 Bacteria 13559
198 Ga0105241_10498406 3300009174 Unclassified 1085
199 Ga0105242_10053929 3300009176 Bacteria 3285
200 Ga0105242_10162470 3300009176 Bacteria 1956
201 Ga0105242_10247525 3300009176 Bacteria 1605
202 Ga0105248_10010227 3300009177 Bacteria 10329
203 Ga0105248_10138182 3300009177 Bacteria 2749
204 Ga0105248_10314997 3300009177 Bacteria 1762
205 Ga0105237_10011798 3300009545 Bacteria 9244
206 Ga0105237_10042401 3300009545 Bacteria 4588
207 Ga0105237_10057413 3300009545 Bacteria 3896
208 Ga0105237_10241402 3300009545 Bacteria 1808
209 Ga0105237_10601673 3300009545 Bacteria 1106
210 Ga0105238_10026230 3300009551 Bacteria 5939
211 Ga0105238_10272277 3300009551 Bacteria 1674
212 Ga0105238_10450953 3300009551 Bacteria 1283
213 Ga0105249_10003900 3300009553 Bacteria 12892
214 Ga0105249_10146452 3300009553 Unclassified 2270
215 Ga0105249_10323236 3300009553 Unclassified 1554
216 Ga0105249_10540070 3300009553 Bacteria 1215
217 Ga0105249_10637098 3300009553 Unclassified 1123
218 Ga0105249_10823616 3300009553 Bacteria 993
219 Ga0099796_10049319 3300010159 Unclassified 1455
220 Ga0105239_10020054 3300010375 Bacteria 7377
221 Ga0105239_10245158 3300010375 Bacteria 2011
222 Ga0105239_10482486 3300010375 Unclassified 1408
223 Ga0105239_10573068 3300010375 Bacteria 1286
224 Ga0105239_10582712 3300010375 Bacteria 1275
225 Ga0105246_10006465 3300011119 Bacteria 7158
226 Ga0157373_10022665 3300013100 Bacteria 4555
227 Ga0157371_10210523 3300013102 Unclassified 1395
228 Ga0157369_10071486 3300013105 Bacteria 3724
229 Ga0157374_10006364 3300013296 Bacteria 10018
230 Ga0157374_10752230 3300013296 Unclassified 989
231 Ga0157378_10034592 3300013297 Bacteria 4468
232 Ga0157378_10355641 3300013297 Bacteria 1432
233 Ga0163162_10027678 3300013306 Bacteria 5607
234 Ga0163162_10243637 3300013306 Bacteria 1929
235 Ga0157372_10287168 3300013307 Unclassified 1913
236 Ga0157372_10536763 3300013307 Unclassified 1363
237 Ga0157375_10023089 3300013308 Bacteria 5734
238 Ga0157375_10044486 3300013308 Bacteria 4314
239 Ga0157375_10948115 3300013308 Unclassified 1002
240 Ga0163163_10106676 3300014325 Bacteria 2827
241 Ga0157380_10008465 3300014326 Bacteria 7348
242 Ga0157379_10008137 3300014968 Bacteria 9108
243 Ga0157379_10120356 3300014968 Bacteria 2361
244 Ga0157376_10022202 3300014969 Bacteria 4942
245 Ga0157376_10193994 3300014969 Bacteria 1864
246 Ga0163161_10003892 3300017792 Bacteria 10468
247 Ga0163161_10183786 3300017792 Bacteria 1604
248 Ga0163161_10298379 3300017792 Unclassified 1268
249 Ga0197907_10346792 3300020069 Bacteria 763
250 Ga0197907_11134939 3300020069 Bacteria 759
251 Ga0206356_10700244 3300020070 Unclassified 860
252 Ga0206349_1143624 3300020075 Unclassified 795
253 Ga0206355_1020091 3300020076 Bacteria 759
254 Ga0206351_10008625 3300020077 Unclassified 787
255 Ga0206350_10296713 3300020080 Unclassified 840
256 Ga0206350_11151494 3300020080 Unclassified 757
257 Ga0206350_11457212 3300020080 Bacteria 797
258 Ga0206354_11278583 3300020081 Unclassified 757
259 Ga0206353_10935834 3300020082 Unclassified 803
260 Ga0206353_11428601 3300020082 Bacteria 1496
261 Ga0224712_10262241 3300022467 Bacteria 801
262 Ga0209025_1000127 3300025294 Bacteria 200766
263 Ga0207697_10052315 3300025315 Bacteria 1689
264 Ga0207692_10385572 3300025898 Bacteria 871
265 Ga0207710_10092347 3300025900 Bacteria 1418
266 Ga0207688_10003966 3300025901 Bacteria 8068
267 Ga0207680_10015137 3300025903 Bacteria 4018
268 Ga0207680_10082452 3300025903 Bacteria 2024
269 Ga0207647_10307807 3300025904 Unclassified 901
270 Ga0207699_10014941 3300025906 Bacteria 4020
271 Ga0207699_10095398 3300025906 Bacteria 1875
272 Ga0207699_10358723 3300025906 Unclassified 1030
273 Ga0207643_10290299 3300025908 Unclassified 1016
274 Ga0207705_10001619 3300025909 Bacteria 17873
275 Ga0207705_10290723 3300025909 Bacteria 1252
276 Ga0207684_10017126 3300025910 Bacteria 6220
277 Ga0207684_10327698 3300025910 Bacteria 1319
278 Ga0207684_10506806 3300025910 Bacteria 1034
279 Ga0207654_10088110 3300025911 Unclassified 1885
280 Ga0207654_10246647 3300025911 Unclassified 1195
281 Ga0207695_10027516 3300025913 Bacteria 6330
282 Ga0207695_10754839 3300025913 Bacteria 853
283 Ga0207671_10003083 3300025914 Bacteria 17008
284 Ga0207671_10007738 3300025914 Bacteria 9256
285 Ga0207671_10022940 3300025914 Bacteria 4713
286 Ga0207693_10031417 3300025915 Bacteria 4195
287 Ga0207693_10096426 3300025915 Unclassified 2319
288 Ga0207663_10018228 3300025916 Bacteria 3929
289 Ga0207663_10230954 3300025916 Unclassified 1352
290 Ga0207663_10250279 3300025916 Bacteria 1304
291 Ga0207660_10010553 3300025917 Bacteria 5999
292 Ga0207662_10003738 3300025918 Bacteria 7891
293 Ga0207662_10410083 3300025918 Bacteria 920
294 Ga0207657_10031637 3300025919 Bacteria 4789
295 Ga0207649_10019900 3300025920 Bacteria 3843
296 Ga0207681_10031730 3300025923 Bacteria 3452
297 Ga0207694_10035966 3300025924 Bacteria 3799
298 Ga0207687_10014302 3300025927 Bacteria 5192
299 Ga0207700_10193287 3300025928 Bacteria 1711
300 Ga0207700_10324972 3300025928 Bacteria 1334
301 Ga0207700_10345534 3300025928 Unclassified 1294
302 Ga0207664_10103143 3300025929 Bacteria 2360
303 Ga0207664_10178593 3300025929 Bacteria 1821
304 Ga0207664_10180685 3300025929 Bacteria 1811
305 Ga0207664_10334320 3300025929 Bacteria 1338
306 Ga0207644_10089635 3300025931 Unclassified 2289
307 Ga0207690_10007550 3300025932 Bacteria 6454
308 Ga0207706_10000234 3300025933 Bacteria 60759
309 Ga0207686_10095592 3300025934 Bacteria 1972
310 Ga0207686_10332852 3300025934 Bacteria 1138
311 Ga0207670_10009819 3300025936 Bacteria 5481
312 Ga0207670_10397724 3300025936 Bacteria 1101
313 Ga0207669_10034390 3300025937 Bacteria 2871
314 Ga0207669_10214405 3300025937 Bacteria 1408
315 Ga0207704_10156227 3300025938 Bacteria 1617
316 Ga0207704_10240017 3300025938 Bacteria 1353
317 Ga0207665_10007555 3300025939 Bacteria 7182
318 Ga0207665_10077584 3300025939 Bacteria 2281
319 Ga0207665_10199410 3300025939 Bacteria 1457
320 Ga0207691_10029739 3300025940 Bacteria 5109
321 Ga0207711_10028651 3300025941 Bacteria 4689
322 Ga0207711_10202587 3300025941 Bacteria 1811
323 Ga0207689_10128768 3300025942 Bacteria 2083
324 Ga0207661_10014503 3300025944 Bacteria 5779
325 Ga0207661_10586158 3300025944 Unclassified 1023
326 Ga0207679_10018844 3300025945 Bacteria 4630
327 Ga0207651_10004644 3300025960 Bacteria 6961
328 Ga0207651_10216608 3300025960 Bacteria 1545
329 Ga0207712_10024182 3300025961 Bacteria 4020
330 Ga0207712_10113590 3300025961 Unclassified 2036
331 Ga0207712_10341815 3300025961 Bacteria 1241
332 Ga0207712_10426939 3300025961 Bacteria 1119
333 Ga0207668_10140257 3300025972 Bacteria 1858
334 Ga0207668_10295291 3300025972 Bacteria 1335
335 Ga0207640_10014575 3300025981 Bacteria 4530
336 Ga0207658_10007405 3300025986 Bacteria 7487
337 Ga0207677_10016462 3300026023 Bacteria 4382
338 Ga0207703_10004902 3300026035 Bacteria 10878
339 Ga0207703_10150539 3300026035 Unclassified 2029
340 Ga0207703_10224301 3300026035 Bacteria 1682
341 Ga0207703_10598956 3300026035 Bacteria 1042
342 Ga0207703_10784224 3300026035 Unclassified 909
343 Ga0207639_10781690 3300026041 Bacteria 889
344 Ga0207678_10000048 3300026067 Bacteria 90920
345 Ga0207678_10132466 3300026067 Bacteria 2127
346 Ga0207708_10012199 3300026075 Bacteria 6409
347 Ga0207708_10057151 3300026075 Bacteria 2977
348 Ga0207708_10096298 3300026075 Bacteria 2287
349 Ga0207708_10124345 3300026075 Unclassified 2012
350 Ga0207708_10193591 3300026075 Bacteria 1620
351 Ga0207708_10496069 3300026075 Bacteria 1023
352 Ga0207702_10588305 3300026078 Bacteria 1091
353 Ga0207641_10003726 3300026088 Bacteria 13406
354 Ga0207648_10227582 3300026089 Bacteria 1658
355 Ga0207676_10119519 3300026095 Unclassified 2219
356 Ga0207674_10020370 3300026116 Bacteria 7165
357 Ga0207675_100000155 3300026118 Bacteria 60380
358 Ga0207683_10002638 3300026121 Bacteria 15672
359 Ga0207683_10296892 3300026121 Bacteria 1478
360 Ga0207698_10016129 3300026142 Bacteria 5026
361 Ga0209998_10011429 3300027717 Unclassified 1838
362 Ga0209974_10103456 3300027876 Unclassified 997
363 Ga0207428_10051510 3300027907 Unclassified 3291
364 Ga0268266_10000027 3300028379 Bacteria 426852
365 Ga0268266_10252413 3300028379 Unclassified 1632
366 Ga0268265_10001852 3300028380 Bacteria 16855
367 Ga0268265_10541577 3300028380 Unclassified 1104
368 Ga0268264_10158315 3300028381 Bacteria 2037
369 Ga0268264_10502018 3300028381 Unclassified 1183
370 Ga0307511_10000583 3300030521 Bacteria 39039
371 Ga0307511_10003648 3300030521 Bacteria 15756
372 Ga0265339_10215481 3300031249 Bacteria 941
373 Ga0265314_10018868 3300031711 Bacteria 5357
374 Ga0265314_10094926 3300031711 Unclassified 1932
375 Ga0316576_10013425 3300031727 Bacteria 5446
376 Ga0316576_10216163 3300031727 Bacteria 1442
377 Ga0316578_10140645 3300031728 Bacteria 1454
378 Ga0316578_10225992 3300031728 Unclassified 1125
379 Ga0316578_10471052 3300031728 Bacteria 741
380 Ga0316593_10089347 3300032168 Unclassified 1084
381 Ga0316592_1016228 3300033524 Unclassified 1556
382 Ga0316587_1031836 3300033529 Bacteria 933
383 Ga0373948_0000625 3300034817 Bacteria 4560
384 Ga0373938_0034760 3300034957 Bacteria 1096
385 Ga0373932_0120530 3300035112 Bacteria 874
386 Ga0373939_0070162 3300035114 Bacteria 1139
387 Ga0373962_0036493 3300035242 Bacteria 1369
388 Ga0316574_0051928 3300035398 Bacteria 2556
389 Ga0316574_0166029 3300035398 Bacteria 1422
390 Ga0373927_0208730 3300035695 Bacteria 1283
391 Ga0373937_0077389 3300036401 Unclassified 3074
392 Ga0316584_0030719 3300036712 Bacteria 3969
393 Ga0316584_0034154 3300036712 Unclassified 3770
394 Ga0316584_0052112 3300036712 Bacteria 3061
395 Ga0316584_0521802 3300036712 Unclassified 832
396 Ga0395899_0048022 3300037312 Unclassified 3177
397 Ga0395900_0012412 3300037418 Bacteria 8712
398 Ga0395898_0044906 3300037466 Bacteria 4345
399 Ga0395898_0892447 3300037466 Bacteria 827
400 Ga0395905_0071904 3300037471 Unclassified 3242
401 Ga0395905_0167767 3300037471 Bacteria 2063
402 Ga0395901_0017671 3300038443 Bacteria 7280
403 Ga0400484_36170 3300038725 Bacteria 2272
404 Ga0439460_0088926 3300042461 Unclassified 979
405 Ga0451577_0003825 3300042876 Bacteria 16385
406 Ga0451577_0013107 3300042876 Bacteria 7771
407 Ga0451577_0111039 3300042876 Bacteria 2453
408 Ga0453684_0000505 3300044712 Bacteria 152407
409 Ga0453684_0002638 3300044712 Bacteria 42867
410 Ga0453684_0006031 3300044712 Bacteria 23448
411 Ga0453684_0041285 3300044712 Bacteria 6245
412 Ga0453684_0324328 3300044712 Bacteria 1743
413 Ga0453684_0974216 3300044712 Unclassified 903
414 Ga0451576_0001425 3300045051 Bacteria 40873
415 Ga0451576_0025177 3300045051 Bacteria 6415
416 Ga0451576_1162592 3300045051 Unclassified 806
417 Ga0495629_0017804 3300046459 Bacteria 5092
418 Ga0495580_0273940 3300046472 Unclassified 1152
419 Ga0495582_0081397 3300046473 Unclassified 1798
420 Ga0495639_0180490 3300046475 Unclassified 1028
421 Ga0495584_0024133 3300046491 Unclassified 3083
422 Ga0495584_0168244 3300046491 Unclassified 1114
423 Ga0495585_0240187 3300046492 Unclassified 907
424 Ga0495594_0000366 3300046499 Bacteria 22685
425 Ga0495663_0178456 3300046525 Unclassified 735
426 Ga0495652_0166550 3300046529 Unclassified 1705
427 Ga0495640_0064728 3300046533 Bacteria 2471
428 Ga0495587_0077885 3300046536 Unclassified 1924
429 Ga0495634_0065777 3300046642 Bacteria 2402
430 Ga0495635_0048566 3300046663 Bacteria 2926
431 Ga0495659_0176297 3300046664 Unclassified 869
432 Ga0495659_0189045 3300046664 Unclassified 841
433 Ga0495669_0256613 3300046684 Bacteria 840
434 Ga0495613_0153809 3300046689 Bacteria 1639
435 Ga0495613_0255135 3300046689 Unclassified 1223
436 Ga0495581_0287603 3300047315 Unclassified 961
437 Ga0496100_0003222 3300048903 Bacteria 8472
438 Ga0496100_0190545 3300048903 Bacteria 1488
439 Ga0496100_0296772 3300048903 Bacteria 1209
440 Ga0496101_0008929 3300048904 Bacteria 6568
441 Ga0496101_0066134 3300048904 Bacteria 2636
442 Ga0496101_0336914 3300048904 Bacteria 1184
443 Ga0496101_0598064 3300048904 Unclassified 872
444 Ga0496102_0009056 3300048905 Bacteria 8541
445 Ga0496102_0081910 3300048905 Bacteria 2976
446 Ga0496103_0004221 3300048906 Bacteria 8723
447 Ga0496103_0134039 3300048906 Bacteria 1583
448 Ga0496104_0039971 3300048907 Bacteria 4394
449 Ga0496104_0101746 3300048907 Bacteria 2751
450 Ga0496105_0064831 3300048908 Bacteria 3014
451 Ga0496106_0039875 3300048909 Bacteria 3516
452 Ga0496106_0060265 3300048909 Bacteria 2876
453 Ga0496106_0488902 3300048909 Bacteria 989
454 Ga0496107_0036073 3300048910 Bacteria 3546
455 Ga0496107_0044810 3300048910 Bacteria 3181
456 Ga0496107_0046114 3300048910 Bacteria 3136
457 Ga0496108_0049753 3300048911 Bacteria 3505
458 Ga0496108_0199932 3300048911 Bacteria 1734
459 Ga0496109_0026650 3300048912 Bacteria 5156
460 Ga0496109_0061706 3300048912 Bacteria 3428
461 Ga0496109_0499788 3300048912 Unclassified 1148
462 Ga0496109_1265240 3300048912 Bacteria 674
463 Ga0496110_0032976 3300048913 Bacteria 4477
464 Ga0496110_0166874 3300048913 Unclassified 1997
465 Ga0496110_0352778 3300048913 Bacteria 1340
466 Ga0496111_0049982 3300048914 Bacteria 3014
467 Ga0496111_0327098 3300048914 Bacteria 1135
468 Ga0496112_0078990 3300048915 Bacteria 3254
469 Ga0496112_0182605 3300048915 Bacteria 2061
470 Ga0496113_0003368 3300048916 Bacteria 9553
471 Ga0496113_0148382 3300048916 Bacteria 1849
472 Ga0496114_0015306 3300048917 Bacteria 6166
473 Ga0496114_0051345 3300048917 Bacteria 3433
474 Ga0496114_0912813 3300048917 Unclassified 760
475 Ga0496115_0010881 3300048918 Bacteria 6811
476 Ga0496115_0040068 3300048918 Bacteria 3722
477 Ga0501034_0003816 3300049571 Bacteria 16987
478 Ga0501034_0006792 3300049571 Bacteria 12239
479 Ga0501034_0326597 3300049571 Bacteria 1466
480 Ga0501036_0073765 3300049572 Bacteria 2885
481 Ga0501036_0545808 3300049572 Unclassified 963
482 Ga0501036_0628620 3300049572 Bacteria 890
483 Ga0501039_0051682 3300049575 Bacteria 3180
484 Ga0501039_0156666 3300049575 Bacteria 1789
485 Ga0501041_0557073 3300049577 Bacteria 731
486 Ga0501043_0418211 3300049579 Unclassified 1011
487 Ga0501043_0601656 3300049579 Bacteria 812
488 Ga0501046_0210083 3300049580 Bacteria 1445
489 Ga0501046_0273429 3300049580 Bacteria 1239
490 Ga0501048_0075652 3300049582 Bacteria 2376
491 Ga0501048_0607711 3300049582 Bacteria 785
492 Ga0501068_0282932 3300049584 Bacteria 1060
493 Ga0501070_0278215 3300049586 Bacteria 1366
494 Ga0501071_0053966 3300049587 Bacteria 2900
495 Ga0501071_0306634 3300049587 Bacteria 1204
496 Ga0501071_0703353 3300049587 Bacteria 778
497 Ga0501072_0358890 3300049588 Bacteria 1157
498 Ga0501072_0786358 3300049588 Bacteria 746
499 Ga0501073_0068112 3300049589 Bacteria 2481
500 Ga0501073_0323901 3300049589 Bacteria 1064
501 Ga0501075_0031038 3300049591 Bacteria 3964
502 Ga0501075_0037180 3300049591 Bacteria 3636
503 Ga0501075_0053026 3300049591 Bacteria 3050
504 Ga0501075_0187497 3300049591 Bacteria 1578
505 Ga0501076_0072321 3300049592 Bacteria 2760
506 Ga0501076_0125375 3300049592 Unclassified 2081
507 Ga0501076_0145745 3300049592 Bacteria 1925
508 Ga0501077_0007500 3300049593 Bacteria 6730
509 Ga0501077_0058758 3300049593 Bacteria 2441
510 Ga0501077_0068491 3300049593 Bacteria 2250
511 Ga0501079_0003677 3300049741 Bacteria 11302
512 Ga0501079_0454893 3300049741 Bacteria 1005
513 Ga0501080_0114431 3300049742 Unclassified 2501
514 Ga0501080_0431126 3300049742 Bacteria 1183
515 Ga0501080_1066824 3300049742 Bacteria 698
516 Ga0501081_0025592 3300049743 Bacteria 3971
517 Ga0501081_0107058 3300049743 Unclassified 1983
518 Ga0501081_0251472 3300049743 Unclassified 1290
519 Ga0501081_0441032 3300049743 Bacteria 967
520 Ga0501083_0007216 3300049744 Bacteria 7893
521 Ga0501083_0249745 3300049744 Unclassified 1155
522 Ga0501083_0421329 3300049744 Bacteria 869
523 Ga0501035_0148833 3300049822 Bacteria 2032
524 Ga0501035_0340115 3300049822 Unclassified 1258
525 Ga0501035_0487594 3300049822 Bacteria 1016
526 Ga0501035_0627644 3300049822 Bacteria 873
527 Ga0501044_0453549 3300049823 Unclassified 1189
528 Ga0501045_0027822 3300049824 Bacteria 4077
529 Ga0501045_0042219 3300049824 Bacteria 3320
530 Ga0501045_0188282 3300049824 Bacteria 1538
531 nmdc:mga03683_1472_c1 3300050489 Bacteria 7024
532 nmdc:mga03n38_101622_c1 3300050490 Bacteria 1040
533 nmdc:mga00v17_238336_c1 3300050491 Unclassified 1179
534 nmdc:mga00v17_326213_c1 3300050491 Bacteria 997
535 nmdc:mga0k408_195_c1 3300050493 Bacteria 31938
536 nmdc:mga0k408_616_c1 3300050493 Bacteria 18860
537 nmdc:mga07m45_7087_c1 3300050496 Bacteria 5707
538 nmdc:mga05p37_107229_c1 3300050507 Bacteria 3437
539 nmdc:mga05p37_218663_c1 3300050507 Bacteria 2300
540 nmdc:mga05p37_440339_c1 3300050507 Bacteria 1511
541 nmdc:mga09592_22377_c1 3300050508 Bacteria 5215
542 nmdc:mga09592_405689_c1 3300050508 Bacteria 1178
543 nmdc:mga0qj67_16803_c1 3300050509 Bacteria 5557
544 nmdc:mga06r32_285514_c1 3300050510 Unclassified 1637
545 nmdc:mga06r32_51410_c1 3300050510 Bacteria 3944
546 nmdc:mga06r32_532925_c1 3300050510 Bacteria 1149
547 nmdc:mga08y16_15659_c1 3300050511 Bacteria 7973
548 nmdc:mga0n895_1073_c1 3300050512 Bacteria 19954
549 nmdc:mga0n895_205151_c1 3300050512 Unclassified 2002
550 nmdc:mga0n895_23376_c1 3300050512 Bacteria 5809
551 nmdc:mga0rr50_102892_c1 3300050513 Unclassified 2247
552 nmdc:mga08x19_234405_c1 3300050514 Bacteria 1264
553 nmdc:mga0a205_142927_c1 3300050515 Unclassified 2293
554 nmdc:mga0a205_15986_c1 3300050515 Bacteria 7022
555 nmdc:mga0a205_734_c1 3300050515 Bacteria 26430
556 Ga0495601_0080685 3300053077 Unclassified 2087
557 Ga0495612_0087192 3300053078 Bacteria 1317
558 Ga0495619_0001789 3300053085 Bacteria 14292
559 Ga0495619_0003392 3300053085 Bacteria 10295
560 Ga0500555_000145 3300053103 Bacteria 33823
561 Ga0500556_0000090 3300053104 Bacteria 84279
562 Ga0500616_0000732 3300053153 Bacteria 37983
563 Ga0501084_0046337 3300054114 Bacteria 3642
564 Ga0501084_0106256 3300054114 Bacteria 2358
565 Ga0501084_0811944 3300054114 Unclassified 788
566 Ga0501082_0068546 3300060353 Bacteria 3054
567 Ga0501082_0115641 3300060353 Bacteria 2323
568 Ga0501082_0206401 3300060353 Bacteria 1709
569 Ga0501082_0448030 3300060353 Bacteria 1128
570 Ga0530510_0013082 3300061734 Bacteria 5835
571 Ga0530510_0062602 3300061734 Unclassified 2693
572 Ga0530510_0139741 3300061734 Unclassified 1784
573 Ga0530510_0254024 3300061734 Bacteria 1310
574 Ga0530510_0325604 3300061734 Bacteria 1152
575 2688395094 2687453341 Bacteria 6534136
576 2808869203 2808606364 Bacteria 4465927
577 2881646741 2881644220 Bacteria 5302661
578 3001268173 3001267043 Bacteria 4823521
579 3006831615 3006826541 Bacteria 4678913
580 3006972967 3006969106 Bacteria 4739423
581 3006975635 3006973921 Bacteria 4423788
582 3006984812 3006984091 Bacteria 4207523
583 3006989157 3006988479 Bacteria 4767936
584 Ga0070705_100411131
585 JGI24739J22299_10050348
586 JGI24738J21930_10015527
587 JGI25151J46595_10000200
588 rootH2_10032256
589 Ga0070658_10003114
590 Ga0070658_10087879
591 Ga0070683_100133048
592 Ga0070690_100000506
593 Ga0070670_100001094
594 Ga0068869_100291494
595 Ga0070666_10037175
596 Ga0070666_10051409
597 Ga0070680_100011526
598 Ga0070682_100004278
599 Ga0068868_100318871
600 Ga0070660_100008865
601 Ga0070689_100003864
602 Ga0070689_100430368
603 Ga0070691_10041683
604 Ga0070687_100010422
605 Ga0070687_100023854
606 Ga0070687_100033753
607 Ga0070661_100011974
608 Ga0070661_100429866
609 Ga0070668_100000692
610 Ga0070668_100052078
611 Ga0070668_100465913
612 Ga0070669_100000807
613 Ga0070671_100001121
614 Ga0070674_100011705
615 Ga0070674_100610040
616 Ga0070674_100687579
617 Ga0070673_100007414
618 Ga0070673_100483425
619 Ga0070688_100007125
620 Ga0070688_100232650
621 Ga0070659_100004099
622 Ga0070659_100606170
623 Ga0070667_100011686
624 Ga0070667_100243526
625 Ga0070709_10000065
626 Ga0070709_10290886
627 Ga0070714_100018881
628 Ga0070714_100033329
629 Ga0070714_100088313
630 Ga0070714_100128556
631 Ga0070714_100513508
632 Ga0070713_100013217
633 Ga0070713_100173858
634 Ga0070710_10056231
635 Ga0070710_10176178
636 Ga0070701_10001644
637 Ga0070701_10036734
638 Ga0070701_10104249
639 Ga0070711_100011022
640 Ga0070711_100231628
641 Ga0070711_100405302
642 Ga0070711_100548653
643 Ga0070705_100014276
644 Ga0070700_100002580
645 Ga0070700_100070695
646 Ga0070700_100211761
647 Ga0070694_100000874
648 Ga0070694_100042216
649 Ga0070694_100087863
650 Ga0070694_100156176
651 Ga0070694_100319676
652 Ga0070708_100184056
653 Ga0070708_100303092
654 Ga0070663_100001067
655 Ga0070678_100004274
656 Ga0070678_100267338
657 Ga0070662_100018135
658 Ga0070706_100051070
659 Ga0070706_100072592
660 Ga0070707_100022899
661 Ga0070698_100032679
662 Ga0070698_100163218
663 Ga0070698_100181765
664 Ga0070698_100425621
665 Ga0070698_100726378
666 Ga0070698_100821921
667 Ga0070699_100016143
668 Ga0070699_100068986
669 Ga0070699_100154022
670 Ga0070699_100155826
671 Ga0070679_100022615
672 Ga0070684_100037003
673 Ga0070697_100031204
674 Ga0070697_100087512
675 Ga0070697_100168543
676 Ga0070697_100397290
677 Ga0068853_100012685
678 Ga0068853_100521504
679 Ga0070672_100015764
680 Ga0070686_100001572
681 Ga0070686_100002911
682 Ga0070686_100030780
683 Ga0070695_100002038
684 Ga0070695_100025167
685 Ga0070695_100284304
686 Ga0070696_100231659
687 Ga0070693_100000326
688 Ga0070665_100000055
689 Ga0070665_100197866
690 Ga0070665_100350802
691 Ga0070665_100707342
692 Ga0070704_100027924
693 Ga0070704_100035822
694 Ga0070704_100051871
695 Ga0070704_100834230
696 Ga0068855_100236135
697 Ga0070664_100007192
698 Ga0068857_100021460
699 Ga0068854_100023312
700 Ga0068854_100174667
701 Ga0068856_100002298
702 Ga0070702_100000139
703 Ga0070702_100087232
704 Ga0068852_100014126
705 Ga0068859_100361553
706 Ga0068864_100051849
707 Ga0068866_10197811
708 Ga0068861_100014073
709 Ga0068861_100338176
710 Ga0068861_101053456
711 Ga0068863_100000314
712 Ga0068863_100000834
713 Ga0068858_100007131
714 Ga0068858_100069925
715 Ga0068858_100194334
716 Ga0068858_100286528
717 Ga0068860_100004777
718 Ga0068860_100256000
719 Ga0068862_100025211
720 Ga0068862_100042059
721 Ga0068862_100132727
722 Ga0081455_10000230
723 Ga0081455_10009500
724 Ga0081455_10015642
725 Ga0081455_10025614
726 Ga0081455_10270781
727 Ga0081538_10109781
728 Ga0081540_1000032
729 Ga0070717_10016731
730 Ga0070717_10908255
731 Ga0075363_100348834
732 Ga0070715_10002712
733 Ga0070715_10163523
734 Ga0070716_100222085
735 Ga0070712_100024461
736 Ga0070712_100109636
737 Ga0070712_100440019
738 Ga0075362_10000382
739 Ga0075366_10032523
740 Ga0097621_100339552
741 Ga0097621_100397841
742 Ga0075370_10010415
743 Ga0068871_100068608
744 Ga0068871_100110780
745 Ga0075428_100143059
746 Ga0075428_100829086
747 Ga0075430_100075642
748 Ga0075430_100385686
749 Ga0075431_100035827
750 Ga0075431_100881012
751 Ga0075433_10083554
752 Ga0075433_10194433
753 Ga0075433_10334441
754 Ga0075434_100007422
755 Ga0075434_100011276
756 Ga0075434_100051367
757 Ga0075429_100068369
758 Ga0075429_100224087
759 Ga0068865_100006104
760 Ga0068865_100642296
761 Ga0075436_100081084
762 Ga0097620_100361543
763 Ga0075435_100204468
764 Ga0075435_100204545
765 Ga0105251_10029502
766 Ga0105250_10006956
767 Ga0105250_10108382
768 Ga0105240_10011000
769 Ga0105240_10106182
770 Ga0111539_10191805
771 Ga0111539_10223907
772 Ga0105245_10052229
773 Ga0105247_10013969
774 Ga0105247_10029246
775 Ga0105247_10032694
776 Ga0114129_10157303
777 Ga0105243_10001724
778 Ga0105243_10275819
779 Ga0105243_10806841
780 Ga0105241_10002591
781 Ga0105241_10498406
782 Ga0105242_10053929
783 Ga0105242_10162470
784 Ga0105242_10247525
785 Ga0105248_10010227
786 Ga0105248_10138182
787 Ga0105248_10314997
788 Ga0105237_10011798
789 Ga0105237_10042401
790 Ga0105237_10057413
791 Ga0105237_10241402
792 Ga0105237_10601673
793 Ga0105238_10026230
794 Ga0105238_10272277
795 Ga0105238_10450953
796 Ga0105249_10003900
797 Ga0105249_10146452
798 Ga0105249_10323236
799 Ga0105249_10540070
800 Ga0105249_10637098
801 Ga0105249_10823616
802 Ga0099796_10049319
803 Ga0105239_10020054
804 Ga0105239_10245158
805 Ga0105239_10482486
806 Ga0105239_10573068
807 Ga0105239_10582712
808 Ga0105246_10006465
809 Ga0157373_10022665
810 Ga0157371_10210523
811 Ga0157369_10071486
812 Ga0157374_10006364
813 Ga0157374_10752230
814 Ga0157378_10034592
815 Ga0157378_10355641
816 Ga0163162_10027678
817 Ga0163162_10243637
818 Ga0157372_10287168
819 Ga0157372_10536763
820 Ga0157375_10023089
821 Ga0157375_10044486
822 Ga0157375_10948115
823 Ga0163163_10106676
824 Ga0157380_10008465
825 Ga0157379_10008137
826 Ga0157379_10120356
827 Ga0157376_10022202
828 Ga0157376_10193994
829 Ga0163161_10003892
830 Ga0163161_10183786
831 Ga0163161_10298379
832 Ga0197907_10346792
833 Ga0197907_11134939
834 Ga0206356_10700244
835 Ga0206349_1143624
836 Ga0206355_1020091
837 Ga0206351_10008625
838 Ga0206350_10296713
839 Ga0206350_11151494
840 Ga0206350_11457212
841 Ga0206354_11278583
842 Ga0206353_10935834
843 Ga0206353_11428601
844 Ga0224712_10262241
845 Ga0209025_1000127
846 Ga0207697_10052315
847 Ga0207692_10385572
848 Ga0207710_10092347
849 Ga0207688_10003966
850 Ga0207680_10015137
851 Ga0207680_10082452
852 Ga0207647_10307807
853 Ga0207699_10014941
854 Ga0207699_10095398
855 Ga0207699_10358723
856 Ga0207643_10290299
857 Ga0207705_10001619
858 Ga0207705_10290723
859 Ga0207684_10017126
860 Ga0207684_10327698
861 Ga0207684_10506806
862 Ga0207654_10088110
863 Ga0207654_10246647
864 Ga0207695_10027516
865 Ga0207695_10754839
866 Ga0207671_10003083
867 Ga0207671_10007738
868 Ga0207671_10022940
869 Ga0207693_10031417
870 Ga0207693_10096426
871 Ga0207663_10018228
872 Ga0207663_10230954
873 Ga0207663_10250279
874 Ga0207660_10010553
875 Ga0207662_10003738
876 Ga0207662_10410083
877 Ga0207657_10031637
878 Ga0207649_10019900
879 Ga0207681_10031730
880 Ga0207694_10035966
881 Ga0207687_10014302
882 Ga0207700_10193287
883 Ga0207700_10324972
884 Ga0207700_10345534
885 Ga0207664_10103143
886 Ga0207664_10178593
887 Ga0207664_10180685
888 Ga0207664_10334320
889 Ga0207644_10089635
890 Ga0207690_10007550
891 Ga0207706_10000234
892 Ga0207686_10095592
893 Ga0207686_10332852
894 Ga0207670_10009819
895 Ga0207670_10397724
896 Ga0207669_10034390
897 Ga0207669_10214405
898 Ga0207704_10156227
899 Ga0207704_10240017
900 Ga0207665_10007555
901 Ga0207665_10077584
902 Ga0207665_10199410
903 Ga0207691_10029739
904 Ga0207711_10028651
905 Ga0207711_10202587
906 Ga0207689_10128768
907 Ga0207661_10014503
908 Ga0207661_10586158
909 Ga0207679_10018844
910 Ga0207651_10004644
911 Ga0207651_10216608
912 Ga0207712_10024182
913 Ga0207712_10113590
914 Ga0207712_10341815
915 Ga0207712_10426939
916 Ga0207668_10140257
917 Ga0207668_10295291
918 Ga0207640_10014575
919 Ga0207658_10007405
920 Ga0207677_10016462
921 Ga0207703_10004902
922 Ga0207703_10150539
923 Ga0207703_10224301
924 Ga0207703_10598956
925 Ga0207703_10784224
926 Ga0207639_10781690
927 Ga0207678_10000048
928 Ga0207678_10132466
929 Ga0207708_10012199
930 Ga0207708_10057151
931 Ga0207708_10096298
932 Ga0207708_10124345
933 Ga0207708_10193591
934 Ga0207708_10496069
935 Ga0207702_10588305
936 Ga0207641_10003726
937 Ga0207648_10227582
938 Ga0207676_10119519
939 Ga0207674_10020370
940 Ga0207675_100000155
941 Ga0207683_10002638
942 Ga0207683_10296892
943 Ga0207698_10016129
944 Ga0209998_10011429
945 Ga0209974_10103456
946 Ga0207428_10051510
947 Ga0268266_10000027
948 Ga0268266_10252413
949 Ga0268265_10001852
950 Ga0268265_10541577
951 Ga0268264_10158315
952 Ga0268264_10502018
953 Ga0307511_10000583
954 Ga0307511_10003648
955 Ga0265339_10215481
956 Ga0265314_10018868
957 Ga0265314_10094926
958 Ga0316576_10013425
959 Ga0316576_10216163
960 Ga0316578_10140645
961 Ga0316578_10225992
962 Ga0316578_10471052
963 Ga0316593_10089347
964 Ga0316592_1016228
965 Ga0316587_1031836
966 Ga0373948_0000625
967 Ga0373938_0034760
968 Ga0373932_0120530
969 Ga0373939_0070162
970 Ga0373962_0036493
971 Ga0316574_0051928
972 Ga0316574_0166029
973 Ga0373927_0208730
974 Ga0373937_0077389
975 Ga0316584_0030719
976 Ga0316584_0034154
977 Ga0316584_0052112
978 Ga0316584_0521802
979 Ga0395899_0048022
980 Ga0395900_0012412
981 Ga0395898_0044906
982 Ga0395898_0892447
983 Ga0395905_0071904
984 Ga0395905_0167767
985 Ga0395901_0017671
986 Ga0400484_36170
987 Ga0439460_0088926
988 Ga0451577_0003825
989 Ga0451577_0013107
990 Ga0451577_0111039
991 Ga0453684_0000505
992 Ga0453684_0002638
993 Ga0453684_0006031
994 Ga0453684_0041285
995 Ga0453684_0324328
996 Ga0453684_0974216
997 Ga0451576_0001425
998 Ga0451576_0025177
999 Ga0451576_1162592
1000 Ga0495629_0017804
1001 Ga0495580_0273940
1002 Ga0495582_0081397
1003 Ga0495639_0180490
1004 Ga0495584_0024133
1005 Ga0495584_0168244
1006 Ga0495585_0240187
1007 Ga0495594_0000366
1008 Ga0495663_0178456
1009 Ga0495652_0166550
1010 Ga0495640_0064728
1011 Ga0495587_0077885
1012 Ga0495634_0065777
1013 Ga0495635_0048566
1014 Ga0495659_0176297
1015 Ga0495659_0189045
1016 Ga0495669_0256613
1017 Ga0495613_0153809
1018 Ga0495613_0255135
1019 Ga0495581_0287603
1020 Ga0496100_0003222
1021 Ga0496100_0190545
1022 Ga0496100_0296772
1023 Ga0496101_0008929
1024 Ga0496101_0066134
1025 Ga0496101_0336914
1026 Ga0496101_0598064
1027 Ga0496102_0009056
1028 Ga0496102_0081910
1029 Ga0496103_0004221
1030 Ga0496103_0134039
1031 Ga0496104_0039971
1032 Ga0496104_0101746
1033 Ga0496105_0064831
1034 Ga0496106_0039875
1035 Ga0496106_0060265
1036 Ga0496106_0488902
1037 Ga0496107_0036073
1038 Ga0496107_0044810
1039 Ga0496107_0046114
1040 Ga0496108_0049753
1041 Ga0496108_0199932
1042 Ga0496109_0026650
1043 Ga0496109_0061706
1044 Ga0496109_0499788
1045 Ga0496109_1265240
1046 Ga0496110_0032976
1047 Ga0496110_0166874
1048 Ga0496110_0352778
1049 Ga0496111_0049982
1050 Ga0496111_0327098
1051 Ga0496112_0078990
1052 Ga0496112_0182605
1053 Ga0496113_0003368
1054 Ga0496113_0148382
1055 Ga0496114_0015306
1056 Ga0496114_0051345
1057 Ga0496114_0912813
1058 Ga0496115_0010881
1059 Ga0496115_0040068
1060 Ga0501034_0003816
1061 Ga0501034_0006792
1062 Ga0501034_0326597
1063 Ga0501036_0073765
1064 Ga0501036_0545808
1065 Ga0501036_0628620
1066 Ga0501039_0051682
1067 Ga0501039_0156666
1068 Ga0501041_0557073
1069 Ga0501043_0418211
1070 Ga0501043_0601656
1071 Ga0501046_0210083
1072 Ga0501046_0273429
1073 Ga0501048_0075652
1074 Ga0501048_0607711
1075 Ga0501068_0282932
1076 Ga0501070_0278215
1077 Ga0501071_0053966
1078 Ga0501071_0306634
1079 Ga0501071_0703353
1080 Ga0501072_0358890
1081 Ga0501072_0786358
1082 Ga0501073_0068112
1083 Ga0501073_0323901
1084 Ga0501075_0031038
1085 Ga0501075_0037180
1086 Ga0501075_0053026
1087 Ga0501075_0187497
1088 Ga0501076_0072321
1089 Ga0501076_0125375
1090 Ga0501076_0145745
1091 Ga0501077_0007500
1092 Ga0501077_0058758
1093 Ga0501077_0068491
1094 Ga0501079_0003677
1095 Ga0501079_0454893
1096 Ga0501080_0114431
1097 Ga0501080_0431126
1098 Ga0501080_1066824
1099 Ga0501081_0025592
1100 Ga0501081_0107058
1101 Ga0501081_0251472
1102 Ga0501081_0441032
1103 Ga0501083_0007216
1104 Ga0501083_0249745
1105 Ga0501083_0421329
1106 Ga0501035_0148833
1107 Ga0501035_0340115
1108 Ga0501035_0487594
1109 Ga0501035_0627644
1110 Ga0501044_0453549
1111 Ga0501045_0027822
1112 Ga0501045_0042219
1113 Ga0501045_0188282
1114 nmdc:mga03683_1472_c1
1115 nmdc:mga03n38_101622_c1
1116 nmdc:mga00v17_238336_c1
1117 nmdc:mga00v17_326213_c1
1118 nmdc:mga0k408_195_c1
1119 nmdc:mga0k408_616_c1
1120 nmdc:mga07m45_7087_c1
1121 nmdc:mga05p37_107229_c1
1122 nmdc:mga05p37_218663_c1
1123 nmdc:mga05p37_440339_c1
1124 nmdc:mga09592_22377_c1
1125 nmdc:mga09592_405689_c1
1126 nmdc:mga0qj67_16803_c1
1127 nmdc:mga06r32_285514_c1
1128 nmdc:mga06r32_51410_c1
1129 nmdc:mga06r32_532925_c1
1130 nmdc:mga08y16_15659_c1
1131 nmdc:mga0n895_1073_c1
1132 nmdc:mga0n895_205151_c1
1133 nmdc:mga0n895_23376_c1
1134 nmdc:mga0rr50_102892_c1
1135 nmdc:mga08x19_234405_c1
1136 nmdc:mga0a205_142927_c1
1137 nmdc:mga0a205_15986_c1
1138 nmdc:mga0a205_734_c1
1139 Ga0495601_0080685
1140 Ga0495612_0087192
1141 Ga0495619_0001789
1142 Ga0495619_0003392
1143 Ga0500555_000145
1144 Ga0500556_0000090
1145 Ga0500616_0000732
1146 Ga0501084_0046337
1147 Ga0501084_0106256
1148 Ga0501084_0811944
1149 Ga0501082_0068546
1150 Ga0501082_0115641
1151 Ga0501082_0206401
1152 Ga0501082_0448030
1153 Ga0530510_0013082
1154 Ga0530510_0062602
1155 Ga0530510_0139741
1156 Ga0530510_0254024
1157 Ga0530510_0325604
1158 2688395094
1159 2808869203
1160 2881646741
1161 3001268173
1162 3006831615
1163 3006972967
1164 3006975635
1165 3006984812
1166 3006989157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04298

Zn_peptidase_2

Putative neutral zinc metallopeptidase

41

259

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7067 42 107
3euh-assembly1.cif.gz_A crystal structure of the muke-mukf complex 0.6572 115 223
6akf-assembly1.cif.gz_A crystal structure of mouse claudin-3 p134a mutant in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.5437 102 213
6sna-assembly5.cif.gz_J crystal structure of antirestriction ardc protein from r388 plasmid. mn(ii)-bound structure. 0.4918 39 214
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.479 42 107
ID Description Score Start End Superfamily
3euhA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Chromosome partition protein MukF, middle domain 0.6572 115 223 1.20.58.590
af_Q99N09_47_204_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6397 123 223 1.20.140.150
af_Q9XVV9_239_480_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6217 43 104 1.10.390.10
af_Q99N07_47_207_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6014 123 225 1.20.140.150
af_Q9UPN3_1423_1541_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5931 117 228 1.20.58.60
ID Description Score Start End GO Terms
AF-A0A5B8UB36-F1-model_v4 Zinc metallopeptidase 0.9833 6 223 GO:0016020
AF-A0A3B9UUD3-F1-model_v4 Peptidase 0.9829 26 223 GO:0016020
AF-A0A237J7C1-F1-model_v4 deleted 0.982 26 110
AF-A0A4R3KVE4-F1-model_v4 Zn-dependent protease 0.9808 7 228 GO:0016020
AF-D4MME8-F1-model_v4 Predicted Zn-dependent protease 0.9802 7 223 GO:0006508
GO:0008233
GO:0016020

Map