F466147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 268 | 552 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100106204|Ga0070684_1001062042 |
| Length | 334 |
| Sequence | MNATRKTIGIVGARGHAGAELIRLIAVHPALELTYVSSREWAGQRVDSHLPEFRGDLRYSAPAHEDLPGLGADIVVLALPNGKAAACVAAFDAAGADPLIVDLSADYRFDAHWYYGLPELTRERWRGERRIANPGCYATAMALAISPLKDLLAAPPVCFGVSGYSGAGTTPSERNDPDKLHDNLMPYALIGHLHEKEAAYRLGVPVDFMPHVAPHFRGLTVTSNLYLARGLKRDEVLARFRHAYADEPLVSLVDDAPWVSRIAGRHHAEIGGITVSPDGKRVVVVATLDNLLKGAATQALQNINRAIGVDEFTAIPLPPSPTTDVHAPAGSGHD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 5 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 6 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 7 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 8 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 9 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 10 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 11 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 12 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 13 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 14 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 15 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 16 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 17 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 18 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 19 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 20 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 21 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 22 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 23 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 24 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 25 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 26 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 27 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 28 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 29 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 30 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 31 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 36 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 37 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 38 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 39 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 40 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 112 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 187 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 232 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 265 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 268 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.33 |
| Metatranscriptomes | 0.52 |
| Isolates | 5.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.37 |
| Nodule | 0 |
| Rhizoplane | 3.09 |
| Rhizosphere | 70.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_723762 | 2162886007 | Bacteria | 4988 |
| 2 | JGI24741J21665_1004716 | 3300001915 | Bacteria | 2966 |
| 3 | JGI24740J21852_10003993 | 3300001979 | Bacteria | 6403 |
| 4 | JGI24737J22298_10009376 | 3300001990 | Bacteria | 3259 |
| 5 | JGI24735J21928_10002797 | 3300002067 | Bacteria | 6021 |
| 6 | JGI25156J39149_1000463 | 3300002705 | Bacteria | 24552 |
| 7 | JGI25156J39149_1013681 | 3300002705 | Bacteria | 1709 |
| 8 | JGI25156J39149_1013976 | 3300002705 | Bacteria | 1676 |
| 9 | JGI25162J39368_1000163 | 3300002737 | Bacteria | 74121 |
| 10 | JGI25162J39368_1000895 | 3300002737 | Bacteria | 19431 |
| 11 | JGI25162J39368_1001323 | 3300002737 | Bacteria | 13849 |
| 12 | JGI25162J39368_1001410 | 3300002737 | Bacteria | 13098 |
| 13 | JGI25157J39369_1000229 | 3300002741 | Bacteria | 43921 |
| 14 | JGI25157J39369_1000575 | 3300002741 | Bacteria | 21822 |
| 15 | JGI25157J39369_1000654 | 3300002741 | Bacteria | 19192 |
| 16 | JGI25157J39369_1004101 | 3300002741 | Bacteria | 2735 |
| 17 | JGI25163J39215_1000538 | 3300002771 | Bacteria | 11102 |
| 18 | JGI25164J39214_1000045 | 3300002772 | Bacteria | 125909 |
| 19 | JGI25164J39214_1000285 | 3300002772 | Bacteria | 35663 |
| 20 | JGI25164J39214_1000485 | 3300002772 | Bacteria | 19655 |
| 21 | JGI25164J39214_1000690 | 3300002772 | Bacteria | 13175 |
| 22 | JGI25165J46597_1000072 | 3300003214 | Bacteria | 192184 |
| 23 | JGI25165J46597_1000215 | 3300003214 | Bacteria | 81941 |
| 24 | JGI25165J46597_1000812 | 3300003214 | Bacteria | 23523 |
| 25 | rootH1_10025459 | 3300003316 | Bacteria | 4344 |
| 26 | rootH2_10012587 | 3300003320 | Bacteria | 26291 |
| 27 | Ga0055538_1001046 | 3300003751 | Bacteria | 6219 |
| 28 | Ga0055527_1000209 | 3300003760 | Bacteria | 37913 |
| 29 | Ga0055527_1001498 | 3300003760 | Bacteria | 4837 |
| 30 | Ga0055535_1000124 | 3300003761 | Bacteria | 81941 |
| 31 | Ga0055535_1000451 | 3300003761 | Bacteria | 37913 |
| 32 | Ga0055535_1000831 | 3300003761 | Bacteria | 22164 |
| 33 | Ga0055535_1008706 | 3300003761 | Bacteria | 1804 |
| 34 | Ga0055542_1000197 | 3300003762 | Bacteria | 74121 |
| 35 | Ga0055542_1000242 | 3300003762 | Bacteria | 62798 |
| 36 | Ga0055542_1000349 | 3300003762 | Bacteria | 48521 |
| 37 | Ga0055542_1000466 | 3300003762 | Bacteria | 37913 |
| 38 | Ga0055529_1000197 | 3300003763 | Bacteria | 81941 |
| 39 | Ga0055529_1000204 | 3300003763 | Bacteria | 78293 |
| 40 | Ga0055529_1000671 | 3300003763 | Bacteria | 23784 |
| 41 | Ga0055536_1002005 | 3300003781 | Bacteria | 11676 |
| 42 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 43 | Ga0058692_1000012 | 3300003856 | Bacteria | 318930 |
| 44 | Ga0065165_1000118 | 3300005262 | Bacteria | 134488 |
| 45 | Ga0065704_10070476 | 3300005289 | Bacteria | 23424 |
| 46 | Ga0065704_10070915 | 3300005289 | Bacteria | 14696 |
| 47 | Ga0070658_10020563 | 3300005327 | Bacteria | 5291 |
| 48 | Ga0070658_10094950 | 3300005327 | Bacteria | 2461 |
| 49 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 50 | Ga0070680_100001147 | 3300005336 | Bacteria | 18999 |
| 51 | Ga0070680_100054615 | 3300005336 | Bacteria | 3262 |
| 52 | Ga0070680_100101701 | 3300005336 | Bacteria | 2386 |
| 53 | Ga0070682_100005899 | 3300005337 | Bacteria | 6848 |
| 54 | Ga0070660_100010300 | 3300005339 | Bacteria | 6601 |
| 55 | Ga0070660_100019495 | 3300005339 | Bacteria | 4972 |
| 56 | Ga0070691_10011407 | 3300005341 | Bacteria | 4058 |
| 57 | Ga0070661_100006026 | 3300005344 | Bacteria | 8341 |
| 58 | Ga0070661_100083337 | 3300005344 | Bacteria | 2362 |
| 59 | Ga0070661_100122322 | 3300005344 | Bacteria | 1950 |
| 60 | Ga0070692_10000760 | 3300005345 | Bacteria | 10573 |
| 61 | Ga0070668_100269442 | 3300005347 | Bacteria | 1419 |
| 62 | Ga0070671_100313027 | 3300005355 | Bacteria | 1337 |
| 63 | Ga0070659_100359423 | 3300005366 | Bacteria | 1223 |
| 64 | Ga0070667_100000061 | 3300005367 | Bacteria | 143754 |
| 65 | Ga0070667_100130011 | 3300005367 | Bacteria | 2197 |
| 66 | Ga0070714_100053430 | 3300005435 | Bacteria | 3448 |
| 67 | Ga0070713_100230093 | 3300005436 | Bacteria | 1685 |
| 68 | Ga0070663_100000098 | 3300005455 | Bacteria | 39429 |
| 69 | Ga0070663_100006804 | 3300005455 | Bacteria | 6912 |
| 70 | Ga0070663_100217132 | 3300005455 | Bacteria | 1500 |
| 71 | Ga0070663_100230760 | 3300005455 | Bacteria | 1457 |
| 72 | Ga0070662_100015623 | 3300005457 | Bacteria | 5089 |
| 73 | Ga0070681_10000478 | 3300005458 | Bacteria | 32685 |
| 74 | Ga0070681_10002606 | 3300005458 | Bacteria | 16546 |
| 75 | Ga0070681_10006071 | 3300005458 | Bacteria | 11717 |
| 76 | Ga0070681_10008891 | 3300005458 | Bacteria | 9873 |
| 77 | Ga0070681_10051954 | 3300005458 | Bacteria | 4087 |
| 78 | Ga0070681_10151614 | 3300005458 | Bacteria | 2244 |
| 79 | Ga0070681_10181467 | 3300005458 | Bacteria | 2026 |
| 80 | Ga0070685_10016889 | 3300005466 | Bacteria | 3895 |
| 81 | Ga0070679_100000159 | 3300005530 | Bacteria | 53995 |
| 82 | Ga0070679_100001102 | 3300005530 | Bacteria | 23613 |
| 83 | Ga0070679_100005521 | 3300005530 | Bacteria | 11717 |
| 84 | Ga0070679_100258561 | 3300005530 | Bacteria | 1696 |
| 85 | Ga0070684_100015112 | 3300005535 | Bacteria | 6276 |
| 86 | Ga0070684_100106204 | 3300005535 | Bacteria | 2513 |
| 87 | Ga0070684_100268297 | 3300005535 | Bacteria | 1562 |
| 88 | Ga0068853_100000998 | 3300005539 | Bacteria | 19938 |
| 89 | Ga0068853_100015777 | 3300005539 | Bacteria | 6204 |
| 90 | Ga0068853_100032032 | 3300005539 | Bacteria | 4451 |
| 91 | Ga0068853_100249431 | 3300005539 | Bacteria | 1628 |
| 92 | Ga0070696_100013121 | 3300005546 | Bacteria | 5559 |
| 93 | Ga0070696_100019136 | 3300005546 | Bacteria | 4635 |
| 94 | Ga0070696_100021589 | 3300005546 | Bacteria | 4366 |
| 95 | Ga0070696_100032241 | 3300005546 | Bacteria | 3595 |
| 96 | Ga0070693_100024182 | 3300005547 | Bacteria | 3255 |
| 97 | Ga0070693_100057716 | 3300005547 | Bacteria | 2245 |
| 98 | Ga0068855_100042451 | 3300005563 | Bacteria | 5388 |
| 99 | Ga0068855_100054823 | 3300005563 | Bacteria | 4685 |
| 100 | Ga0068857_100046007 | 3300005577 | Bacteria | 3872 |
| 101 | Ga0068854_100014236 | 3300005578 | Bacteria | 5238 |
| 102 | Ga0068854_100017938 | 3300005578 | Bacteria | 4744 |
| 103 | Ga0068854_100135998 | 3300005578 | Bacteria | 1881 |
| 104 | Ga0068854_100198100 | 3300005578 | Bacteria | 1577 |
| 105 | Ga0068856_100000416 | 3300005614 | Bacteria | 46989 |
| 106 | Ga0068856_100004196 | 3300005614 | Bacteria | 14393 |
| 107 | Ga0068856_100030189 | 3300005614 | Bacteria | 5299 |
| 108 | Ga0068856_100132041 | 3300005614 | Bacteria | 2502 |
| 109 | Ga0068852_100103211 | 3300005616 | Bacteria | 2578 |
| 110 | Ga0068859_100507566 | 3300005617 | Bacteria | 1301 |
| 111 | Ga0068864_100022244 | 3300005618 | Bacteria | 5314 |
| 112 | Ga0068864_100175186 | 3300005618 | Bacteria | 1958 |
| 113 | Ga0068851_10013971 | 3300005834 | Bacteria | 3805 |
| 114 | Ga0068863_100040023 | 3300005841 | Bacteria | 4457 |
| 115 | Ga0068863_100046769 | 3300005841 | Bacteria | 4107 |
| 116 | Ga0068858_100237183 | 3300005842 | Bacteria | 1730 |
| 117 | Ga0068860_100034319 | 3300005843 | Bacteria | 4865 |
| 118 | Ga0097621_100039782 | 3300006237 | Bacteria | 3778 |
| 119 | Ga0068865_100217977 | 3300006881 | Bacteria | 1490 |
| 120 | Ga0097620_100507600 | 3300006931 | Bacteria | 1301 |
| 121 | Ga0105240_10008662 | 3300009093 | Bacteria | 14524 |
| 122 | Ga0105240_10028816 | 3300009093 | Bacteria | 7243 |
| 123 | Ga0105240_10090461 | 3300009093 | Bacteria | 3740 |
| 124 | Ga0105240_10090630 | 3300009093 | Bacteria | 3737 |
| 125 | Ga0105240_10381373 | 3300009093 | Bacteria | 1592 |
| 126 | Ga0105243_10004981 | 3300009148 | Bacteria | 10410 |
| 127 | Ga0105241_10273475 | 3300009174 | Bacteria | 1440 |
| 128 | Ga0105241_10358131 | 3300009174 | Bacteria | 1269 |
| 129 | Ga0105248_10000294 | 3300009177 | Bacteria | 59302 |
| 130 | Ga0105248_10216895 | 3300009177 | Bacteria | 2155 |
| 131 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 132 | Ga0105237_10000637 | 3300009545 | Bacteria | 48955 |
| 133 | Ga0105237_10071696 | 3300009545 | Bacteria | 3459 |
| 134 | Ga0105238_10003835 | 3300009551 | Bacteria | 14930 |
| 135 | Ga0105238_10036497 | 3300009551 | Bacteria | 4996 |
| 136 | Ga0105238_10054370 | 3300009551 | Bacteria | 4020 |
| 137 | Ga0105238_10073353 | 3300009551 | Bacteria | 3417 |
| 138 | Ga0105238_10210926 | 3300009551 | Bacteria | 1918 |
| 139 | Ga0105249_10000272 | 3300009553 | Bacteria | 54568 |
| 140 | Ga0105249_10036550 | 3300009553 | Bacteria | 4455 |
| 141 | Ga0105239_10000030 | 3300010375 | Bacteria | 233669 |
| 142 | Ga0105239_10039254 | 3300010375 | Bacteria | 5187 |
| 143 | Ga0105239_10065148 | 3300010375 | Bacteria | 4001 |
| 144 | Ga0105239_10067311 | 3300010375 | Bacteria | 3935 |
| 145 | Ga0105239_10106232 | 3300010375 | Bacteria | 3110 |
| 146 | Ga0105246_10003959 | 3300011119 | Bacteria | 8977 |
| 147 | Ga0157373_10026888 | 3300013100 | Bacteria | 4153 |
| 148 | Ga0157373_10248043 | 3300013100 | Bacteria | 1259 |
| 149 | Ga0157371_10010073 | 3300013102 | Bacteria | 7390 |
| 150 | Ga0157371_10046887 | 3300013102 | Bacteria | 3071 |
| 151 | Ga0157370_10000293 | 3300013104 | Bacteria | 63396 |
| 152 | Ga0157370_10001525 | 3300013104 | Bacteria | 28645 |
| 153 | Ga0157370_10005088 | 3300013104 | Bacteria | 14834 |
| 154 | Ga0157370_10007298 | 3300013104 | Bacteria | 12062 |
| 155 | Ga0157370_10167371 | 3300013104 | Bacteria | 2044 |
| 156 | Ga0157369_10012900 | 3300013105 | Bacteria | 9472 |
| 157 | Ga0157374_10019015 | 3300013296 | Bacteria | 6076 |
| 158 | Ga0157374_10039886 | 3300013296 | Bacteria | 4323 |
| 159 | Ga0163162_10000489 | 3300013306 | Bacteria | 36741 |
| 160 | Ga0157372_10003283 | 3300013307 | Bacteria | 17484 |
| 161 | Ga0157372_10007646 | 3300013307 | Bacteria | 11492 |
| 162 | Ga0157372_10011205 | 3300013307 | Bacteria | 9538 |
| 163 | Ga0157372_10056190 | 3300013307 | Bacteria | 4398 |
| 164 | Ga0157372_10329461 | 3300013307 | Bacteria | 1778 |
| 165 | Ga0157372_10505534 | 3300013307 | Bacteria | 1409 |
| 166 | Ga0157375_10014055 | 3300013308 | Bacteria | 7139 |
| 167 | Ga0163163_10053838 | 3300014325 | Bacteria | 3974 |
| 168 | Ga0163163_10443403 | 3300014325 | Bacteria | 1358 |
| 169 | Ga0182008_10007901 | 3300014497 | Bacteria | 5838 |
| 170 | Ga0182008_10033442 | 3300014497 | Bacteria | 2579 |
| 171 | Ga0157379_10006837 | 3300014968 | Bacteria | 9858 |
| 172 | Ga0157376_10038489 | 3300014969 | Bacteria | 3892 |
| 173 | Ga0182005_1000028 | 3300015265 | Bacteria | 221889 |
| 174 | Ga0182005_1004772 | 3300015265 | Bacteria | 4323 |
| 175 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 176 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 177 | Ga0163161_10086921 | 3300017792 | Bacteria | 2308 |
| 178 | Ga0206354_10560480 | 3300020081 | Bacteria | 6450 |
| 179 | Ga0206353_10613403 | 3300020082 | Bacteria | 1238 |
| 180 | Ga0154015_1237743 | 3300020610 | Bacteria | 3202 |
| 181 | Ga0209435_102200 | 3300025206 | Bacteria | 2314 |
| 182 | Ga0209435_108134 | 3300025206 | Bacteria | 1157 |
| 183 | Ga0209784_100120 | 3300025224 | Bacteria | 82684 |
| 184 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 185 | Ga0209674_101824 | 3300025226 | Bacteria | 5080 |
| 186 | Ga0209674_102139 | 3300025226 | Bacteria | 4455 |
| 187 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 188 | Ga0209672_100277 | 3300025228 | Bacteria | 37238 |
| 189 | Ga0209672_100911 | 3300025228 | Bacteria | 13436 |
| 190 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 191 | Ga0207427_100013 | 3300025231 | Bacteria | 581419 |
| 192 | Ga0207427_100055 | 3300025231 | Bacteria | 209093 |
| 193 | Ga0207427_100244 | 3300025231 | Bacteria | 43765 |
| 194 | Ga0207427_100248 | 3300025231 | Bacteria | 42623 |
| 195 | Ga0207427_103884 | 3300025231 | Bacteria | 2810 |
| 196 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 197 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 198 | Ga0209437_100079 | 3300025233 | Bacteria | 275948 |
| 199 | Ga0209437_100161 | 3300025233 | Bacteria | 148264 |
| 200 | Ga0209437_100224 | 3300025233 | Bacteria | 101515 |
| 201 | Ga0209437_102166 | 3300025233 | Bacteria | 3939 |
| 202 | Ga0209437_103650 | 3300025233 | Bacteria | 2758 |
| 203 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 204 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 205 | Ga0209258_100186 | 3300025242 | Bacteria | 132381 |
| 206 | Ga0209258_103422 | 3300025242 | Bacteria | 3427 |
| 207 | Ga0209646_1000467 | 3300025246 | Bacteria | 20487 |
| 208 | Ga0209646_1000760 | 3300025246 | Bacteria | 11160 |
| 209 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 210 | Ga0209026_1000204 | 3300025250 | Bacteria | 81999 |
| 211 | Ga0209026_1000375 | 3300025250 | Bacteria | 41000 |
| 212 | Ga0209026_1001302 | 3300025250 | Bacteria | 11274 |
| 213 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 214 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 215 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 216 | Ga0209148_1000073 | 3300025254 | Bacteria | 320851 |
| 217 | Ga0209148_1001285 | 3300025254 | Bacteria | 13676 |
| 218 | Ga0209759_1000103 | 3300025256 | Bacteria | 153195 |
| 219 | Ga0209759_1000672 | 3300025256 | Bacteria | 31426 |
| 220 | Ga0209759_1013336 | 3300025256 | Bacteria | 2229 |
| 221 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 222 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 223 | Ga0209233_1000063 | 3300025261 | Bacteria | 395810 |
| 224 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 225 | Ga0209233_1011780 | 3300025261 | Bacteria | 2566 |
| 226 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 227 | Ga0209455_1000082 | 3300025272 | Bacteria | 257909 |
| 228 | Ga0209455_1000177 | 3300025272 | Bacteria | 106026 |
| 229 | Ga0209455_1000344 | 3300025272 | Bacteria | 43864 |
| 230 | Ga0209455_1006368 | 3300025272 | Bacteria | 3494 |
| 231 | Ga0209676_1000034 | 3300025292 | Bacteria | 460125 |
| 232 | Ga0209256_1004365 | 3300025299 | Bacteria | 8952 |
| 233 | Ga0207426_1011861 | 3300025302 | Bacteria | 3298 |
| 234 | Ga0207656_10046545 | 3300025321 | Bacteria | 1861 |
| 235 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 236 | Ga0207647_10000084 | 3300025904 | Bacteria | 71295 |
| 237 | Ga0207647_10000747 | 3300025904 | Bacteria | 25485 |
| 238 | Ga0207647_10010317 | 3300025904 | Bacteria | 6599 |
| 239 | Ga0207705_10001128 | 3300025909 | Bacteria | 21726 |
| 240 | Ga0207705_10008538 | 3300025909 | Bacteria | 7469 |
| 241 | Ga0207705_10010341 | 3300025909 | Bacteria | 6787 |
| 242 | Ga0207705_10015167 | 3300025909 | Bacteria | 5538 |
| 243 | Ga0207705_10074272 | 3300025909 | Bacteria | 2468 |
| 244 | Ga0207705_10081318 | 3300025909 | Bacteria | 2361 |
| 245 | Ga0207654_10004928 | 3300025911 | Bacteria | 6754 |
| 246 | Ga0207707_10000032 | 3300025912 | Bacteria | 158499 |
| 247 | Ga0207707_10000274 | 3300025912 | Bacteria | 55548 |
| 248 | Ga0207707_10002692 | 3300025912 | Bacteria | 15870 |
| 249 | Ga0207707_10003858 | 3300025912 | Bacteria | 13289 |
| 250 | Ga0207707_10011681 | 3300025912 | Bacteria | 7643 |
| 251 | Ga0207707_10058093 | 3300025912 | Bacteria | 3367 |
| 252 | Ga0207707_10161666 | 3300025912 | Bacteria | 1958 |
| 253 | Ga0207695_10001749 | 3300025913 | Bacteria | 34474 |
| 254 | Ga0207695_10003349 | 3300025913 | Bacteria | 22657 |
| 255 | Ga0207695_10003804 | 3300025913 | Bacteria | 20926 |
| 256 | Ga0207695_10004269 | 3300025913 | Bacteria | 19628 |
| 257 | Ga0207695_10019259 | 3300025913 | Bacteria | 7860 |
| 258 | Ga0207695_10149108 | 3300025913 | Bacteria | 2279 |
| 259 | Ga0207695_10171773 | 3300025913 | Bacteria | 2093 |
| 260 | Ga0207671_10000074 | 3300025914 | Bacteria | 156482 |
| 261 | Ga0207671_10009987 | 3300025914 | Bacteria | 7885 |
| 262 | Ga0207671_10103904 | 3300025914 | Bacteria | 2155 |
| 263 | Ga0207660_10000431 | 3300025917 | Bacteria | 27636 |
| 264 | Ga0207660_10001041 | 3300025917 | Bacteria | 18343 |
| 265 | Ga0207660_10002224 | 3300025917 | Bacteria | 12842 |
| 266 | Ga0207660_10014264 | 3300025917 | Bacteria | 5221 |
| 267 | Ga0207660_10045926 | 3300025917 | Bacteria | 3080 |
| 268 | Ga0207660_10187936 | 3300025917 | Bacteria | 1607 |
| 269 | Ga0207657_10001633 | 3300025919 | Bacteria | 24148 |
| 270 | Ga0207657_10002096 | 3300025919 | Bacteria | 21574 |
| 271 | Ga0207649_10008395 | 3300025920 | Bacteria | 5629 |
| 272 | Ga0207649_10157664 | 3300025920 | Bacteria | 1570 |
| 273 | Ga0207652_10000026 | 3300025921 | Bacteria | 156183 |
| 274 | Ga0207652_10000715 | 3300025921 | Bacteria | 32237 |
| 275 | Ga0207652_10005288 | 3300025921 | Bacteria | 10475 |
| 276 | Ga0207652_10234641 | 3300025921 | Bacteria | 1653 |
| 277 | Ga0207694_10009159 | 3300025924 | Bacteria | 7472 |
| 278 | Ga0207694_10011255 | 3300025924 | Bacteria | 6757 |
| 279 | Ga0207694_10074068 | 3300025924 | Bacteria | 2665 |
| 280 | Ga0207694_10098035 | 3300025924 | Bacteria | 2320 |
| 281 | Ga0207694_10332149 | 3300025924 | Bacteria | 1256 |
| 282 | Ga0207650_10169429 | 3300025925 | Bacteria | 1735 |
| 283 | Ga0207700_10141960 | 3300025928 | Bacteria | 1974 |
| 284 | Ga0207664_10098555 | 3300025929 | Bacteria | 2410 |
| 285 | Ga0207690_10001160 | 3300025932 | Bacteria | 16674 |
| 286 | Ga0207690_10005361 | 3300025932 | Bacteria | 7558 |
| 287 | Ga0207706_10026570 | 3300025933 | Bacteria | 5181 |
| 288 | Ga0207709_10007378 | 3300025935 | Bacteria | 6126 |
| 289 | Ga0207711_10000850 | 3300025941 | Bacteria | 29523 |
| 290 | Ga0207689_10042832 | 3300025942 | Bacteria | 3743 |
| 291 | Ga0207661_10174231 | 3300025944 | Bacteria | 1874 |
| 292 | Ga0207667_10002690 | 3300025949 | Bacteria | 21986 |
| 293 | Ga0207667_10005247 | 3300025949 | Bacteria | 15812 |
| 294 | Ga0207667_10011214 | 3300025949 | Bacteria | 10429 |
| 295 | Ga0207667_10251913 | 3300025949 | Bacteria | 1806 |
| 296 | Ga0207667_10321237 | 3300025949 | Bacteria | 1581 |
| 297 | Ga0207712_10000339 | 3300025961 | Bacteria | 42473 |
| 298 | Ga0207712_10001053 | 3300025961 | Bacteria | 19387 |
| 299 | Ga0207712_10026904 | 3300025961 | Bacteria | 3837 |
| 300 | Ga0207668_10204173 | 3300025972 | Bacteria | 1576 |
| 301 | Ga0207640_10002743 | 3300025981 | Bacteria | 9424 |
| 302 | Ga0207640_10006105 | 3300025981 | Bacteria | 6586 |
| 303 | Ga0207640_10008198 | 3300025981 | Bacteria | 5791 |
| 304 | Ga0207640_10030042 | 3300025981 | Bacteria | 3343 |
| 305 | Ga0207640_10031945 | 3300025981 | Bacteria | 3260 |
| 306 | Ga0207640_10113448 | 3300025981 | Bacteria | 1926 |
| 307 | Ga0207658_10000166 | 3300025986 | Bacteria | 70441 |
| 308 | Ga0207658_10084659 | 3300025986 | Bacteria | 2440 |
| 309 | Ga0207639_10002830 | 3300026041 | Bacteria | 11641 |
| 310 | Ga0207639_10012112 | 3300026041 | Bacteria | 6001 |
| 311 | Ga0207639_10014786 | 3300026041 | Bacteria | 5497 |
| 312 | Ga0207639_10022813 | 3300026041 | Bacteria | 4512 |
| 313 | Ga0207678_10001403 | 3300026067 | Bacteria | 22155 |
| 314 | Ga0207678_10002211 | 3300026067 | Bacteria | 17577 |
| 315 | Ga0207678_10003668 | 3300026067 | Bacteria | 13806 |
| 316 | Ga0207678_10011703 | 3300026067 | Bacteria | 7699 |
| 317 | Ga0207678_10022074 | 3300026067 | Bacteria | 5577 |
| 318 | Ga0207678_10111048 | 3300026067 | Bacteria | 2339 |
| 319 | Ga0207678_10120294 | 3300026067 | Bacteria | 2241 |
| 320 | Ga0207702_10000185 | 3300026078 | Bacteria | 74602 |
| 321 | Ga0207702_10008548 | 3300026078 | Bacteria | 8628 |
| 322 | Ga0207702_10096143 | 3300026078 | Bacteria | 2604 |
| 323 | Ga0207702_10184847 | 3300026078 | Bacteria | 1921 |
| 324 | Ga0207641_10064929 | 3300026088 | Bacteria | 3121 |
| 325 | Ga0207641_10078202 | 3300026088 | Bacteria | 2864 |
| 326 | Ga0207648_10176343 | 3300026089 | Bacteria | 1890 |
| 327 | Ga0207676_10066337 | 3300026095 | Bacteria | 2878 |
| 328 | Ga0207674_10002798 | 3300026116 | Bacteria | 21725 |
| 329 | Ga0207674_10018482 | 3300026116 | Bacteria | 7576 |
| 330 | Ga0207674_10054334 | 3300026116 | Bacteria | 4078 |
| 331 | Ga0207674_10105380 | 3300026116 | Bacteria | 2798 |
| 332 | Ga0207698_10001786 | 3300026142 | Bacteria | 12566 |
| 333 | Ga0207698_10002926 | 3300026142 | Bacteria | 10208 |
| 334 | Ga0207698_10100907 | 3300026142 | Bacteria | 2392 |
| 335 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 336 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 337 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 338 | Ga0268264_10056756 | 3300028381 | Bacteria | 3274 |
| 339 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 340 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 341 | Ga0307516_10106044 | 3300031730 | Bacteria | 2621 |
| 342 | Ga0307412_10003347 | 3300031911 | Bacteria | 8905 |
| 343 | Ga0307412_10100670 | 3300031911 | Bacteria | 2043 |
| 344 | Ga0307409_100317436 | 3300031995 | Bacteria | 1457 |
| 345 | Ga0307414_10004643 | 3300032004 | Bacteria | 7480 |
| 346 | Ga0307414_10008972 | 3300032004 | Bacteria | 5717 |
| 347 | Ga0307414_10041317 | 3300032004 | Bacteria | 3123 |
| 348 | Ga0307414_10046183 | 3300032004 | Bacteria | 2987 |
| 349 | Ga0307411_10075577 | 3300032005 | Bacteria | 2300 |
| 350 | Ga0307510_10005230 | 3300033180 | Bacteria | 15426 |
| 351 | Ga0307510_10021816 | 3300033180 | Bacteria | 7452 |
| 352 | Ga0395899_0016207 | 3300037312 | Bacteria | 5679 |
| 353 | Ga0395899_0085820 | 3300037312 | Bacteria | 2287 |
| 354 | Ga0395899_0219217 | 3300037312 | Bacteria | 1318 |
| 355 | Ga0395900_0005984 | 3300037418 | Bacteria | 12701 |
| 356 | Ga0395900_0007251 | 3300037418 | Bacteria | 11478 |
| 357 | Ga0395900_0008909 | 3300037418 | Bacteria | 10296 |
| 358 | Ga0395900_0047569 | 3300037418 | Bacteria | 4417 |
| 359 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 360 | Ga0395898_0003336 | 3300037466 | Bacteria | 18023 |
| 361 | Ga0395898_0004927 | 3300037466 | Bacteria | 14491 |
| 362 | Ga0395898_0012224 | 3300037466 | Bacteria | 8876 |
| 363 | Ga0395898_0114074 | 3300037466 | Bacteria | 2589 |
| 364 | Ga0395905_0084163 | 3300037471 | Bacteria | 2980 |
| 365 | Ga0395901_0004732 | 3300038443 | Bacteria | 13738 |
| 366 | Ga0395901_0005132 | 3300038443 | Bacteria | 13220 |
| 367 | Ga0395901_0009707 | 3300038443 | Bacteria | 9760 |
| 368 | Ga0395901_0010230 | 3300038443 | Bacteria | 9503 |
| 369 | Ga0395901_0165825 | 3300038443 | Bacteria | 2320 |
| 370 | Ga0395901_0186033 | 3300038443 | Bacteria | 2178 |
| 371 | Ga0395901_0194078 | 3300038443 | Bacteria | 2129 |
| 372 | Ga0237816_02346 | 3300039145 | Bacteria | 1459 |
| 373 | Ga0436365_0838762 | 3300039437 | Bacteria | 3305 |
| 374 | Ga0439436_0000156 | 3300041404 | Bacteria | 15891 |
| 375 | Ga0451800_0027863 | 3300041459 | Bacteria | 1854 |
| 376 | Ga0451800_0163290 | 3300041459 | Bacteria | 12437 |
| 377 | Ga0451806_619891 | 3300041462 | Bacteria | 4955 |
| 378 | Ga0451804_0794885 | 3300041463 | Bacteria | 2792 |
| 379 | Ga0451807_1039361 | 3300041486 | Bacteria | 5369 |
| 380 | Ga0451853_2514762 | 3300041512 | Bacteria | 2017 |
| 381 | Ga0439459_0006387 | 3300042438 | Bacteria | 1962 |
| 382 | Ga0466969_0003903 | 3300044656 | Bacteria | 7914 |
| 383 | Ga0466965_0000550 | 3300044683 | Bacteria | 13502 |
| 384 | Ga0466966_0001316 | 3300044684 | Bacteria | 15936 |
| 385 | Ga0466966_0013296 | 3300044684 | Bacteria | 5450 |
| 386 | Ga0466961_0004179 | 3300044693 | Bacteria | 9020 |
| 387 | Ga0466961_0009981 | 3300044693 | Bacteria | 6051 |
| 388 | Ga0466961_0013180 | 3300044693 | Bacteria | 5287 |
| 389 | Ga0466963_0162984 | 3300044694 | Bacteria | 1552 |
| 390 | Ga0466971_0006496 | 3300044719 | Bacteria | 5082 |
| 391 | Ga0466971_0019590 | 3300044719 | Bacteria | 3006 |
| 392 | Ga0466957_0028237 | 3300044842 | Bacteria | 3339 |
| 393 | Ga0466957_0137941 | 3300044842 | Bacteria | 1569 |
| 394 | Ga0466960_0005921 | 3300044901 | Bacteria | 4875 |
| 395 | Ga0466959_0010673 | 3300045049 | Bacteria | 6576 |
| 396 | Ga0466959_0045661 | 3300045049 | Bacteria | 3226 |
| 397 | Ga0466958_0020369 | 3300045836 | Bacteria | 3867 |
| 398 | Ga0495627_025570 | 3300046453 | Bacteria | 1913 |
| 399 | Ga0495638_0000234 | 3300046460 | Bacteria | 75860 |
| 400 | Ga0495650_0000247 | 3300046471 | Bacteria | 106616 |
| 401 | Ga0495585_0000104 | 3300046492 | Bacteria | 90097 |
| 402 | Ga0495607_0008360 | 3300046501 | Bacteria | 7080 |
| 403 | Ga0495606_0000401 | 3300046507 | Bacteria | 73149 |
| 404 | Ga0495606_0005269 | 3300046507 | Bacteria | 12464 |
| 405 | Ga0495610_0002689 | 3300046512 | Bacteria | 14657 |
| 406 | Ga0495648_0000914 | 3300046524 | Bacteria | 30767 |
| 407 | Ga0495622_0006636 | 3300046557 | Bacteria | 5364 |
| 408 | Ga0495633_0032712 | 3300046558 | Bacteria | 2511 |
| 409 | Ga0495625_0005535 | 3300046660 | Bacteria | 11474 |
| 410 | Ga0495625_0016176 | 3300046660 | Bacteria | 5876 |
| 411 | Ga0495661_0000199 | 3300046665 | Bacteria | 69536 |
| 412 | Ga0495670_0008599 | 3300046691 | Bacteria | 5024 |
| 413 | Ga0495649_0000553 | 3300046694 | Bacteria | 31708 |
| 414 | Ga0495660_0000583 | 3300046810 | Bacteria | 29142 |
| 415 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 416 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 417 | Ga0496100_0115146 | 3300048903 | Bacteria | 1874 |
| 418 | Ga0496104_0030305 | 3300048907 | Bacteria | 5026 |
| 419 | Ga0496105_0003042 | 3300048908 | Bacteria | 12333 |
| 420 | Ga0496106_0007333 | 3300048909 | Bacteria | 8150 |
| 421 | Ga0496106_0111966 | 3300048909 | Bacteria | 2126 |
| 422 | Ga0496107_0094468 | 3300048910 | Bacteria | 2188 |
| 423 | Ga0496108_0158003 | 3300048911 | Bacteria | 1958 |
| 424 | Ga0496113_0014146 | 3300048916 | Bacteria | 5434 |
| 425 | Ga0496113_0193342 | 3300048916 | Bacteria | 1615 |
| 426 | Ga0496114_0016091 | 3300048917 | Bacteria | 6020 |
| 427 | Ga0496115_0000073 | 3300048918 | Bacteria | 90289 |
| 428 | Ga0496115_0000206 | 3300048918 | Bacteria | 54824 |
| 429 | Ga0496115_0000946 | 3300048918 | Bacteria | 21065 |
| 430 | Ga0496117_0008476 | 3300048920 | Bacteria | 9759 |
| 431 | Ga0496117_0022641 | 3300048920 | Bacteria | 5035 |
| 432 | Ga0496117_0025189 | 3300048920 | Bacteria | 4683 |
| 433 | Ga0496117_0098077 | 3300048920 | Bacteria | 1864 |
| 434 | Ga0496118_0003118 | 3300048921 | Bacteria | 21238 |
| 435 | Ga0496118_0004645 | 3300048921 | Bacteria | 16112 |
| 436 | Ga0496118_0006962 | 3300048921 | Bacteria | 12210 |
| 437 | Ga0496118_0015853 | 3300048921 | Bacteria | 6948 |
| 438 | Ga0496118_0019362 | 3300048921 | Bacteria | 6086 |
| 439 | Ga0496119_0001081 | 3300048922 | Bacteria | 34425 |
| 440 | Ga0496119_0014335 | 3300048922 | Bacteria | 6214 |
| 441 | Ga0496120_0001250 | 3300048923 | Bacteria | 31970 |
| 442 | Ga0496120_0001337 | 3300048923 | Bacteria | 30388 |
| 443 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 444 | Ga0496121_0000743 | 3300048924 | Bacteria | 59998 |
| 445 | Ga0496121_0037519 | 3300048924 | Bacteria | 4303 |
| 446 | Ga0496121_0131079 | 3300048924 | Bacteria | 1876 |
| 447 | Ga0496121_0315768 | 3300048924 | Bacteria | 1054 |
| 448 | Ga0496122_0000374 | 3300048925 | Bacteria | 96140 |
| 449 | Ga0496122_0025528 | 3300048925 | Bacteria | 5128 |
| 450 | Ga0496122_0186607 | 3300048925 | Bacteria | 1229 |
| 451 | Ga0496123_0001233 | 3300048926 | Bacteria | 37229 |
| 452 | Ga0496123_0039389 | 3300048926 | Bacteria | 3307 |
| 453 | Ga0496124_0022699 | 3300048927 | Bacteria | 5746 |
| 454 | Ga0496124_0142336 | 3300048927 | Bacteria | 1891 |
| 455 | Ga0496125_0015635 | 3300048928 | Bacteria | 7323 |
| 456 | Ga0496125_0043076 | 3300048928 | Bacteria | 3837 |
| 457 | Ga0496126_0000169 | 3300048929 | Bacteria | 150322 |
| 458 | Ga0496126_0003516 | 3300048929 | Bacteria | 19717 |
| 459 | Ga0496126_0010323 | 3300048929 | Bacteria | 9803 |
| 460 | Ga0496126_0072018 | 3300048929 | Bacteria | 3075 |
| 461 | Ga0496126_0091306 | 3300048929 | Bacteria | 2678 |
| 462 | Ga0496126_0176597 | 3300048929 | Bacteria | 1816 |
| 463 | Ga0495682_0048565 | 3300049460 | Bacteria | 1547 |
| 464 | Ga0501031_0001179 | 3300049568 | Bacteria | 15915 |
| 465 | Ga0501031_0091146 | 3300049568 | Bacteria | 1988 |
| 466 | Ga0501031_0168800 | 3300049568 | Bacteria | 1430 |
| 467 | Ga0501032_0008047 | 3300049569 | Bacteria | 7685 |
| 468 | Ga0501032_0127980 | 3300049569 | Bacteria | 1677 |
| 469 | Ga0501033_0006957 | 3300049570 | Bacteria | 8831 |
| 470 | Ga0501033_0040160 | 3300049570 | Bacteria | 3493 |
| 471 | Ga0501033_0081765 | 3300049570 | Bacteria | 2369 |
| 472 | Ga0501033_0168701 | 3300049570 | Bacteria | 1572 |
| 473 | Ga0501034_0000091 | 3300049571 | Bacteria | 164456 |
| 474 | Ga0501034_0002029 | 3300049571 | Bacteria | 25488 |
| 475 | Ga0501034_0010969 | 3300049571 | Bacteria | 9412 |
| 476 | Ga0501034_0031976 | 3300049571 | Bacteria | 5345 |
| 477 | Ga0501034_0070728 | 3300049571 | Bacteria | 3500 |
| 478 | Ga0501036_0010107 | 3300049572 | Bacteria | 7779 |
| 479 | Ga0501036_0077353 | 3300049572 | Bacteria | 2815 |
| 480 | Ga0501036_0206056 | 3300049572 | Bacteria | 1653 |
| 481 | Ga0501037_0014206 | 3300049573 | Bacteria | 5863 |
| 482 | Ga0501037_0037219 | 3300049573 | Bacteria | 3587 |
| 483 | Ga0501037_0054282 | 3300049573 | Bacteria | 2930 |
| 484 | Ga0501037_0157137 | 3300049573 | Bacteria | 1622 |
| 485 | Ga0501038_0017649 | 3300049574 | Bacteria | 6450 |
| 486 | Ga0501038_0078887 | 3300049574 | Bacteria | 2777 |
| 487 | Ga0501043_0002924 | 3300049579 | Bacteria | 14260 |
| 488 | Ga0501043_0018714 | 3300049579 | Bacteria | 5434 |
| 489 | Ga0501043_0031687 | 3300049579 | Bacteria | 4156 |
| 490 | Ga0501043_0091289 | 3300049579 | Bacteria | 2394 |
| 491 | Ga0501043_0289219 | 3300049579 | Bacteria | 1255 |
| 492 | Ga0501046_0006397 | 3300049580 | Bacteria | 10444 |
| 493 | Ga0501046_0078849 | 3300049580 | Bacteria | 2547 |
| 494 | Ga0501047_0001140 | 3300049581 | Bacteria | 26350 |
| 495 | Ga0501047_0009456 | 3300049581 | Bacteria | 9208 |
| 496 | Ga0501047_0015754 | 3300049581 | Bacteria | 7205 |
| 497 | Ga0501047_0041058 | 3300049581 | Bacteria | 4471 |
| 498 | Ga0501047_0042030 | 3300049581 | Bacteria | 4417 |
| 499 | Ga0501047_0082045 | 3300049581 | Bacteria | 3099 |
| 500 | Ga0501048_0018513 | 3300049582 | Bacteria | 5120 |
| 501 | Ga0501068_0157228 | 3300049584 | Bacteria | 1432 |
| 502 | Ga0501068_0202825 | 3300049584 | Bacteria | 1258 |
| 503 | Ga0501069_0012229 | 3300049585 | Bacteria | 4560 |
| 504 | Ga0501069_0060579 | 3300049585 | Bacteria | 2113 |
| 505 | Ga0501070_0000955 | 3300049586 | Bacteria | 26067 |
| 506 | Ga0501070_0004034 | 3300049586 | Bacteria | 12612 |
| 507 | Ga0501070_0009100 | 3300049586 | Bacteria | 8398 |
| 508 | Ga0501070_0017920 | 3300049586 | Bacteria | 5945 |
| 509 | Ga0501070_0018070 | 3300049586 | Bacteria | 5916 |
| 510 | Ga0501070_0027783 | 3300049586 | Bacteria | 4745 |
| 511 | Ga0501070_0050818 | 3300049586 | Bacteria | 3441 |
| 512 | Ga0501070_0090101 | 3300049586 | Bacteria | 2538 |
| 513 | Ga0501071_0006093 | 3300049587 | Bacteria | 7818 |
| 514 | Ga0501073_0009510 | 3300049589 | Bacteria | 7176 |
| 515 | Ga0501073_0052005 | 3300049589 | Bacteria | 2869 |
| 516 | Ga0501073_0072705 | 3300049589 | Bacteria | 2395 |
| 517 | Ga0501074_0014060 | 3300049590 | Bacteria | 5819 |
| 518 | Ga0501074_0014638 | 3300049590 | Bacteria | 5705 |
| 519 | Ga0501074_0105751 | 3300049590 | Bacteria | 2015 |
| 520 | Ga0501076_0430481 | 3300049592 | Bacteria | 1086 |
| 521 | Ga0501077_0008784 | 3300049593 | Bacteria | 6271 |
| 522 | Ga0501225_0010582 | 3300049705 | Bacteria | 2611 |
| 523 | Ga0501079_0123108 | 3300049741 | Bacteria | 2017 |
| 524 | Ga0501080_0002935 | 3300049742 | Bacteria | 14979 |
| 525 | Ga0501080_0004845 | 3300049742 | Bacteria | 11997 |
| 526 | Ga0501080_0019215 | 3300049742 | Bacteria | 6327 |
| 527 | Ga0501080_0028480 | 3300049742 | Bacteria | 5197 |
| 528 | Ga0501080_0049529 | 3300049742 | Bacteria | 3910 |
| 529 | Ga0501080_0051332 | 3300049742 | Bacteria | 3837 |
| 530 | Ga0501035_0001816 | 3300049822 | Bacteria | 21577 |
| 531 | Ga0501035_0001954 | 3300049822 | Bacteria | 20636 |
| 532 | Ga0501035_0002968 | 3300049822 | Bacteria | 16311 |
| 533 | Ga0501035_0013820 | 3300049822 | Bacteria | 7451 |
| 534 | Ga0501035_0023994 | 3300049822 | Bacteria | 5597 |
| 535 | Ga0501035_0042186 | 3300049822 | Bacteria | 4116 |
| 536 | Ga0501035_0064924 | 3300049822 | Bacteria | 3243 |
| 537 | Ga0501035_0179982 | 3300049822 | Bacteria | 1821 |
| 538 | Ga0501044_0017427 | 3300049823 | Bacteria | 7705 |
| 539 | Ga0501044_0020806 | 3300049823 | Bacteria | 7003 |
| 540 | Ga0501044_0036954 | 3300049823 | Bacteria | 5106 |
| 541 | Ga0501044_0044350 | 3300049823 | Bacteria | 4614 |
| 542 | Ga0501044_0086361 | 3300049823 | Bacteria | 3169 |
| 543 | Ga0501044_0097311 | 3300049823 | Bacteria | 2964 |
| 544 | Ga0501044_0101792 | 3300049823 | Bacteria | 2889 |
| 545 | Ga0501044_0131218 | 3300049823 | Bacteria | 2499 |
| 546 | Ga0501044_0153508 | 3300049823 | Bacteria | 2283 |
| 547 | Ga0500620_009766 | 3300053155 | Bacteria | 2492 |
| 548 | Ga0500634_0000051 | 3300053161 | Bacteria | 52447 |
| 549 | Ga0501084_0226009 | 3300054114 | Bacteria | 1579 |
| 550 | Ga0466962_0004383 | 3300061719 | Bacteria | 6768 |
| 551 | Ga0466962_0010142 | 3300061719 | Bacteria | 4524 |
| 552 | Ga0466962_0090676 | 3300061719 | Bacteria | 1464 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053155 | Ga0500620_009766 | Ga0500620_009766_1641_2471 | 271 |
| 2 | 3300005455 | Ga0070663_100000098 | Ga0070663_10000009812 | 289 |
| 3 | 3300026067 | Ga0207678_10003668 | Ga0207678_100036682 | 289 |
| 4 | 3300026089 | Ga0207648_10176343 | Ga0207648_101763432 | 289 |
| 5 | 3300009093 | Ga0105240_10090461 | Ga0105240_100904614 | 296 |
| 6 | 3300013100 | Ga0157373_10026888 | Ga0157373_100268884 | 296 |
| 7 | 3300013102 | Ga0157371_10046887 | Ga0157371_100468872 | 296 |
| 8 | 3300013104 | Ga0157370_10005088 | Ga0157370_1000508811 | 296 |
| 9 | 3300013307 | Ga0157372_10007646 | Ga0157372_100076464 | 296 |
| 10 | 3300005367 | Ga0070667_100000061 | Ga0070667_1000000614 | 297 |
| 11 | 3300005539 | Ga0068853_100032032 | Ga0068853_1000320322 | 297 |
| 12 | 3300009177 | Ga0105248_10000294 | Ga0105248_1000029430 | 297 |
| 13 | 3300025941 | Ga0207711_10000850 | Ga0207711_1000085030 | 297 |
| 14 | 3300025986 | Ga0207658_10000166 | Ga0207658_1000016670 | 297 |
| 15 | 3300026041 | Ga0207639_10014786 | Ga0207639_100147863 | 297 |
| 16 | 3300048925 | Ga0496122_0000374 | Ga0496122_0000374_15852_16805 | 297 |
| 17 | 3300048926 | Ga0496123_0001233 | Ga0496123_0001233_23990_24943 | 297 |
| 18 | 3300048929 | Ga0496126_0091306 | Ga0496126_0091306_205_1158 | 297 |
| 19 | 3300048927 | Ga0496124_0142336 | Ga0496124_0142336_285_1220 | 302 |
| 20 | 3300026067 | Ga0207678_10022074 | Ga0207678_100220742 | 304 |
| 21 | 3300025949 | Ga0207667_10321237 | Ga0207667_103212372 | 306 |
| 22 | 3300009553 | Ga0105249_10036550 | Ga0105249_100365504 | 311 |
| 23 | 3300025961 | Ga0207712_10000339 | Ga0207712_1000033912 | 311 |
| 24 | 3300048929 | Ga0496126_0010323 | Ga0496126_0010323_2914_3849 | 311 |
| 25 | iso_pu_bacteria | 2593339238 | 2595446780 | 311 |
| 26 | iso_pu_bacteria | 2593339239 | 2595449543 | 311 |
| 27 | iso_pu_bacteria | 2842918807 | 2842919854 | 311 |
| 28 | iso_pu_bacteria | 2884338543 | 2884341452 | 311 |
| 29 | iso_pu_bacteria | 2919085039 | 2919088345 | 311 |
| 30 | iso_pu_bacteria | 2919404418 | 2919406072 | 311 |
| 31 | iso_pu_bacteria | 2941471342 | 2941472902 | 311 |
| 32 | 3300005336 | Ga0070680_100001147 | Ga0070680_10000114720 | 312 |
| 33 | 3300005339 | Ga0070660_100019495 | Ga0070660_1000194952 | 312 |
| 34 | 3300005455 | Ga0070663_100006804 | Ga0070663_1000068042 | 312 |
| 35 | 3300005458 | Ga0070681_10000478 | Ga0070681_100004782 | 312 |
| 36 | 3300005530 | Ga0070679_100000159 | Ga0070679_1000001598 | 312 |
| 37 | 3300005546 | Ga0070696_100032241 | Ga0070696_1000322413 | 312 |
| 38 | 3300005578 | Ga0068854_100014236 | Ga0068854_1000142361 | 312 |
| 39 | 3300025912 | Ga0207707_10000032 | Ga0207707_1000003214 | 312 |
| 40 | 3300025913 | Ga0207695_10171773 | Ga0207695_101717732 | 312 |
| 41 | 3300025917 | Ga0207660_10000431 | Ga0207660_1000043116 | 312 |
| 42 | 3300025921 | Ga0207652_10000026 | Ga0207652_1000002614 | 312 |
| 43 | 3300025949 | Ga0207667_10005247 | Ga0207667_1000524717 | 312 |
| 44 | 3300025981 | Ga0207640_10030042 | Ga0207640_100300422 | 312 |
| 45 | 3300026067 | Ga0207678_10011703 | Ga0207678_100117037 | 312 |
| 46 | 3300049570 | Ga0501033_0081765 | Ga0501033_0081765_510_1454 | 312 |
| 47 | 3300049579 | Ga0501043_0289219 | Ga0501043_0289219_107_1051 | 312 |
| 48 | 3300049585 | Ga0501069_0060579 | Ga0501069_0060579_236_1180 | 312 |
| 49 | 3300049586 | Ga0501070_0009100 | Ga0501070_0009100_4189_5133 | 312 |
| 50 | 3300049590 | Ga0501074_0014638 | Ga0501074_0014638_2951_3895 | 312 |
| 51 | 3300049741 | Ga0501079_0123108 | Ga0501079_0123108_940_1884 | 312 |
| 52 | 3300049742 | Ga0501080_0051332 | Ga0501080_0051332_2740_3684 | 312 |
| 53 | 3300049823 | Ga0501044_0020806 | Ga0501044_0020806_3978_4922 | 312 |
| 54 | 3300005327 | Ga0070658_10020563 | Ga0070658_100205632 | 313 |
| 55 | 3300005335 | Ga0070666_10000005 | Ga0070666_10000005104 | 313 |
| 56 | 3300005843 | Ga0068860_100034319 | Ga0068860_1000343192 | 313 |
| 57 | 3300009551 | Ga0105238_10003835 | Ga0105238_1000383516 | 313 |
| 58 | 3300013306 | Ga0163162_10000489 | Ga0163162_1000048912 | 313 |
| 59 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005461 | 313 |
| 60 | 3300025909 | Ga0207705_10010341 | Ga0207705_100103415 | 313 |
| 61 | 3300025924 | Ga0207694_10009159 | Ga0207694_100091597 | 313 |
| 62 | 3300025986 | Ga0207658_10084659 | Ga0207658_100846592 | 313 |
| 63 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041071 | 313 |
| 64 | 3300028381 | Ga0268264_10056756 | Ga0268264_100567563 | 313 |
| 65 | 3300031995 | Ga0307409_100317436 | Ga0307409_1003174362 | 313 |
| 66 | 3300033180 | Ga0307510_10005230 | Ga0307510_100052308 | 313 |
| 67 | 3300033180 | Ga0307510_10021816 | Ga0307510_100218168 | 313 |
| 68 | 3300045836 | Ga0466958_0020369 | Ga0466958_0020369_2179_3120 | 313 |
| 69 | 3300046471 | Ga0495650_0000247 | Ga0495650_0000247_3824_4774 | 313 |
| 70 | 3300046660 | Ga0495625_0005535 | Ga0495625_0005535_4978_5928 | 313 |
| 71 | 3300048924 | Ga0496121_0315768 | Ga0496121_0315768_43_993 | 313 |
| 72 | 3300048928 | Ga0496125_0043076 | Ga0496125_0043076_1776_2726 | 313 |
| 73 | 3300048929 | Ga0496126_0176597 | Ga0496126_0176597_574_1524 | 313 |
| 74 | iso_pu_bacteria | 2643221562 | 2643830300 | 313 |
| 75 | iso_pu_bacteria | 2687453130 | 2687583745 | 313 |
| 76 | iso_pu_bacteria | 2747842501 | 2748016040 | 313 |
| 77 | iso_pu_bacteria | 2857442823 | 2857446159 | 313 |
| 78 | iso_pu_bacteria | 2919130084 | 2919131369 | 313 |
| 79 | iso_pu_bacteria | 2928963466 | 2928967717 | 313 |
| 80 | iso_pu_bacteria | 2929195423 | 2929198212 | 313 |
| 81 | 3300005262 | Ga0065165_1000118 | Ga0065165_10001189 | 314 |
| 82 | 3300005344 | Ga0070661_100122322 | Ga0070661_1001223222 | 314 |
| 83 | 3300005614 | Ga0068856_100004196 | Ga0068856_1000041968 | 314 |
| 84 | 3300005618 | Ga0068864_100022244 | Ga0068864_1000222443 | 314 |
| 85 | 3300005841 | Ga0068863_100046769 | Ga0068863_1000467692 | 314 |
| 86 | 3300010375 | Ga0105239_10067311 | Ga0105239_100673112 | 314 |
| 87 | 3300010375 | Ga0105239_10106232 | Ga0105239_101062322 | 314 |
| 88 | 3300011119 | Ga0105246_10003959 | Ga0105246_100039597 | 314 |
| 89 | 3300013104 | Ga0157370_10000293 | Ga0157370_1000029343 | 314 |
| 90 | 3300013105 | Ga0157369_10012900 | Ga0157369_100129004 | 314 |
| 91 | 3300013296 | Ga0157374_10019015 | Ga0157374_100190151 | 314 |
| 92 | 3300014968 | Ga0157379_10006837 | Ga0157379_100068372 | 314 |
| 93 | 3300015265 | Ga0182005_1000028 | Ga0182005_1000028162 | 314 |
| 94 | 3300015265 | Ga0182005_1004772 | Ga0182005_10047722 | 314 |
| 95 | 3300025226 | Ga0209674_102139 | Ga0209674_1021393 | 314 |
| 96 | 3300025233 | Ga0209437_102166 | Ga0209437_1021663 | 314 |
| 97 | 3300025233 | Ga0209437_103650 | Ga0209437_1036501 | 314 |
| 98 | 3300025254 | Ga0209148_1001285 | Ga0209148_100128513 | 314 |
| 99 | 3300025299 | Ga0209256_1004365 | Ga0209256_10043656 | 314 |
| 100 | 3300025302 | Ga0207426_1011861 | Ga0207426_10118612 | 314 |
| 101 | 3300025904 | Ga0207647_10000747 | Ga0207647_1000074719 | 314 |
| 102 | 3300025920 | Ga0207649_10157664 | Ga0207649_101576642 | 314 |
| 103 | 3300025924 | Ga0207694_10074068 | Ga0207694_100740682 | 314 |
| 104 | 3300026078 | Ga0207702_10008548 | Ga0207702_100085486 | 314 |
| 105 | 3300026088 | Ga0207641_10078202 | Ga0207641_100782023 | 314 |
| 106 | 3300026095 | Ga0207676_10066337 | Ga0207676_100663372 | 314 |
| 107 | 3300031911 | Ga0307412_10003347 | Ga0307412_100033474 | 314 |
| 108 | 3300037312 | Ga0395899_0219217 | Ga0395899_0219217_222_1169 | 314 |
| 109 | 3300037418 | Ga0395900_0007251 | Ga0395900_0007251_8784_9731 | 314 |
| 110 | 3300037466 | Ga0395898_0003336 | Ga0395898_0003336_16607_17554 | 314 |
| 111 | 3300038443 | Ga0395901_0004732 | Ga0395901_0004732_4181_5128 | 314 |
| 112 | 3300038443 | Ga0395901_0005132 | Ga0395901_0005132_5121_6068 | 314 |
| 113 | 3300039437 | Ga0436365_0838762 | Ga0436365_0838762_805_1752 | 314 |
| 114 | 3300041404 | Ga0439436_0000156 | Ga0439436_0000156_5104_6051 | 314 |
| 115 | 3300046492 | Ga0495585_0000104 | Ga0495585_0000104_37551_38498 | 314 |
| 116 | 3300046501 | Ga0495607_0008360 | Ga0495607_0008360_3269_4216 | 314 |
| 117 | 3300046507 | Ga0495606_0005269 | Ga0495606_0005269_9996_10943 | 314 |
| 118 | 3300046512 | Ga0495610_0002689 | Ga0495610_0002689_3877_4824 | 314 |
| 119 | 3300046524 | Ga0495648_0000914 | Ga0495648_0000914_12457_13404 | 314 |
| 120 | 3300046665 | Ga0495661_0000199 | Ga0495661_0000199_61783_62730 | 314 |
| 121 | 3300046691 | Ga0495670_0008599 | Ga0495670_0008599_1528_2475 | 314 |
| 122 | 3300046810 | Ga0495660_0000583 | Ga0495660_0000583_23151_24098 | 314 |
| 123 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_91182_92129 | 314 |
| 124 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_166912_167859 | 314 |
| 125 | 3300048909 | Ga0496106_0007333 | Ga0496106_0007333_3344_4291 | 314 |
| 126 | 3300048918 | Ga0496115_0000073 | Ga0496115_0000073_46230_47180 | 314 |
| 127 | 3300048921 | Ga0496118_0004645 | Ga0496118_0004645_4972_5919 | 314 |
| 128 | 3300048921 | Ga0496118_0019362 | Ga0496118_0019362_67_1014 | 314 |
| 129 | 3300048924 | Ga0496121_0000045 | Ga0496121_0000045_329839_330786 | 314 |
| 130 | 3300048925 | Ga0496122_0186607 | Ga0496122_0186607_171_1118 | 314 |
| 131 | 3300048928 | Ga0496125_0015635 | Ga0496125_0015635_4221_5168 | 314 |
| 132 | 3300048929 | Ga0496126_0000169 | Ga0496126_0000169_55429_56379 | 314 |
| 133 | 3300049569 | Ga0501032_0127980 | Ga0501032_0127980_171_1121 | 314 |
| 134 | 3300049571 | Ga0501034_0002029 | Ga0501034_0002029_1383_2333 | 314 |
| 135 | 3300049573 | Ga0501037_0054282 | Ga0501037_0054282_44_1006 | 314 |
| 136 | 3300049580 | Ga0501046_0078849 | Ga0501046_0078849_806_1756 | 314 |
| 137 | 3300049581 | Ga0501047_0001140 | Ga0501047_0001140_20196_21146 | 314 |
| 138 | 3300049581 | Ga0501047_0015754 | Ga0501047_0015754_2912_3859 | 314 |
| 139 | 3300049581 | Ga0501047_0041058 | Ga0501047_0041058_2282_3244 | 314 |
| 140 | 3300049584 | Ga0501068_0157228 | Ga0501068_0157228_232_1182 | 314 |
| 141 | 3300049586 | Ga0501070_0004034 | Ga0501070_0004034_233_1183 | 314 |
| 142 | 3300049586 | Ga0501070_0017920 | Ga0501070_0017920_3510_4472 | 314 |
| 143 | 3300049587 | Ga0501071_0006093 | Ga0501071_0006093_254_1216 | 314 |
| 144 | 3300049590 | Ga0501074_0014060 | Ga0501074_0014060_3108_4070 | 314 |
| 145 | 3300049592 | Ga0501076_0430481 | Ga0501076_0430481_25_987 | 314 |
| 146 | 3300049742 | Ga0501080_0002935 | Ga0501080_0002935_10989_11939 | 314 |
| 147 | 3300049742 | Ga0501080_0019215 | Ga0501080_0019215_1082_2044 | 314 |
| 148 | 3300049822 | Ga0501035_0179982 | Ga0501035_0179982_281_1243 | 314 |
| 149 | 3300049823 | Ga0501044_0036954 | Ga0501044_0036954_1889_2851 | 314 |
| 150 | 3300054114 | Ga0501084_0226009 | Ga0501084_0226009_21_965 | 314 |
| 151 | iso_pu_bacteria | 2739367700 | 2739730279 | 314 |
| 152 | iso_pu_bacteria | 2818991440 | 2819563934 | 314 |
| 153 | iso_pu_bacteria | 2842780639 | 2842783844 | 314 |
| 154 | iso_pu_bacteria | 2884411467 | 2884412122 | 314 |
| 155 | iso_pu_bacteria | 2904463128 | 2904464570 | 314 |
| 156 | 3300003316 | rootH1_10025459 | rootH1_100254594 | 315 |
| 157 | 3300013307 | Ga0157372_10056190 | Ga0157372_100561903 | 315 |
| 158 | 3300014325 | Ga0163163_10443403 | Ga0163163_104434032 | 315 |
| 159 | 3300020081 | Ga0206354_10560480 | Ga0206354_105604802 | 315 |
| 160 | 3300032004 | Ga0307414_10008972 | Ga0307414_100089723 | 315 |
| 161 | 3300037466 | Ga0395898_0012224 | Ga0395898_0012224_2367_3317 | 315 |
| 162 | 3300038443 | Ga0395901_0194078 | Ga0395901_0194078_547_1497 | 315 |
| 163 | 3300049581 | Ga0501047_0009456 | Ga0501047_0009456_7986_8942 | 315 |
| 164 | 3300049585 | Ga0501069_0012229 | Ga0501069_0012229_2935_3891 | 315 |
| 165 | 3300049586 | Ga0501070_0018070 | Ga0501070_0018070_3073_4029 | 315 |
| 166 | 3300049586 | Ga0501070_0027783 | Ga0501070_0027783_3674_4630 | 315 |
| 167 | 3300049586 | Ga0501070_0050818 | Ga0501070_0050818_1775_2731 | 315 |
| 168 | 3300049586 | Ga0501070_0090101 | Ga0501070_0090101_414_1370 | 315 |
| 169 | 3300049589 | Ga0501073_0052005 | Ga0501073_0052005_1813_2769 | 315 |
| 170 | 3300049742 | Ga0501080_0004845 | Ga0501080_0004845_2947_3903 | 315 |
| 171 | 3300049822 | Ga0501035_0001954 | Ga0501035_0001954_3054_4013 | 315 |
| 172 | 3300049822 | Ga0501035_0013820 | Ga0501035_0013820_3323_4279 | 315 |
| 173 | 3300049823 | Ga0501044_0044350 | Ga0501044_0044350_1120_2076 | 315 |
| 174 | iso_pu_bacteria | 8002869464 | 8002872338 | 315 |
| 175 | 3300001915 | JGI24741J21665_1004716 | JGI24741J21665_10047163 | 316 |
| 176 | 3300001979 | JGI24740J21852_10003993 | JGI24740J21852_100039934 | 316 |
| 177 | 3300002705 | JGI25156J39149_1000463 | JGI25156J39149_100046324 | 316 |
| 178 | 3300002705 | JGI25156J39149_1013976 | JGI25156J39149_10139762 | 316 |
| 179 | 3300002737 | JGI25162J39368_1000895 | JGI25162J39368_100089519 | 316 |
| 180 | 3300002737 | JGI25162J39368_1001410 | JGI25162J39368_10014109 | 316 |
| 181 | 3300002741 | JGI25157J39369_1000229 | JGI25157J39369_100022926 | 316 |
| 182 | 3300002741 | JGI25157J39369_1004101 | JGI25157J39369_10041011 | 316 |
| 183 | 3300002772 | JGI25164J39214_1000045 | JGI25164J39214_100004568 | 316 |
| 184 | 3300003214 | JGI25165J46597_1000072 | JGI25165J46597_100007268 | 316 |
| 185 | 3300003760 | Ga0055527_1001498 | Ga0055527_10014984 | 316 |
| 186 | 3300003761 | Ga0055535_1000831 | Ga0055535_100083117 | 316 |
| 187 | 3300003762 | Ga0055542_1000242 | Ga0055542_10002429 | 316 |
| 188 | 3300003762 | Ga0055542_1000349 | Ga0055542_100034941 | 316 |
| 189 | 3300003763 | Ga0055529_1000204 | Ga0055529_100020425 | 316 |
| 190 | 3300003856 | Ga0058692_1000012 | Ga0058692_100001298 | 316 |
| 191 | 3300005337 | Ga0070682_100005899 | Ga0070682_1000058996 | 316 |
| 192 | 3300005347 | Ga0070668_100269442 | Ga0070668_1002694422 | 316 |
| 193 | 3300005455 | Ga0070663_100230760 | Ga0070663_1002307602 | 316 |
| 194 | 3300005457 | Ga0070662_100015623 | Ga0070662_1000156233 | 316 |
| 195 | 3300005535 | Ga0070684_100015112 | Ga0070684_1000151126 | 316 |
| 196 | 3300005539 | Ga0068853_100249431 | Ga0068853_1002494311 | 316 |
| 197 | 3300005546 | Ga0070696_100021589 | Ga0070696_1000215893 | 316 |
| 198 | 3300005578 | Ga0068854_100135998 | Ga0068854_1001359982 | 316 |
| 199 | 3300005614 | Ga0068856_100030189 | Ga0068856_1000301892 | 316 |
| 200 | 3300005616 | Ga0068852_100103211 | Ga0068852_1001032112 | 316 |
| 201 | 3300005834 | Ga0068851_10013971 | Ga0068851_100139712 | 316 |
| 202 | 3300009093 | Ga0105240_10381373 | Ga0105240_103813732 | 316 |
| 203 | 3300009174 | Ga0105241_10273475 | Ga0105241_102734752 | 316 |
| 204 | 3300009545 | Ga0105237_10000007 | Ga0105237_10000007134 | 316 |
| 205 | 3300009545 | Ga0105237_10000637 | Ga0105237_100006373 | 316 |
| 206 | 3300009551 | Ga0105238_10054370 | Ga0105238_100543703 | 316 |
| 207 | 3300009551 | Ga0105238_10073353 | Ga0105238_100733532 | 316 |
| 208 | 3300009551 | Ga0105238_10210926 | Ga0105238_102109261 | 316 |
| 209 | 3300009553 | Ga0105249_10000272 | Ga0105249_1000027244 | 316 |
| 210 | 3300013104 | Ga0157370_10007298 | Ga0157370_100072989 | 316 |
| 211 | 3300013308 | Ga0157375_10014055 | Ga0157375_100140554 | 316 |
| 212 | 3300015685 | Ga0183369_1007 | Ga0183369_1007401 | 316 |
| 213 | 3300017792 | Ga0163161_10086921 | Ga0163161_100869213 | 316 |
| 214 | 3300020610 | Ga0154015_1237743 | Ga0154015_12377432 | 316 |
| 215 | 3300025228 | Ga0209672_100277 | Ga0209672_10027723 | 316 |
| 216 | 3300025231 | Ga0207427_100055 | Ga0207427_100055143 | 316 |
| 217 | 3300025231 | Ga0207427_103884 | Ga0207427_1038843 | 316 |
| 218 | 3300025233 | Ga0209437_100161 | Ga0209437_10016186 | 316 |
| 219 | 3300025233 | Ga0209437_100224 | Ga0209437_10022420 | 316 |
| 220 | 3300025242 | Ga0209258_100186 | Ga0209258_10018658 | 316 |
| 221 | 3300025246 | Ga0209646_1000760 | Ga0209646_100076010 | 316 |
| 222 | 3300025250 | Ga0209026_1000375 | Ga0209026_100037511 | 316 |
| 223 | 3300025250 | Ga0209026_1001302 | Ga0209026_10013023 | 316 |
| 224 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005966 | 316 |
| 225 | 3300025254 | Ga0209148_1000073 | Ga0209148_100007384 | 316 |
| 226 | 3300025256 | Ga0209759_1000103 | Ga0209759_100010387 | 316 |
| 227 | 3300025256 | Ga0209759_1013336 | Ga0209759_10133362 | 316 |
| 228 | 3300025261 | Ga0209233_1000063 | Ga0209233_1000063293 | 316 |
| 229 | 3300025272 | Ga0209455_1000177 | Ga0209455_100017758 | 316 |
| 230 | 3300025272 | Ga0209455_1000344 | Ga0209455_100034410 | 316 |
| 231 | 3300025321 | Ga0207656_10046545 | Ga0207656_100465452 | 316 |
| 232 | 3300025904 | Ga0207647_10000084 | Ga0207647_1000008432 | 316 |
| 233 | 3300025909 | Ga0207705_10008538 | Ga0207705_100085383 | 316 |
| 234 | 3300025909 | Ga0207705_10015167 | Ga0207705_100151674 | 316 |
| 235 | 3300025911 | Ga0207654_10004928 | Ga0207654_100049284 | 316 |
| 236 | 3300025912 | Ga0207707_10002692 | Ga0207707_100026928 | 316 |
| 237 | 3300025913 | Ga0207695_10003349 | Ga0207695_1000334911 | 316 |
| 238 | 3300025913 | Ga0207695_10019259 | Ga0207695_100192597 | 316 |
| 239 | 3300025914 | Ga0207671_10000074 | Ga0207671_10000074123 | 316 |
| 240 | 3300025914 | Ga0207671_10009987 | Ga0207671_100099874 | 316 |
| 241 | 3300025917 | Ga0207660_10002224 | Ga0207660_100022245 | 316 |
| 242 | 3300025919 | Ga0207657_10001633 | Ga0207657_1000163313 | 316 |
| 243 | 3300025920 | Ga0207649_10008395 | Ga0207649_100083952 | 316 |
| 244 | 3300025924 | Ga0207694_10011255 | Ga0207694_100112556 | 316 |
| 245 | 3300025924 | Ga0207694_10098035 | Ga0207694_100980352 | 316 |
| 246 | 3300025924 | Ga0207694_10332149 | Ga0207694_103321491 | 316 |
| 247 | 3300025925 | Ga0207650_10169429 | Ga0207650_101694292 | 316 |
| 248 | 3300025933 | Ga0207706_10026570 | Ga0207706_100265703 | 316 |
| 249 | 3300025944 | Ga0207661_10174231 | Ga0207661_101742312 | 316 |
| 250 | 3300025949 | Ga0207667_10011214 | Ga0207667_100112142 | 316 |
| 251 | 3300025961 | Ga0207712_10001053 | Ga0207712_100010534 | 316 |
| 252 | 3300025972 | Ga0207668_10204173 | Ga0207668_102041732 | 316 |
| 253 | 3300025981 | Ga0207640_10006105 | Ga0207640_100061051 | 316 |
| 254 | 3300025981 | Ga0207640_10113448 | Ga0207640_101134482 | 316 |
| 255 | 3300026067 | Ga0207678_10002211 | Ga0207678_1000221113 | 316 |
| 256 | 3300026067 | Ga0207678_10111048 | Ga0207678_101110482 | 316 |
| 257 | 3300026116 | Ga0207674_10002798 | Ga0207674_1000279810 | 316 |
| 258 | 3300026142 | Ga0207698_10100907 | Ga0207698_101009072 | 316 |
| 259 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007292 | 316 |
| 260 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008658 | 316 |
| 261 | 3300031730 | Ga0307516_10106044 | Ga0307516_101060443 | 316 |
| 262 | 3300031911 | Ga0307412_10100670 | Ga0307412_101006701 | 316 |
| 263 | 3300037312 | Ga0395899_0085820 | Ga0395899_0085820_1300_2253 | 316 |
| 264 | 3300037418 | Ga0395900_0047569 | Ga0395900_0047569_3442_4395 | 316 |
| 265 | 3300037466 | Ga0395898_0000049 | Ga0395898_0000049_216015_216968 | 316 |
| 266 | 3300038443 | Ga0395901_0010230 | Ga0395901_0010230_463_1416 | 316 |
| 267 | 3300038443 | Ga0395901_0165825 | Ga0395901_0165825_149_1102 | 316 |
| 268 | 3300041459 | Ga0451800_0027863 | Ga0451800_0027863_636_1589 | 316 |
| 269 | 3300041459 | Ga0451800_0163290 | Ga0451800_0163290_2829_3782 | 316 |
| 270 | 3300041462 | Ga0451806_619891 | Ga0451806_619891_1280_2233 | 316 |
| 271 | 3300041463 | Ga0451804_0794885 | Ga0451804_0794885_1344_2297 | 316 |
| 272 | 3300041486 | Ga0451807_1039361 | Ga0451807_1039361_3936_4889 | 316 |
| 273 | 3300041512 | Ga0451853_2514762 | Ga0451853_2514762_176_1129 | 316 |
| 274 | 3300042438 | Ga0439459_0006387 | Ga0439459_0006387_618_1568 | 316 |
| 275 | 3300044693 | Ga0466961_0004179 | Ga0466961_0004179_4777_5736 | 316 |
| 276 | 3300044694 | Ga0466963_0162984 | Ga0466963_0162984_146_1099 | 316 |
| 277 | 3300046453 | Ga0495627_025570 | Ga0495627_025570_66_1019 | 316 |
| 278 | 3300046558 | Ga0495633_0032712 | Ga0495633_0032712_42_995 | 316 |
| 279 | 3300048920 | Ga0496117_0098077 | Ga0496117_0098077_120_1073 | 316 |
| 280 | 3300048921 | Ga0496118_0015853 | Ga0496118_0015853_5930_6883 | 316 |
| 281 | 3300048927 | Ga0496124_0022699 | Ga0496124_0022699_821_1774 | 316 |
| 282 | 3300049705 | Ga0501225_0010582 | Ga0501225_0010582_157_1107 | 316 |
| 283 | 3300053161 | Ga0500634_0000051 | Ga0500634_0000051_15366_16319 | 316 |
| 284 | iso_pu_bacteria | 2537561836 | 2538832291 | 316 |
| 285 | iso_pu_bacteria | 2643221579 | 2643908028 | 316 |
| 286 | iso_pu_bacteria | 2643221581 | 2643915770 | 316 |
| 287 | iso_pu_bacteria | 2895498888 | 2895498956 | 316 |
| 288 | iso_pu_bacteria | 2895511927 | 2895511995 | 316 |
| 289 | iso_pu_bacteria | 2895522137 | 2895524939 | 316 |
| 290 | iso_pu_bacteria | 2895525241 | 2895527938 | 316 |
| 291 | iso_pu_bacteria | 2923516293 | 2923518677 | 316 |
| 292 | 3300001990 | JGI24737J22298_10009376 | JGI24737J22298_100093762 | 317 |
| 293 | 3300002067 | JGI24735J21928_10002797 | JGI24735J21928_100027973 | 317 |
| 294 | 3300002705 | JGI25156J39149_1013681 | JGI25156J39149_10136811 | 317 |
| 295 | 3300002737 | JGI25162J39368_1000163 | JGI25162J39368_100016352 | 317 |
| 296 | 3300002741 | JGI25157J39369_1000575 | JGI25157J39369_100057514 | 317 |
| 297 | 3300002771 | JGI25163J39215_1000538 | JGI25163J39215_100053810 | 317 |
| 298 | 3300002772 | JGI25164J39214_1000285 | JGI25164J39214_100028513 | 317 |
| 299 | 3300003214 | JGI25165J46597_1000215 | JGI25165J46597_100021526 | 317 |
| 300 | 3300003320 | rootH2_10012587 | rootH2_100125873 | 317 |
| 301 | 3300003751 | Ga0055538_1001046 | Ga0055538_10010466 | 317 |
| 302 | 3300003761 | Ga0055535_1000124 | Ga0055535_100012426 | 317 |
| 303 | 3300003761 | Ga0055535_1008706 | Ga0055535_10087062 | 317 |
| 304 | 3300003762 | Ga0055542_1000197 | Ga0055542_100019726 | 317 |
| 305 | 3300003763 | Ga0055529_1000197 | Ga0055529_100019756 | 317 |
| 306 | 3300005327 | Ga0070658_10094950 | Ga0070658_100949502 | 317 |
| 307 | 3300005336 | Ga0070680_100101701 | Ga0070680_1001017012 | 317 |
| 308 | 3300005339 | Ga0070660_100010300 | Ga0070660_1000103005 | 317 |
| 309 | 3300005355 | Ga0070671_100313027 | Ga0070671_1003130272 | 317 |
| 310 | 3300005366 | Ga0070659_100359423 | Ga0070659_1003594231 | 317 |
| 311 | 3300005367 | Ga0070667_100130011 | Ga0070667_1001300112 | 317 |
| 312 | 3300005455 | Ga0070663_100217132 | Ga0070663_1002171322 | 317 |
| 313 | 3300005458 | Ga0070681_10006071 | Ga0070681_1000607111 | 317 |
| 314 | 3300005458 | Ga0070681_10008891 | Ga0070681_100088913 | 317 |
| 315 | 3300005458 | Ga0070681_10051954 | Ga0070681_100519543 | 317 |
| 316 | 3300005458 | Ga0070681_10151614 | Ga0070681_101516142 | 317 |
| 317 | 3300005530 | Ga0070679_100005521 | Ga0070679_10000552111 | 317 |
| 318 | 3300005539 | Ga0068853_100000998 | Ga0068853_1000009982 | 317 |
| 319 | 3300005546 | Ga0070696_100013121 | Ga0070696_1000131214 | 317 |
| 320 | 3300005546 | Ga0070696_100019136 | Ga0070696_1000191363 | 317 |
| 321 | 3300005547 | Ga0070693_100024182 | Ga0070693_1000241822 | 317 |
| 322 | 3300005563 | Ga0068855_100054823 | Ga0068855_1000548232 | 317 |
| 323 | 3300005577 | Ga0068857_100046007 | Ga0068857_1000460072 | 317 |
| 324 | 3300005841 | Ga0068863_100040023 | Ga0068863_1000400233 | 317 |
| 325 | 3300009093 | Ga0105240_10008662 | Ga0105240_1000866211 | 317 |
| 326 | 3300009093 | Ga0105240_10028816 | Ga0105240_100288162 | 317 |
| 327 | 3300009174 | Ga0105241_10358131 | Ga0105241_103581312 | 317 |
| 328 | 3300010375 | Ga0105239_10000030 | Ga0105239_10000030145 | 317 |
| 329 | 3300010375 | Ga0105239_10039254 | Ga0105239_100392544 | 317 |
| 330 | 3300010375 | Ga0105239_10065148 | Ga0105239_100651482 | 317 |
| 331 | 3300013100 | Ga0157373_10248043 | Ga0157373_102480432 | 317 |
| 332 | 3300013104 | Ga0157370_10167371 | Ga0157370_101673712 | 317 |
| 333 | 3300013307 | Ga0157372_10011205 | Ga0157372_100112057 | 317 |
| 334 | 3300013307 | Ga0157372_10505534 | Ga0157372_105055341 | 317 |
| 335 | 3300014497 | Ga0182008_10033442 | Ga0182008_100334422 | 317 |
| 336 | 3300014969 | Ga0157376_10038489 | Ga0157376_100384894 | 317 |
| 337 | 3300015687 | Ga0183368_1003 | Ga0183368_1003746 | 317 |
| 338 | 3300025206 | Ga0209435_102200 | Ga0209435_1022002 | 317 |
| 339 | 3300025206 | Ga0209435_108134 | Ga0209435_1081342 | 317 |
| 340 | 3300025224 | Ga0209784_100120 | Ga0209784_10012024 | 317 |
| 341 | 3300025226 | Ga0209674_100012 | Ga0209674_100012497 | 317 |
| 342 | 3300025228 | Ga0209672_100911 | Ga0209672_1009116 | 317 |
| 343 | 3300025231 | Ga0207427_100013 | Ga0207427_100013512 | 317 |
| 344 | 3300025233 | Ga0209437_100015 | Ga0209437_10001524 | 317 |
| 345 | 3300025242 | Ga0209258_100049 | Ga0209258_100049131 | 317 |
| 346 | 3300025242 | Ga0209258_103422 | Ga0209258_1034222 | 317 |
| 347 | 3300025246 | Ga0209646_1000467 | Ga0209646_100046712 | 317 |
| 348 | 3300025250 | Ga0209026_1000204 | Ga0209026_100020424 | 317 |
| 349 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010889 | 317 |
| 350 | 3300025256 | Ga0209759_1000672 | Ga0209759_100067224 | 317 |
| 351 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009281 | 317 |
| 352 | 3300025261 | Ga0209233_1011780 | Ga0209233_10117802 | 317 |
| 353 | 3300025272 | Ga0209455_1000082 | Ga0209455_100008224 | 317 |
| 354 | 3300025272 | Ga0209455_1006368 | Ga0209455_10063682 | 317 |
| 355 | 3300025904 | Ga0207647_10010317 | Ga0207647_100103174 | 317 |
| 356 | 3300025909 | Ga0207705_10074272 | Ga0207705_100742722 | 317 |
| 357 | 3300025909 | Ga0207705_10081318 | Ga0207705_100813181 | 317 |
| 358 | 3300025912 | Ga0207707_10003858 | Ga0207707_1000385811 | 317 |
| 359 | 3300025912 | Ga0207707_10011681 | Ga0207707_100116817 | 317 |
| 360 | 3300025912 | Ga0207707_10058093 | Ga0207707_100580932 | 317 |
| 361 | 3300025913 | Ga0207695_10001749 | Ga0207695_1000174925 | 317 |
| 362 | 3300025913 | Ga0207695_10004269 | Ga0207695_100042697 | 317 |
| 363 | 3300025917 | Ga0207660_10045926 | Ga0207660_100459263 | 317 |
| 364 | 3300025917 | Ga0207660_10187936 | Ga0207660_101879362 | 317 |
| 365 | 3300025921 | Ga0207652_10005288 | Ga0207652_100052889 | 317 |
| 366 | 3300025932 | Ga0207690_10001160 | Ga0207690_1000116014 | 317 |
| 367 | 3300025949 | Ga0207667_10251913 | Ga0207667_102519132 | 317 |
| 368 | 3300025961 | Ga0207712_10026904 | Ga0207712_100269043 | 317 |
| 369 | 3300025981 | Ga0207640_10031945 | Ga0207640_100319452 | 317 |
| 370 | 3300026041 | Ga0207639_10012112 | Ga0207639_100121122 | 317 |
| 371 | 3300026041 | Ga0207639_10022813 | Ga0207639_100228134 | 317 |
| 372 | 3300026067 | Ga0207678_10120294 | Ga0207678_101202942 | 317 |
| 373 | 3300026088 | Ga0207641_10064929 | Ga0207641_100649293 | 317 |
| 374 | 3300026116 | Ga0207674_10018482 | Ga0207674_100184825 | 317 |
| 375 | 3300026116 | Ga0207674_10054334 | Ga0207674_100543342 | 317 |
| 376 | 3300026116 | Ga0207674_10105380 | Ga0207674_101053802 | 317 |
| 377 | 3300026142 | Ga0207698_10002926 | Ga0207698_100029269 | 317 |
| 378 | 3300032005 | Ga0307411_10075577 | Ga0307411_100755772 | 317 |
| 379 | 3300037312 | Ga0395899_0016207 | Ga0395899_0016207_2880_3851 | 317 |
| 380 | 3300037418 | Ga0395900_0005984 | Ga0395900_0005984_7858_8829 | 317 |
| 381 | 3300037418 | Ga0395900_0008909 | Ga0395900_0008909_9264_10217 | 317 |
| 382 | 3300037466 | Ga0395898_0004927 | Ga0395898_0004927_5955_6926 | 317 |
| 383 | 3300038443 | Ga0395901_0009707 | Ga0395901_0009707_1938_2894 | 317 |
| 384 | 3300046460 | Ga0495638_0000234 | Ga0495638_0000234_51775_52731 | 317 |
| 385 | 3300046507 | Ga0495606_0000401 | Ga0495606_0000401_59309_60265 | 317 |
| 386 | 3300046557 | Ga0495622_0006636 | Ga0495622_0006636_675_1631 | 317 |
| 387 | 3300046660 | Ga0495625_0016176 | Ga0495625_0016176_1582_2538 | 317 |
| 388 | 3300046694 | Ga0495649_0000553 | Ga0495649_0000553_8414_9370 | 317 |
| 389 | 3300048903 | Ga0496100_0115146 | Ga0496100_0115146_877_1833 | 317 |
| 390 | 3300048907 | Ga0496104_0030305 | Ga0496104_0030305_2393_3349 | 317 |
| 391 | 3300048908 | Ga0496105_0003042 | Ga0496105_0003042_2952_3908 | 317 |
| 392 | 3300048909 | Ga0496106_0111966 | Ga0496106_0111966_469_1425 | 317 |
| 393 | 3300048910 | Ga0496107_0094468 | Ga0496107_0094468_483_1439 | 317 |
| 394 | 3300048911 | Ga0496108_0158003 | Ga0496108_0158003_804_1790 | 317 |
| 395 | 3300048916 | Ga0496113_0014146 | Ga0496113_0014146_272_1228 | 317 |
| 396 | 3300048916 | Ga0496113_0193342 | Ga0496113_0193342_192_1178 | 317 |
| 397 | 3300048918 | Ga0496115_0000206 | Ga0496115_0000206_12009_12965 | 317 |
| 398 | 3300048918 | Ga0496115_0000946 | Ga0496115_0000946_9641_10597 | 317 |
| 399 | 3300048920 | Ga0496117_0008476 | Ga0496117_0008476_7378_8334 | 317 |
| 400 | 3300048920 | Ga0496117_0022641 | Ga0496117_0022641_1426_2382 | 317 |
| 401 | 3300048920 | Ga0496117_0025189 | Ga0496117_0025189_1014_1970 | 317 |
| 402 | 3300048921 | Ga0496118_0003118 | Ga0496118_0003118_10928_11884 | 317 |
| 403 | 3300048921 | Ga0496118_0006962 | Ga0496118_0006962_1190_2146 | 317 |
| 404 | 3300048922 | Ga0496119_0001081 | Ga0496119_0001081_8470_9426 | 317 |
| 405 | 3300048922 | Ga0496119_0014335 | Ga0496119_0014335_4526_5482 | 317 |
| 406 | 3300048923 | Ga0496120_0001250 | Ga0496120_0001250_25029_25985 | 317 |
| 407 | 3300048923 | Ga0496120_0001337 | Ga0496120_0001337_23390_24346 | 317 |
| 408 | 3300048924 | Ga0496121_0000743 | Ga0496121_0000743_28763_29719 | 317 |
| 409 | 3300048924 | Ga0496121_0037519 | Ga0496121_0037519_1989_2945 | 317 |
| 410 | 3300048924 | Ga0496121_0131079 | Ga0496121_0131079_764_1720 | 317 |
| 411 | 3300048929 | Ga0496126_0003516 | Ga0496126_0003516_12783_13739 | 317 |
| 412 | 3300048929 | Ga0496126_0072018 | Ga0496126_0072018_1300_2256 | 317 |
| 413 | 3300049460 | Ga0495682_0048565 | Ga0495682_0048565_125_1081 | 317 |
| 414 | 3300049568 | Ga0501031_0001179 | Ga0501031_0001179_9412_10392 | 317 |
| 415 | 3300049568 | Ga0501031_0091146 | Ga0501031_0091146_250_1215 | 317 |
| 416 | 3300049568 | Ga0501031_0168800 | Ga0501031_0168800_31_996 | 317 |
| 417 | 3300049569 | Ga0501032_0008047 | Ga0501032_0008047_3029_4009 | 317 |
| 418 | 3300049570 | Ga0501033_0006957 | Ga0501033_0006957_5675_6655 | 317 |
| 419 | 3300049570 | Ga0501033_0040160 | Ga0501033_0040160_598_1566 | 317 |
| 420 | 3300049570 | Ga0501033_0168701 | Ga0501033_0168701_420_1388 | 317 |
| 421 | 3300049571 | Ga0501034_0000091 | Ga0501034_0000091_18839_19792 | 317 |
| 422 | 3300049571 | Ga0501034_0010969 | Ga0501034_0010969_3830_4810 | 317 |
| 423 | 3300049571 | Ga0501034_0031976 | Ga0501034_0031976_501_1466 | 317 |
| 424 | 3300049571 | Ga0501034_0070728 | Ga0501034_0070728_1757_2722 | 317 |
| 425 | 3300049572 | Ga0501036_0010107 | Ga0501036_0010107_3861_4841 | 317 |
| 426 | 3300049572 | Ga0501036_0077353 | Ga0501036_0077353_1123_2091 | 317 |
| 427 | 3300049572 | Ga0501036_0206056 | Ga0501036_0206056_556_1521 | 317 |
| 428 | 3300049573 | Ga0501037_0014206 | Ga0501037_0014206_1313_2293 | 317 |
| 429 | 3300049573 | Ga0501037_0037219 | Ga0501037_0037219_2156_3121 | 317 |
| 430 | 3300049573 | Ga0501037_0157137 | Ga0501037_0157137_117_1085 | 317 |
| 431 | 3300049574 | Ga0501038_0017649 | Ga0501038_0017649_3054_4034 | 317 |
| 432 | 3300049574 | Ga0501038_0078887 | Ga0501038_0078887_1510_2478 | 317 |
| 433 | 3300049579 | Ga0501043_0002924 | Ga0501043_0002924_10163_11143 | 317 |
| 434 | 3300049579 | Ga0501043_0018714 | Ga0501043_0018714_3025_3993 | 317 |
| 435 | 3300049579 | Ga0501043_0031687 | Ga0501043_0031687_319_1284 | 317 |
| 436 | 3300049579 | Ga0501043_0091289 | Ga0501043_0091289_1227_2195 | 317 |
| 437 | 3300049580 | Ga0501046_0006397 | Ga0501046_0006397_5966_6946 | 317 |
| 438 | 3300049581 | Ga0501047_0042030 | Ga0501047_0042030_2022_3002 | 317 |
| 439 | 3300049581 | Ga0501047_0082045 | Ga0501047_0082045_1244_2209 | 317 |
| 440 | 3300049584 | Ga0501068_0202825 | Ga0501068_0202825_119_1099 | 317 |
| 441 | 3300049586 | Ga0501070_0000955 | Ga0501070_0000955_5682_6668 | 317 |
| 442 | 3300049589 | Ga0501073_0009510 | Ga0501073_0009510_4306_5286 | 317 |
| 443 | 3300049589 | Ga0501073_0072705 | Ga0501073_0072705_1295_2263 | 317 |
| 444 | 3300049590 | Ga0501074_0105751 | Ga0501074_0105751_134_1120 | 317 |
| 445 | 3300049593 | Ga0501077_0008784 | Ga0501077_0008784_2462_3448 | 317 |
| 446 | 3300049742 | Ga0501080_0028480 | Ga0501080_0028480_687_1667 | 317 |
| 447 | 3300049742 | Ga0501080_0049529 | Ga0501080_0049529_503_1459 | 317 |
| 448 | 3300049822 | Ga0501035_0001816 | Ga0501035_0001816_14407_15372 | 317 |
| 449 | 3300049822 | Ga0501035_0002968 | Ga0501035_0002968_9726_10706 | 317 |
| 450 | 3300049822 | Ga0501035_0023994 | Ga0501035_0023994_4356_5321 | 317 |
| 451 | 3300049822 | Ga0501035_0064924 | Ga0501035_0064924_2041_3009 | 317 |
| 452 | 3300049823 | Ga0501044_0017427 | Ga0501044_0017427_5606_6586 | 317 |
| 453 | 3300049823 | Ga0501044_0086361 | Ga0501044_0086361_640_1605 | 317 |
| 454 | 3300049823 | Ga0501044_0101792 | Ga0501044_0101792_1262_2230 | 317 |
| 455 | 3300049823 | Ga0501044_0131218 | Ga0501044_0131218_504_1472 | 317 |
| 456 | 3300049823 | Ga0501044_0153508 | Ga0501044_0153508_261_1226 | 317 |
| 457 | iso_pu_bacteria | 2818991457 | 2819659931 | 317 |
| 458 | iso_pu_bacteria | 2852684882 | 2852685244 | 317 |
| 459 | 3300005344 | Ga0070661_100083337 | Ga0070661_1000833372 | 318 |
| 460 | 3300005535 | Ga0070684_100268297 | Ga0070684_1002682972 | 318 |
| 461 | 3300005547 | Ga0070693_100057716 | Ga0070693_1000577162 | 318 |
| 462 | 3300005614 | Ga0068856_100000416 | Ga0068856_10000041620 | 318 |
| 463 | 3300005617 | Ga0068859_100507566 | Ga0068859_1005075662 | 318 |
| 464 | 3300005618 | Ga0068864_100175186 | Ga0068864_1001751862 | 318 |
| 465 | 3300005842 | Ga0068858_100237183 | Ga0068858_1002371832 | 318 |
| 466 | 3300006237 | Ga0097621_100039782 | Ga0097621_1000397822 | 318 |
| 467 | 3300006881 | Ga0068865_100217977 | Ga0068865_1002179772 | 318 |
| 468 | 3300006931 | Ga0097620_100507600 | Ga0097620_1005076002 | 318 |
| 469 | 3300009177 | Ga0105248_10216895 | Ga0105248_102168952 | 318 |
| 470 | 3300013307 | Ga0157372_10329461 | Ga0157372_103294612 | 318 |
| 471 | 3300014325 | Ga0163163_10053838 | Ga0163163_100538383 | 318 |
| 472 | 3300025913 | Ga0207695_10149108 | Ga0207695_101491082 | 318 |
| 473 | 3300026078 | Ga0207702_10000185 | Ga0207702_1000018562 | 318 |
| 474 | 3300026078 | Ga0207702_10184847 | Ga0207702_101848472 | 318 |
| 475 | 3300037471 | Ga0395905_0084163 | Ga0395905_0084163_1300_2289 | 318 |
| 476 | 3300044684 | Ga0466966_0013296 | Ga0466966_0013296_996_1955 | 318 |
| 477 | 3300044719 | Ga0466971_0019590 | Ga0466971_0019590_1109_2068 | 318 |
| 478 | 3300044901 | Ga0466960_0005921 | Ga0466960_0005921_3025_3999 | 318 |
| 479 | 3300049582 | Ga0501048_0018513 | Ga0501048_0018513_3460_4419 | 318 |
| 480 | 3300049822 | Ga0501035_0042186 | Ga0501035_0042186_2045_3004 | 318 |
| 481 | 3300049823 | Ga0501044_0097311 | Ga0501044_0097311_898_1857 | 318 |
| 482 | 3300061719 | Ga0466962_0004383 | Ga0466962_0004383_1105_2064 | 318 |
| 483 | 3300002737 | JGI25162J39368_1001323 | JGI25162J39368_10013239 | 319 |
| 484 | 3300002741 | JGI25157J39369_1000654 | JGI25157J39369_100065414 | 319 |
| 485 | 3300002772 | JGI25164J39214_1000485 | JGI25164J39214_10004859 | 319 |
| 486 | 3300002772 | JGI25164J39214_1000690 | JGI25164J39214_10006907 | 319 |
| 487 | 3300003214 | JGI25165J46597_1000812 | JGI25165J46597_10008129 | 319 |
| 488 | 3300003760 | Ga0055527_1000209 | Ga0055527_100020921 | 319 |
| 489 | 3300003761 | Ga0055535_1000451 | Ga0055535_100045121 | 319 |
| 490 | 3300003762 | Ga0055542_1000466 | Ga0055542_100046621 | 319 |
| 491 | 3300003763 | Ga0055529_1000671 | Ga0055529_10006716 | 319 |
| 492 | 3300005336 | Ga0070680_100054615 | Ga0070680_1000546152 | 319 |
| 493 | 3300005341 | Ga0070691_10011407 | Ga0070691_100114073 | 319 |
| 494 | 3300005344 | Ga0070661_100006026 | Ga0070661_1000060268 | 319 |
| 495 | 3300005345 | Ga0070692_10000760 | Ga0070692_100007607 | 319 |
| 496 | 3300005435 | Ga0070714_100053430 | Ga0070714_1000534302 | 319 |
| 497 | 3300005436 | Ga0070713_100230093 | Ga0070713_1002300932 | 319 |
| 498 | 3300005458 | Ga0070681_10002606 | Ga0070681_100026066 | 319 |
| 499 | 3300005458 | Ga0070681_10181467 | Ga0070681_101814672 | 319 |
| 500 | 3300005530 | Ga0070679_100001102 | Ga0070679_10000110213 | 319 |
| 501 | 3300005530 | Ga0070679_100258561 | Ga0070679_1002585612 | 319 |
| 502 | 3300005535 | Ga0070684_100106204 | Ga0070684_1001062042 | 319 |
| 503 | 3300005539 | Ga0068853_100015777 | Ga0068853_1000157772 | 319 |
| 504 | 3300005563 | Ga0068855_100042451 | Ga0068855_1000424512 | 319 |
| 505 | 3300005578 | Ga0068854_100017938 | Ga0068854_1000179385 | 319 |
| 506 | 3300005578 | Ga0068854_100198100 | Ga0068854_1001981002 | 319 |
| 507 | 3300005614 | Ga0068856_100132041 | Ga0068856_1001320412 | 319 |
| 508 | 3300009093 | Ga0105240_10090630 | Ga0105240_100906303 | 319 |
| 509 | 3300009545 | Ga0105237_10071696 | Ga0105237_100716962 | 319 |
| 510 | 3300009551 | Ga0105238_10036497 | Ga0105238_100364973 | 319 |
| 511 | 3300013102 | Ga0157371_10010073 | Ga0157371_100100735 | 319 |
| 512 | 3300013104 | Ga0157370_10001525 | Ga0157370_1000152520 | 319 |
| 513 | 3300013307 | Ga0157372_10003283 | Ga0157372_1000328312 | 319 |
| 514 | 3300014497 | Ga0182008_10007901 | Ga0182008_100079011 | 319 |
| 515 | 3300020082 | Ga0206353_10613403 | Ga0206353_106134031 | 319 |
| 516 | 3300025226 | Ga0209674_101824 | Ga0209674_1018244 | 319 |
| 517 | 3300025228 | Ga0209672_100005 | Ga0209672_100005700 | 319 |
| 518 | 3300025230 | Ga0209563_100023 | Ga0209563_100023359 | 319 |
| 519 | 3300025231 | Ga0207427_100244 | Ga0207427_10024424 | 319 |
| 520 | 3300025231 | Ga0207427_100248 | Ga0207427_10024823 | 319 |
| 521 | 3300025233 | Ga0209437_100020 | Ga0209437_100020383 | 319 |
| 522 | 3300025233 | Ga0209437_100079 | Ga0209437_10007921 | 319 |
| 523 | 3300025242 | Ga0209258_100006 | Ga0209258_100006700 | 319 |
| 524 | 3300025250 | Ga0209026_1000037 | Ga0209026_1000037104 | 319 |
| 525 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012700 | 319 |
| 526 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020242 | 319 |
| 527 | 3300025261 | Ga0209233_1000147 | Ga0209233_100014723 | 319 |
| 528 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008700 | 319 |
| 529 | 3300025909 | Ga0207705_10001128 | Ga0207705_1000112814 | 319 |
| 530 | 3300025912 | Ga0207707_10000274 | Ga0207707_1000027440 | 319 |
| 531 | 3300025912 | Ga0207707_10161666 | Ga0207707_101616662 | 319 |
| 532 | 3300025913 | Ga0207695_10003804 | Ga0207695_1000380410 | 319 |
| 533 | 3300025914 | Ga0207671_10103904 | Ga0207671_101039042 | 319 |
| 534 | 3300025917 | Ga0207660_10001041 | Ga0207660_1000104113 | 319 |
| 535 | 3300025917 | Ga0207660_10014264 | Ga0207660_100142642 | 319 |
| 536 | 3300025919 | Ga0207657_10002096 | Ga0207657_1000209610 | 319 |
| 537 | 3300025921 | Ga0207652_10000715 | Ga0207652_1000071517 | 319 |
| 538 | 3300025921 | Ga0207652_10234641 | Ga0207652_102346412 | 319 |
| 539 | 3300025928 | Ga0207700_10141960 | Ga0207700_101419602 | 319 |
| 540 | 3300025929 | Ga0207664_10098555 | Ga0207664_100985553 | 319 |
| 541 | 3300025932 | Ga0207690_10005361 | Ga0207690_100053614 | 319 |
| 542 | 3300025949 | Ga0207667_10002690 | Ga0207667_100026907 | 319 |
| 543 | 3300025981 | Ga0207640_10002743 | Ga0207640_100027438 | 319 |
| 544 | 3300025981 | Ga0207640_10008198 | Ga0207640_100081986 | 319 |
| 545 | 3300026041 | Ga0207639_10002830 | Ga0207639_100028309 | 319 |
| 546 | 3300026067 | Ga0207678_10001403 | Ga0207678_1000140314 | 319 |
| 547 | 3300026078 | Ga0207702_10096143 | Ga0207702_100961432 | 319 |
| 548 | 3300026142 | Ga0207698_10001786 | Ga0207698_100017865 | 319 |
| 549 | 3300032004 | Ga0307414_10004643 | Ga0307414_100046434 | 319 |
| 550 | 3300032004 | Ga0307414_10046183 | Ga0307414_100461832 | 319 |
| 551 | 3300037466 | Ga0395898_0114074 | Ga0395898_0114074_96_1082 | 319 |
| 552 | 3300038443 | Ga0395901_0186033 | Ga0395901_0186033_96_1082 | 319 |
| 553 | 3300044656 | Ga0466969_0003903 | Ga0466969_0003903_2006_2977 | 319 |
| 554 | 3300044683 | Ga0466965_0000550 | Ga0466965_0000550_11130_12101 | 319 |
| 555 | 3300044684 | Ga0466966_0001316 | Ga0466966_0001316_2382_3353 | 319 |
| 556 | 3300044693 | Ga0466961_0009981 | Ga0466961_0009981_1542_2513 | 319 |
| 557 | 3300044693 | Ga0466961_0013180 | Ga0466961_0013180_1137_2108 | 319 |
| 558 | 3300044719 | Ga0466971_0006496 | Ga0466971_0006496_888_1859 | 319 |
| 559 | 3300044842 | Ga0466957_0028237 | Ga0466957_0028237_162_1133 | 319 |
| 560 | 3300044842 | Ga0466957_0137941 | Ga0466957_0137941_51_1028 | 319 |
| 561 | 3300045049 | Ga0466959_0010673 | Ga0466959_0010673_4708_5679 | 319 |
| 562 | 3300045049 | Ga0466959_0045661 | Ga0466959_0045661_747_1718 | 319 |
| 563 | 3300048925 | Ga0496122_0025528 | Ga0496122_0025528_104_1063 | 319 |
| 564 | 3300048926 | Ga0496123_0039389 | Ga0496123_0039389_1184_2143 | 319 |
| 565 | 3300061719 | Ga0466962_0010142 | Ga0466962_0010142_1587_2558 | 319 |
| 566 | 3300061719 | Ga0466962_0090676 | Ga0466962_0090676_73_1044 | 319 |
| 567 | 2162886007 | SwRhRL2b_contig_723762 | SwRhRL2b_0236.00007630 | 320 |
| 568 | 3300003781 | Ga0055536_1002005 | Ga0055536_10020057 | 320 |
| 569 | 3300003856 | Ga0058692_1000006 | Ga0058692_1000006233 | 320 |
| 570 | 3300005289 | Ga0065704_10070476 | Ga0065704_1007047613 | 320 |
| 571 | 3300005289 | Ga0065704_10070915 | Ga0065704_100709156 | 320 |
| 572 | 3300005466 | Ga0070685_10016889 | Ga0070685_100168892 | 320 |
| 573 | 3300009148 | Ga0105243_10004981 | Ga0105243_100049813 | 320 |
| 574 | 3300013296 | Ga0157374_10039886 | Ga0157374_100398865 | 320 |
| 575 | 3300025292 | Ga0209676_1000034 | Ga0209676_1000034417 | 320 |
| 576 | 3300025935 | Ga0207709_10007378 | Ga0207709_100073783 | 320 |
| 577 | 3300025942 | Ga0207689_10042832 | Ga0207689_100428322 | 320 |
| 578 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016233 | 320 |
| 579 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015337 | 320 |
| 580 | 3300032004 | Ga0307414_10041317 | Ga0307414_100413172 | 320 |
| 581 | 3300039145 | Ga0237816_02346 | Ga0237816_02346_323_1315 | 320 |
| 582 | 3300048917 | Ga0496114_0016091 | Ga0496114_0016091_3334_4296 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g17-assembly1.cif.gz_A | the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. | 0.9002 | 1 | 315 |
| 8afv-assembly1.cif.gz_A | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.8987 | 6 | 315 |
| 8afu-assembly2.cif.gz_A-2 | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.8942 | 2 | 315 |
| 8afu-assembly2.cif.gz_B | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.8929 | 1 | 315 |
| 8afv-assembly2.cif.gz_C | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.8921 | 6 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1H4_146_311_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9183 | 134 | 289 | 3.30.360.10 |
| af_Q2G1H4_169_311_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9047 | 155 | 289 | 3.30.360.10 |
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.898 | 133 | 289 | 3.30.360.10 |
| 3dr3A02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8869 | 134 | 293 | 3.30.360.10 |
| 3dr3A02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8817 | 134 | 293 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A367J6R2-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase | 0.9801 | 200 | 317 |
GO:0016301
|
| AF-T1AKM0-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase | 0.9789 | 3 | 134 |
GO:0006526
GO:0016620 GO:0051287 |
| AF-A0A2S6BA65-F1-model_v4 | deleted | 0.9779 | 219 | 314 |
|
| AF-D5G7N8-F1-model_v4 | (Perigord truffle) hypothetical protein | 0.9765 | 184 | 315 |
|
| AF-A0A2W5HSF8-F1-model_v4 | deleted | 0.9738 | 1 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar