F466147

General Info

Members Datasets Scaffolds Average Seq Length
582 268 552 318

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100106204|Ga0070684_1001062042
Length 334
Sequence MNATRKTIGIVGARGHAGAELIRLIAVHPALELTYVSSREWAGQRVDSHLPEFRGDLRYSAPAHEDLPGLGADIVVLALPNGKAAACVAAFDAAGADPLIVDLSADYRFDAHWYYGLPELTRERWRGERRIANPGCYATAMALAISPLKDLLAAPPVCFGVSGYSGAGTTPSERNDPDKLHDNLMPYALIGHLHEKEAAYRLGVPVDFMPHVAPHFRGLTVTSNLYLARGLKRDEVLARFRHAYADEPLVSLVDDAPWVSRIAGRHHAEIGGITVSPDGKRVVVVATLDNLLKGAATQALQNINRAIGVDEFTAIPLPPSPTTDVHAPAGSGHD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
12 2818991457 Xanthomonas translucens 569 Isolate Unclassified
13 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
16 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
17 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
18 2884411467 Dyella sp. AD56 Isolate Rhizosphere
19 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
20 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
21 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
22 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
23 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
24 2919085039 Luteibacter sp. 1214 Isolate Unclassified
25 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
26 2919404418 Luteibacter sp. 3190 Isolate Unclassified
27 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
28 2928963466 Dyella japonica 1073 Isolate Unclassified
29 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
30 2941471342 Luteibacter sp. 621 Isolate Unclassified
31 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
39 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
112 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
188 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
189 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 0.52
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.37
Nodule 0
Rhizoplane 3.09
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 13.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_723762 2162886007 Bacteria 4988
2 JGI24741J21665_1004716 3300001915 Bacteria 2966
3 JGI24740J21852_10003993 3300001979 Bacteria 6403
4 JGI24737J22298_10009376 3300001990 Bacteria 3259
5 JGI24735J21928_10002797 3300002067 Bacteria 6021
6 JGI25156J39149_1000463 3300002705 Bacteria 24552
7 JGI25156J39149_1013681 3300002705 Bacteria 1709
8 JGI25156J39149_1013976 3300002705 Bacteria 1676
9 JGI25162J39368_1000163 3300002737 Bacteria 74121
10 JGI25162J39368_1000895 3300002737 Bacteria 19431
11 JGI25162J39368_1001323 3300002737 Bacteria 13849
12 JGI25162J39368_1001410 3300002737 Bacteria 13098
13 JGI25157J39369_1000229 3300002741 Bacteria 43921
14 JGI25157J39369_1000575 3300002741 Bacteria 21822
15 JGI25157J39369_1000654 3300002741 Bacteria 19192
16 JGI25157J39369_1004101 3300002741 Bacteria 2735
17 JGI25163J39215_1000538 3300002771 Bacteria 11102
18 JGI25164J39214_1000045 3300002772 Bacteria 125909
19 JGI25164J39214_1000285 3300002772 Bacteria 35663
20 JGI25164J39214_1000485 3300002772 Bacteria 19655
21 JGI25164J39214_1000690 3300002772 Bacteria 13175
22 JGI25165J46597_1000072 3300003214 Bacteria 192184
23 JGI25165J46597_1000215 3300003214 Bacteria 81941
24 JGI25165J46597_1000812 3300003214 Bacteria 23523
25 rootH1_10025459 3300003316 Bacteria 4344
26 rootH2_10012587 3300003320 Bacteria 26291
27 Ga0055538_1001046 3300003751 Bacteria 6219
28 Ga0055527_1000209 3300003760 Bacteria 37913
29 Ga0055527_1001498 3300003760 Bacteria 4837
30 Ga0055535_1000124 3300003761 Bacteria 81941
31 Ga0055535_1000451 3300003761 Bacteria 37913
32 Ga0055535_1000831 3300003761 Bacteria 22164
33 Ga0055535_1008706 3300003761 Bacteria 1804
34 Ga0055542_1000197 3300003762 Bacteria 74121
35 Ga0055542_1000242 3300003762 Bacteria 62798
36 Ga0055542_1000349 3300003762 Bacteria 48521
37 Ga0055542_1000466 3300003762 Bacteria 37913
38 Ga0055529_1000197 3300003763 Bacteria 81941
39 Ga0055529_1000204 3300003763 Bacteria 78293
40 Ga0055529_1000671 3300003763 Bacteria 23784
41 Ga0055536_1002005 3300003781 Bacteria 11676
42 Ga0058692_1000006 3300003856 Bacteria 398109
43 Ga0058692_1000012 3300003856 Bacteria 318930
44 Ga0065165_1000118 3300005262 Bacteria 134488
45 Ga0065704_10070476 3300005289 Bacteria 23424
46 Ga0065704_10070915 3300005289 Bacteria 14696
47 Ga0070658_10020563 3300005327 Bacteria 5291
48 Ga0070658_10094950 3300005327 Bacteria 2461
49 Ga0070666_10000005 3300005335 Bacteria 343092
50 Ga0070680_100001147 3300005336 Bacteria 18999
51 Ga0070680_100054615 3300005336 Bacteria 3262
52 Ga0070680_100101701 3300005336 Bacteria 2386
53 Ga0070682_100005899 3300005337 Bacteria 6848
54 Ga0070660_100010300 3300005339 Bacteria 6601
55 Ga0070660_100019495 3300005339 Bacteria 4972
56 Ga0070691_10011407 3300005341 Bacteria 4058
57 Ga0070661_100006026 3300005344 Bacteria 8341
58 Ga0070661_100083337 3300005344 Bacteria 2362
59 Ga0070661_100122322 3300005344 Bacteria 1950
60 Ga0070692_10000760 3300005345 Bacteria 10573
61 Ga0070668_100269442 3300005347 Bacteria 1419
62 Ga0070671_100313027 3300005355 Bacteria 1337
63 Ga0070659_100359423 3300005366 Bacteria 1223
64 Ga0070667_100000061 3300005367 Bacteria 143754
65 Ga0070667_100130011 3300005367 Bacteria 2197
66 Ga0070714_100053430 3300005435 Bacteria 3448
67 Ga0070713_100230093 3300005436 Bacteria 1685
68 Ga0070663_100000098 3300005455 Bacteria 39429
69 Ga0070663_100006804 3300005455 Bacteria 6912
70 Ga0070663_100217132 3300005455 Bacteria 1500
71 Ga0070663_100230760 3300005455 Bacteria 1457
72 Ga0070662_100015623 3300005457 Bacteria 5089
73 Ga0070681_10000478 3300005458 Bacteria 32685
74 Ga0070681_10002606 3300005458 Bacteria 16546
75 Ga0070681_10006071 3300005458 Bacteria 11717
76 Ga0070681_10008891 3300005458 Bacteria 9873
77 Ga0070681_10051954 3300005458 Bacteria 4087
78 Ga0070681_10151614 3300005458 Bacteria 2244
79 Ga0070681_10181467 3300005458 Bacteria 2026
80 Ga0070685_10016889 3300005466 Bacteria 3895
81 Ga0070679_100000159 3300005530 Bacteria 53995
82 Ga0070679_100001102 3300005530 Bacteria 23613
83 Ga0070679_100005521 3300005530 Bacteria 11717
84 Ga0070679_100258561 3300005530 Bacteria 1696
85 Ga0070684_100015112 3300005535 Bacteria 6276
86 Ga0070684_100106204 3300005535 Bacteria 2513
87 Ga0070684_100268297 3300005535 Bacteria 1562
88 Ga0068853_100000998 3300005539 Bacteria 19938
89 Ga0068853_100015777 3300005539 Bacteria 6204
90 Ga0068853_100032032 3300005539 Bacteria 4451
91 Ga0068853_100249431 3300005539 Bacteria 1628
92 Ga0070696_100013121 3300005546 Bacteria 5559
93 Ga0070696_100019136 3300005546 Bacteria 4635
94 Ga0070696_100021589 3300005546 Bacteria 4366
95 Ga0070696_100032241 3300005546 Bacteria 3595
96 Ga0070693_100024182 3300005547 Bacteria 3255
97 Ga0070693_100057716 3300005547 Bacteria 2245
98 Ga0068855_100042451 3300005563 Bacteria 5388
99 Ga0068855_100054823 3300005563 Bacteria 4685
100 Ga0068857_100046007 3300005577 Bacteria 3872
101 Ga0068854_100014236 3300005578 Bacteria 5238
102 Ga0068854_100017938 3300005578 Bacteria 4744
103 Ga0068854_100135998 3300005578 Bacteria 1881
104 Ga0068854_100198100 3300005578 Bacteria 1577
105 Ga0068856_100000416 3300005614 Bacteria 46989
106 Ga0068856_100004196 3300005614 Bacteria 14393
107 Ga0068856_100030189 3300005614 Bacteria 5299
108 Ga0068856_100132041 3300005614 Bacteria 2502
109 Ga0068852_100103211 3300005616 Bacteria 2578
110 Ga0068859_100507566 3300005617 Bacteria 1301
111 Ga0068864_100022244 3300005618 Bacteria 5314
112 Ga0068864_100175186 3300005618 Bacteria 1958
113 Ga0068851_10013971 3300005834 Bacteria 3805
114 Ga0068863_100040023 3300005841 Bacteria 4457
115 Ga0068863_100046769 3300005841 Bacteria 4107
116 Ga0068858_100237183 3300005842 Bacteria 1730
117 Ga0068860_100034319 3300005843 Bacteria 4865
118 Ga0097621_100039782 3300006237 Bacteria 3778
119 Ga0068865_100217977 3300006881 Bacteria 1490
120 Ga0097620_100507600 3300006931 Bacteria 1301
121 Ga0105240_10008662 3300009093 Bacteria 14524
122 Ga0105240_10028816 3300009093 Bacteria 7243
123 Ga0105240_10090461 3300009093 Bacteria 3740
124 Ga0105240_10090630 3300009093 Bacteria 3737
125 Ga0105240_10381373 3300009093 Bacteria 1592
126 Ga0105243_10004981 3300009148 Bacteria 10410
127 Ga0105241_10273475 3300009174 Bacteria 1440
128 Ga0105241_10358131 3300009174 Bacteria 1269
129 Ga0105248_10000294 3300009177 Bacteria 59302
130 Ga0105248_10216895 3300009177 Bacteria 2155
131 Ga0105237_10000007 3300009545 Bacteria 367690
132 Ga0105237_10000637 3300009545 Bacteria 48955
133 Ga0105237_10071696 3300009545 Bacteria 3459
134 Ga0105238_10003835 3300009551 Bacteria 14930
135 Ga0105238_10036497 3300009551 Bacteria 4996
136 Ga0105238_10054370 3300009551 Bacteria 4020
137 Ga0105238_10073353 3300009551 Bacteria 3417
138 Ga0105238_10210926 3300009551 Bacteria 1918
139 Ga0105249_10000272 3300009553 Bacteria 54568
140 Ga0105249_10036550 3300009553 Bacteria 4455
141 Ga0105239_10000030 3300010375 Bacteria 233669
142 Ga0105239_10039254 3300010375 Bacteria 5187
143 Ga0105239_10065148 3300010375 Bacteria 4001
144 Ga0105239_10067311 3300010375 Bacteria 3935
145 Ga0105239_10106232 3300010375 Bacteria 3110
146 Ga0105246_10003959 3300011119 Bacteria 8977
147 Ga0157373_10026888 3300013100 Bacteria 4153
148 Ga0157373_10248043 3300013100 Bacteria 1259
149 Ga0157371_10010073 3300013102 Bacteria 7390
150 Ga0157371_10046887 3300013102 Bacteria 3071
151 Ga0157370_10000293 3300013104 Bacteria 63396
152 Ga0157370_10001525 3300013104 Bacteria 28645
153 Ga0157370_10005088 3300013104 Bacteria 14834
154 Ga0157370_10007298 3300013104 Bacteria 12062
155 Ga0157370_10167371 3300013104 Bacteria 2044
156 Ga0157369_10012900 3300013105 Bacteria 9472
157 Ga0157374_10019015 3300013296 Bacteria 6076
158 Ga0157374_10039886 3300013296 Bacteria 4323
159 Ga0163162_10000489 3300013306 Bacteria 36741
160 Ga0157372_10003283 3300013307 Bacteria 17484
161 Ga0157372_10007646 3300013307 Bacteria 11492
162 Ga0157372_10011205 3300013307 Bacteria 9538
163 Ga0157372_10056190 3300013307 Bacteria 4398
164 Ga0157372_10329461 3300013307 Bacteria 1778
165 Ga0157372_10505534 3300013307 Bacteria 1409
166 Ga0157375_10014055 3300013308 Bacteria 7139
167 Ga0163163_10053838 3300014325 Bacteria 3974
168 Ga0163163_10443403 3300014325 Bacteria 1358
169 Ga0182008_10007901 3300014497 Bacteria 5838
170 Ga0182008_10033442 3300014497 Bacteria 2579
171 Ga0157379_10006837 3300014968 Bacteria 9858
172 Ga0157376_10038489 3300014969 Bacteria 3892
173 Ga0182005_1000028 3300015265 Bacteria 221889
174 Ga0182005_1004772 3300015265 Bacteria 4323
175 Ga0183369_1007 3300015685 Bacteria 414878
176 Ga0183368_1003 3300015687 Bacteria 1276390
177 Ga0163161_10086921 3300017792 Bacteria 2308
178 Ga0206354_10560480 3300020081 Bacteria 6450
179 Ga0206353_10613403 3300020082 Bacteria 1238
180 Ga0154015_1237743 3300020610 Bacteria 3202
181 Ga0209435_102200 3300025206 Bacteria 2314
182 Ga0209435_108134 3300025206 Bacteria 1157
183 Ga0209784_100120 3300025224 Bacteria 82684
184 Ga0209674_100012 3300025226 Bacteria 950162
185 Ga0209674_101824 3300025226 Bacteria 5080
186 Ga0209674_102139 3300025226 Bacteria 4455
187 Ga0209672_100005 3300025228 Bacteria 1069303
188 Ga0209672_100277 3300025228 Bacteria 37238
189 Ga0209672_100911 3300025228 Bacteria 13436
190 Ga0209563_100023 3300025230 Bacteria 636844
191 Ga0207427_100013 3300025231 Bacteria 581419
192 Ga0207427_100055 3300025231 Bacteria 209093
193 Ga0207427_100244 3300025231 Bacteria 43765
194 Ga0207427_100248 3300025231 Bacteria 42623
195 Ga0207427_103884 3300025231 Bacteria 2810
196 Ga0209437_100015 3300025233 Bacteria 713457
197 Ga0209437_100020 3300025233 Bacteria 656374
198 Ga0209437_100079 3300025233 Bacteria 275948
199 Ga0209437_100161 3300025233 Bacteria 148264
200 Ga0209437_100224 3300025233 Bacteria 101515
201 Ga0209437_102166 3300025233 Bacteria 3939
202 Ga0209437_103650 3300025233 Bacteria 2758
203 Ga0209258_100006 3300025242 Bacteria 1069303
204 Ga0209258_100049 3300025242 Bacteria 358328
205 Ga0209258_100186 3300025242 Bacteria 132381
206 Ga0209258_103422 3300025242 Bacteria 3427
207 Ga0209646_1000467 3300025246 Bacteria 20487
208 Ga0209646_1000760 3300025246 Bacteria 11160
209 Ga0209026_1000037 3300025250 Bacteria 282562
210 Ga0209026_1000204 3300025250 Bacteria 81999
211 Ga0209026_1000375 3300025250 Bacteria 41000
212 Ga0209026_1001302 3300025250 Bacteria 11274
213 Ga0209148_1000005 3300025254 Bacteria 1806504
214 Ga0209148_1000010 3300025254 Bacteria 1265567
215 Ga0209148_1000012 3300025254 Bacteria 1069303
216 Ga0209148_1000073 3300025254 Bacteria 320851
217 Ga0209148_1001285 3300025254 Bacteria 13676
218 Ga0209759_1000103 3300025256 Bacteria 153195
219 Ga0209759_1000672 3300025256 Bacteria 31426
220 Ga0209759_1013336 3300025256 Bacteria 2229
221 Ga0209233_1000009 3300025261 Bacteria 1265567
222 Ga0209233_1000020 3300025261 Bacteria 798224
223 Ga0209233_1000063 3300025261 Bacteria 395810
224 Ga0209233_1000147 3300025261 Bacteria 186517
225 Ga0209233_1011780 3300025261 Bacteria 2566
226 Ga0209455_1000008 3300025272 Bacteria 1069303
227 Ga0209455_1000082 3300025272 Bacteria 257909
228 Ga0209455_1000177 3300025272 Bacteria 106026
229 Ga0209455_1000344 3300025272 Bacteria 43864
230 Ga0209455_1006368 3300025272 Bacteria 3494
231 Ga0209676_1000034 3300025292 Bacteria 460125
232 Ga0209256_1004365 3300025299 Bacteria 8952
233 Ga0207426_1011861 3300025302 Bacteria 3298
234 Ga0207656_10046545 3300025321 Bacteria 1861
235 Ga0207680_10000005 3300025903 Bacteria 660983
236 Ga0207647_10000084 3300025904 Bacteria 71295
237 Ga0207647_10000747 3300025904 Bacteria 25485
238 Ga0207647_10010317 3300025904 Bacteria 6599
239 Ga0207705_10001128 3300025909 Bacteria 21726
240 Ga0207705_10008538 3300025909 Bacteria 7469
241 Ga0207705_10010341 3300025909 Bacteria 6787
242 Ga0207705_10015167 3300025909 Bacteria 5538
243 Ga0207705_10074272 3300025909 Bacteria 2468
244 Ga0207705_10081318 3300025909 Bacteria 2361
245 Ga0207654_10004928 3300025911 Bacteria 6754
246 Ga0207707_10000032 3300025912 Bacteria 158499
247 Ga0207707_10000274 3300025912 Bacteria 55548
248 Ga0207707_10002692 3300025912 Bacteria 15870
249 Ga0207707_10003858 3300025912 Bacteria 13289
250 Ga0207707_10011681 3300025912 Bacteria 7643
251 Ga0207707_10058093 3300025912 Bacteria 3367
252 Ga0207707_10161666 3300025912 Bacteria 1958
253 Ga0207695_10001749 3300025913 Bacteria 34474
254 Ga0207695_10003349 3300025913 Bacteria 22657
255 Ga0207695_10003804 3300025913 Bacteria 20926
256 Ga0207695_10004269 3300025913 Bacteria 19628
257 Ga0207695_10019259 3300025913 Bacteria 7860
258 Ga0207695_10149108 3300025913 Bacteria 2279
259 Ga0207695_10171773 3300025913 Bacteria 2093
260 Ga0207671_10000074 3300025914 Bacteria 156482
261 Ga0207671_10009987 3300025914 Bacteria 7885
262 Ga0207671_10103904 3300025914 Bacteria 2155
263 Ga0207660_10000431 3300025917 Bacteria 27636
264 Ga0207660_10001041 3300025917 Bacteria 18343
265 Ga0207660_10002224 3300025917 Bacteria 12842
266 Ga0207660_10014264 3300025917 Bacteria 5221
267 Ga0207660_10045926 3300025917 Bacteria 3080
268 Ga0207660_10187936 3300025917 Bacteria 1607
269 Ga0207657_10001633 3300025919 Bacteria 24148
270 Ga0207657_10002096 3300025919 Bacteria 21574
271 Ga0207649_10008395 3300025920 Bacteria 5629
272 Ga0207649_10157664 3300025920 Bacteria 1570
273 Ga0207652_10000026 3300025921 Bacteria 156183
274 Ga0207652_10000715 3300025921 Bacteria 32237
275 Ga0207652_10005288 3300025921 Bacteria 10475
276 Ga0207652_10234641 3300025921 Bacteria 1653
277 Ga0207694_10009159 3300025924 Bacteria 7472
278 Ga0207694_10011255 3300025924 Bacteria 6757
279 Ga0207694_10074068 3300025924 Bacteria 2665
280 Ga0207694_10098035 3300025924 Bacteria 2320
281 Ga0207694_10332149 3300025924 Bacteria 1256
282 Ga0207650_10169429 3300025925 Bacteria 1735
283 Ga0207700_10141960 3300025928 Bacteria 1974
284 Ga0207664_10098555 3300025929 Bacteria 2410
285 Ga0207690_10001160 3300025932 Bacteria 16674
286 Ga0207690_10005361 3300025932 Bacteria 7558
287 Ga0207706_10026570 3300025933 Bacteria 5181
288 Ga0207709_10007378 3300025935 Bacteria 6126
289 Ga0207711_10000850 3300025941 Bacteria 29523
290 Ga0207689_10042832 3300025942 Bacteria 3743
291 Ga0207661_10174231 3300025944 Bacteria 1874
292 Ga0207667_10002690 3300025949 Bacteria 21986
293 Ga0207667_10005247 3300025949 Bacteria 15812
294 Ga0207667_10011214 3300025949 Bacteria 10429
295 Ga0207667_10251913 3300025949 Bacteria 1806
296 Ga0207667_10321237 3300025949 Bacteria 1581
297 Ga0207712_10000339 3300025961 Bacteria 42473
298 Ga0207712_10001053 3300025961 Bacteria 19387
299 Ga0207712_10026904 3300025961 Bacteria 3837
300 Ga0207668_10204173 3300025972 Bacteria 1576
301 Ga0207640_10002743 3300025981 Bacteria 9424
302 Ga0207640_10006105 3300025981 Bacteria 6586
303 Ga0207640_10008198 3300025981 Bacteria 5791
304 Ga0207640_10030042 3300025981 Bacteria 3343
305 Ga0207640_10031945 3300025981 Bacteria 3260
306 Ga0207640_10113448 3300025981 Bacteria 1926
307 Ga0207658_10000166 3300025986 Bacteria 70441
308 Ga0207658_10084659 3300025986 Bacteria 2440
309 Ga0207639_10002830 3300026041 Bacteria 11641
310 Ga0207639_10012112 3300026041 Bacteria 6001
311 Ga0207639_10014786 3300026041 Bacteria 5497
312 Ga0207639_10022813 3300026041 Bacteria 4512
313 Ga0207678_10001403 3300026067 Bacteria 22155
314 Ga0207678_10002211 3300026067 Bacteria 17577
315 Ga0207678_10003668 3300026067 Bacteria 13806
316 Ga0207678_10011703 3300026067 Bacteria 7699
317 Ga0207678_10022074 3300026067 Bacteria 5577
318 Ga0207678_10111048 3300026067 Bacteria 2339
319 Ga0207678_10120294 3300026067 Bacteria 2241
320 Ga0207702_10000185 3300026078 Bacteria 74602
321 Ga0207702_10008548 3300026078 Bacteria 8628
322 Ga0207702_10096143 3300026078 Bacteria 2604
323 Ga0207702_10184847 3300026078 Bacteria 1921
324 Ga0207641_10064929 3300026088 Bacteria 3121
325 Ga0207641_10078202 3300026088 Bacteria 2864
326 Ga0207648_10176343 3300026089 Bacteria 1890
327 Ga0207676_10066337 3300026095 Bacteria 2878
328 Ga0207674_10002798 3300026116 Bacteria 21725
329 Ga0207674_10018482 3300026116 Bacteria 7576
330 Ga0207674_10054334 3300026116 Bacteria 4078
331 Ga0207674_10105380 3300026116 Bacteria 2798
332 Ga0207698_10001786 3300026142 Bacteria 12566
333 Ga0207698_10002926 3300026142 Bacteria 10208
334 Ga0207698_10100907 3300026142 Bacteria 2392
335 Ga0209371_1000007 3300027312 Bacteria 1050654
336 Ga0209371_1000016 3300027312 Bacteria 646301
337 Ga0268266_10000004 3300028379 Bacteria 1495817
338 Ga0268264_10056756 3300028381 Bacteria 3274
339 Ga0268256_1000008 3300030500 Bacteria 1050654
340 Ga0268256_1000015 3300030500 Bacteria 646300
341 Ga0307516_10106044 3300031730 Bacteria 2621
342 Ga0307412_10003347 3300031911 Bacteria 8905
343 Ga0307412_10100670 3300031911 Bacteria 2043
344 Ga0307409_100317436 3300031995 Bacteria 1457
345 Ga0307414_10004643 3300032004 Bacteria 7480
346 Ga0307414_10008972 3300032004 Bacteria 5717
347 Ga0307414_10041317 3300032004 Bacteria 3123
348 Ga0307414_10046183 3300032004 Bacteria 2987
349 Ga0307411_10075577 3300032005 Bacteria 2300
350 Ga0307510_10005230 3300033180 Bacteria 15426
351 Ga0307510_10021816 3300033180 Bacteria 7452
352 Ga0395899_0016207 3300037312 Bacteria 5679
353 Ga0395899_0085820 3300037312 Bacteria 2287
354 Ga0395899_0219217 3300037312 Bacteria 1318
355 Ga0395900_0005984 3300037418 Bacteria 12701
356 Ga0395900_0007251 3300037418 Bacteria 11478
357 Ga0395900_0008909 3300037418 Bacteria 10296
358 Ga0395900_0047569 3300037418 Bacteria 4417
359 Ga0395898_0000049 3300037466 Bacteria 284792
360 Ga0395898_0003336 3300037466 Bacteria 18023
361 Ga0395898_0004927 3300037466 Bacteria 14491
362 Ga0395898_0012224 3300037466 Bacteria 8876
363 Ga0395898_0114074 3300037466 Bacteria 2589
364 Ga0395905_0084163 3300037471 Bacteria 2980
365 Ga0395901_0004732 3300038443 Bacteria 13738
366 Ga0395901_0005132 3300038443 Bacteria 13220
367 Ga0395901_0009707 3300038443 Bacteria 9760
368 Ga0395901_0010230 3300038443 Bacteria 9503
369 Ga0395901_0165825 3300038443 Bacteria 2320
370 Ga0395901_0186033 3300038443 Bacteria 2178
371 Ga0395901_0194078 3300038443 Bacteria 2129
372 Ga0237816_02346 3300039145 Bacteria 1459
373 Ga0436365_0838762 3300039437 Bacteria 3305
374 Ga0439436_0000156 3300041404 Bacteria 15891
375 Ga0451800_0027863 3300041459 Bacteria 1854
376 Ga0451800_0163290 3300041459 Bacteria 12437
377 Ga0451806_619891 3300041462 Bacteria 4955
378 Ga0451804_0794885 3300041463 Bacteria 2792
379 Ga0451807_1039361 3300041486 Bacteria 5369
380 Ga0451853_2514762 3300041512 Bacteria 2017
381 Ga0439459_0006387 3300042438 Bacteria 1962
382 Ga0466969_0003903 3300044656 Bacteria 7914
383 Ga0466965_0000550 3300044683 Bacteria 13502
384 Ga0466966_0001316 3300044684 Bacteria 15936
385 Ga0466966_0013296 3300044684 Bacteria 5450
386 Ga0466961_0004179 3300044693 Bacteria 9020
387 Ga0466961_0009981 3300044693 Bacteria 6051
388 Ga0466961_0013180 3300044693 Bacteria 5287
389 Ga0466963_0162984 3300044694 Bacteria 1552
390 Ga0466971_0006496 3300044719 Bacteria 5082
391 Ga0466971_0019590 3300044719 Bacteria 3006
392 Ga0466957_0028237 3300044842 Bacteria 3339
393 Ga0466957_0137941 3300044842 Bacteria 1569
394 Ga0466960_0005921 3300044901 Bacteria 4875
395 Ga0466959_0010673 3300045049 Bacteria 6576
396 Ga0466959_0045661 3300045049 Bacteria 3226
397 Ga0466958_0020369 3300045836 Bacteria 3867
398 Ga0495627_025570 3300046453 Bacteria 1913
399 Ga0495638_0000234 3300046460 Bacteria 75860
400 Ga0495650_0000247 3300046471 Bacteria 106616
401 Ga0495585_0000104 3300046492 Bacteria 90097
402 Ga0495607_0008360 3300046501 Bacteria 7080
403 Ga0495606_0000401 3300046507 Bacteria 73149
404 Ga0495606_0005269 3300046507 Bacteria 12464
405 Ga0495610_0002689 3300046512 Bacteria 14657
406 Ga0495648_0000914 3300046524 Bacteria 30767
407 Ga0495622_0006636 3300046557 Bacteria 5364
408 Ga0495633_0032712 3300046558 Bacteria 2511
409 Ga0495625_0005535 3300046660 Bacteria 11474
410 Ga0495625_0016176 3300046660 Bacteria 5876
411 Ga0495661_0000199 3300046665 Bacteria 69536
412 Ga0495670_0008599 3300046691 Bacteria 5024
413 Ga0495649_0000553 3300046694 Bacteria 31708
414 Ga0495660_0000583 3300046810 Bacteria 29142
415 Ga0495673_0000004 3300047469 Bacteria 1354526
416 Ga0495686_0000017 3300047472 Bacteria 435554
417 Ga0496100_0115146 3300048903 Bacteria 1874
418 Ga0496104_0030305 3300048907 Bacteria 5026
419 Ga0496105_0003042 3300048908 Bacteria 12333
420 Ga0496106_0007333 3300048909 Bacteria 8150
421 Ga0496106_0111966 3300048909 Bacteria 2126
422 Ga0496107_0094468 3300048910 Bacteria 2188
423 Ga0496108_0158003 3300048911 Bacteria 1958
424 Ga0496113_0014146 3300048916 Bacteria 5434
425 Ga0496113_0193342 3300048916 Bacteria 1615
426 Ga0496114_0016091 3300048917 Bacteria 6020
427 Ga0496115_0000073 3300048918 Bacteria 90289
428 Ga0496115_0000206 3300048918 Bacteria 54824
429 Ga0496115_0000946 3300048918 Bacteria 21065
430 Ga0496117_0008476 3300048920 Bacteria 9759
431 Ga0496117_0022641 3300048920 Bacteria 5035
432 Ga0496117_0025189 3300048920 Bacteria 4683
433 Ga0496117_0098077 3300048920 Bacteria 1864
434 Ga0496118_0003118 3300048921 Bacteria 21238
435 Ga0496118_0004645 3300048921 Bacteria 16112
436 Ga0496118_0006962 3300048921 Bacteria 12210
437 Ga0496118_0015853 3300048921 Bacteria 6948
438 Ga0496118_0019362 3300048921 Bacteria 6086
439 Ga0496119_0001081 3300048922 Bacteria 34425
440 Ga0496119_0014335 3300048922 Bacteria 6214
441 Ga0496120_0001250 3300048923 Bacteria 31970
442 Ga0496120_0001337 3300048923 Bacteria 30388
443 Ga0496121_0000045 3300048924 Bacteria 336130
444 Ga0496121_0000743 3300048924 Bacteria 59998
445 Ga0496121_0037519 3300048924 Bacteria 4303
446 Ga0496121_0131079 3300048924 Bacteria 1876
447 Ga0496121_0315768 3300048924 Bacteria 1054
448 Ga0496122_0000374 3300048925 Bacteria 96140
449 Ga0496122_0025528 3300048925 Bacteria 5128
450 Ga0496122_0186607 3300048925 Bacteria 1229
451 Ga0496123_0001233 3300048926 Bacteria 37229
452 Ga0496123_0039389 3300048926 Bacteria 3307
453 Ga0496124_0022699 3300048927 Bacteria 5746
454 Ga0496124_0142336 3300048927 Bacteria 1891
455 Ga0496125_0015635 3300048928 Bacteria 7323
456 Ga0496125_0043076 3300048928 Bacteria 3837
457 Ga0496126_0000169 3300048929 Bacteria 150322
458 Ga0496126_0003516 3300048929 Bacteria 19717
459 Ga0496126_0010323 3300048929 Bacteria 9803
460 Ga0496126_0072018 3300048929 Bacteria 3075
461 Ga0496126_0091306 3300048929 Bacteria 2678
462 Ga0496126_0176597 3300048929 Bacteria 1816
463 Ga0495682_0048565 3300049460 Bacteria 1547
464 Ga0501031_0001179 3300049568 Bacteria 15915
465 Ga0501031_0091146 3300049568 Bacteria 1988
466 Ga0501031_0168800 3300049568 Bacteria 1430
467 Ga0501032_0008047 3300049569 Bacteria 7685
468 Ga0501032_0127980 3300049569 Bacteria 1677
469 Ga0501033_0006957 3300049570 Bacteria 8831
470 Ga0501033_0040160 3300049570 Bacteria 3493
471 Ga0501033_0081765 3300049570 Bacteria 2369
472 Ga0501033_0168701 3300049570 Bacteria 1572
473 Ga0501034_0000091 3300049571 Bacteria 164456
474 Ga0501034_0002029 3300049571 Bacteria 25488
475 Ga0501034_0010969 3300049571 Bacteria 9412
476 Ga0501034_0031976 3300049571 Bacteria 5345
477 Ga0501034_0070728 3300049571 Bacteria 3500
478 Ga0501036_0010107 3300049572 Bacteria 7779
479 Ga0501036_0077353 3300049572 Bacteria 2815
480 Ga0501036_0206056 3300049572 Bacteria 1653
481 Ga0501037_0014206 3300049573 Bacteria 5863
482 Ga0501037_0037219 3300049573 Bacteria 3587
483 Ga0501037_0054282 3300049573 Bacteria 2930
484 Ga0501037_0157137 3300049573 Bacteria 1622
485 Ga0501038_0017649 3300049574 Bacteria 6450
486 Ga0501038_0078887 3300049574 Bacteria 2777
487 Ga0501043_0002924 3300049579 Bacteria 14260
488 Ga0501043_0018714 3300049579 Bacteria 5434
489 Ga0501043_0031687 3300049579 Bacteria 4156
490 Ga0501043_0091289 3300049579 Bacteria 2394
491 Ga0501043_0289219 3300049579 Bacteria 1255
492 Ga0501046_0006397 3300049580 Bacteria 10444
493 Ga0501046_0078849 3300049580 Bacteria 2547
494 Ga0501047_0001140 3300049581 Bacteria 26350
495 Ga0501047_0009456 3300049581 Bacteria 9208
496 Ga0501047_0015754 3300049581 Bacteria 7205
497 Ga0501047_0041058 3300049581 Bacteria 4471
498 Ga0501047_0042030 3300049581 Bacteria 4417
499 Ga0501047_0082045 3300049581 Bacteria 3099
500 Ga0501048_0018513 3300049582 Bacteria 5120
501 Ga0501068_0157228 3300049584 Bacteria 1432
502 Ga0501068_0202825 3300049584 Bacteria 1258
503 Ga0501069_0012229 3300049585 Bacteria 4560
504 Ga0501069_0060579 3300049585 Bacteria 2113
505 Ga0501070_0000955 3300049586 Bacteria 26067
506 Ga0501070_0004034 3300049586 Bacteria 12612
507 Ga0501070_0009100 3300049586 Bacteria 8398
508 Ga0501070_0017920 3300049586 Bacteria 5945
509 Ga0501070_0018070 3300049586 Bacteria 5916
510 Ga0501070_0027783 3300049586 Bacteria 4745
511 Ga0501070_0050818 3300049586 Bacteria 3441
512 Ga0501070_0090101 3300049586 Bacteria 2538
513 Ga0501071_0006093 3300049587 Bacteria 7818
514 Ga0501073_0009510 3300049589 Bacteria 7176
515 Ga0501073_0052005 3300049589 Bacteria 2869
516 Ga0501073_0072705 3300049589 Bacteria 2395
517 Ga0501074_0014060 3300049590 Bacteria 5819
518 Ga0501074_0014638 3300049590 Bacteria 5705
519 Ga0501074_0105751 3300049590 Bacteria 2015
520 Ga0501076_0430481 3300049592 Bacteria 1086
521 Ga0501077_0008784 3300049593 Bacteria 6271
522 Ga0501225_0010582 3300049705 Bacteria 2611
523 Ga0501079_0123108 3300049741 Bacteria 2017
524 Ga0501080_0002935 3300049742 Bacteria 14979
525 Ga0501080_0004845 3300049742 Bacteria 11997
526 Ga0501080_0019215 3300049742 Bacteria 6327
527 Ga0501080_0028480 3300049742 Bacteria 5197
528 Ga0501080_0049529 3300049742 Bacteria 3910
529 Ga0501080_0051332 3300049742 Bacteria 3837
530 Ga0501035_0001816 3300049822 Bacteria 21577
531 Ga0501035_0001954 3300049822 Bacteria 20636
532 Ga0501035_0002968 3300049822 Bacteria 16311
533 Ga0501035_0013820 3300049822 Bacteria 7451
534 Ga0501035_0023994 3300049822 Bacteria 5597
535 Ga0501035_0042186 3300049822 Bacteria 4116
536 Ga0501035_0064924 3300049822 Bacteria 3243
537 Ga0501035_0179982 3300049822 Bacteria 1821
538 Ga0501044_0017427 3300049823 Bacteria 7705
539 Ga0501044_0020806 3300049823 Bacteria 7003
540 Ga0501044_0036954 3300049823 Bacteria 5106
541 Ga0501044_0044350 3300049823 Bacteria 4614
542 Ga0501044_0086361 3300049823 Bacteria 3169
543 Ga0501044_0097311 3300049823 Bacteria 2964
544 Ga0501044_0101792 3300049823 Bacteria 2889
545 Ga0501044_0131218 3300049823 Bacteria 2499
546 Ga0501044_0153508 3300049823 Bacteria 2283
547 Ga0500620_009766 3300053155 Bacteria 2492
548 Ga0500634_0000051 3300053161 Bacteria 52447
549 Ga0501084_0226009 3300054114 Bacteria 1579
550 Ga0466962_0004383 3300061719 Bacteria 6768
551 Ga0466962_0010142 3300061719 Bacteria 4524
552 Ga0466962_0090676 3300061719 Bacteria 1464

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053155 Ga0500620_009766 Ga0500620_009766_1641_2471 271
2 3300005455 Ga0070663_100000098 Ga0070663_10000009812 289
3 3300026067 Ga0207678_10003668 Ga0207678_100036682 289
4 3300026089 Ga0207648_10176343 Ga0207648_101763432 289
5 3300009093 Ga0105240_10090461 Ga0105240_100904614 296
6 3300013100 Ga0157373_10026888 Ga0157373_100268884 296
7 3300013102 Ga0157371_10046887 Ga0157371_100468872 296
8 3300013104 Ga0157370_10005088 Ga0157370_1000508811 296
9 3300013307 Ga0157372_10007646 Ga0157372_100076464 296
10 3300005367 Ga0070667_100000061 Ga0070667_1000000614 297
11 3300005539 Ga0068853_100032032 Ga0068853_1000320322 297
12 3300009177 Ga0105248_10000294 Ga0105248_1000029430 297
13 3300025941 Ga0207711_10000850 Ga0207711_1000085030 297
14 3300025986 Ga0207658_10000166 Ga0207658_1000016670 297
15 3300026041 Ga0207639_10014786 Ga0207639_100147863 297
16 3300048925 Ga0496122_0000374 Ga0496122_0000374_15852_16805 297
17 3300048926 Ga0496123_0001233 Ga0496123_0001233_23990_24943 297
18 3300048929 Ga0496126_0091306 Ga0496126_0091306_205_1158 297
19 3300048927 Ga0496124_0142336 Ga0496124_0142336_285_1220 302
20 3300026067 Ga0207678_10022074 Ga0207678_100220742 304
21 3300025949 Ga0207667_10321237 Ga0207667_103212372 306
22 3300009553 Ga0105249_10036550 Ga0105249_100365504 311
23 3300025961 Ga0207712_10000339 Ga0207712_1000033912 311
24 3300048929 Ga0496126_0010323 Ga0496126_0010323_2914_3849 311
25 iso_pu_bacteria 2593339238 2595446780 311
26 iso_pu_bacteria 2593339239 2595449543 311
27 iso_pu_bacteria 2842918807 2842919854 311
28 iso_pu_bacteria 2884338543 2884341452 311
29 iso_pu_bacteria 2919085039 2919088345 311
30 iso_pu_bacteria 2919404418 2919406072 311
31 iso_pu_bacteria 2941471342 2941472902 311
32 3300005336 Ga0070680_100001147 Ga0070680_10000114720 312
33 3300005339 Ga0070660_100019495 Ga0070660_1000194952 312
34 3300005455 Ga0070663_100006804 Ga0070663_1000068042 312
35 3300005458 Ga0070681_10000478 Ga0070681_100004782 312
36 3300005530 Ga0070679_100000159 Ga0070679_1000001598 312
37 3300005546 Ga0070696_100032241 Ga0070696_1000322413 312
38 3300005578 Ga0068854_100014236 Ga0068854_1000142361 312
39 3300025912 Ga0207707_10000032 Ga0207707_1000003214 312
40 3300025913 Ga0207695_10171773 Ga0207695_101717732 312
41 3300025917 Ga0207660_10000431 Ga0207660_1000043116 312
42 3300025921 Ga0207652_10000026 Ga0207652_1000002614 312
43 3300025949 Ga0207667_10005247 Ga0207667_1000524717 312
44 3300025981 Ga0207640_10030042 Ga0207640_100300422 312
45 3300026067 Ga0207678_10011703 Ga0207678_100117037 312
46 3300049570 Ga0501033_0081765 Ga0501033_0081765_510_1454 312
47 3300049579 Ga0501043_0289219 Ga0501043_0289219_107_1051 312
48 3300049585 Ga0501069_0060579 Ga0501069_0060579_236_1180 312
49 3300049586 Ga0501070_0009100 Ga0501070_0009100_4189_5133 312
50 3300049590 Ga0501074_0014638 Ga0501074_0014638_2951_3895 312
51 3300049741 Ga0501079_0123108 Ga0501079_0123108_940_1884 312
52 3300049742 Ga0501080_0051332 Ga0501080_0051332_2740_3684 312
53 3300049823 Ga0501044_0020806 Ga0501044_0020806_3978_4922 312
54 3300005327 Ga0070658_10020563 Ga0070658_100205632 313
55 3300005335 Ga0070666_10000005 Ga0070666_10000005104 313
56 3300005843 Ga0068860_100034319 Ga0068860_1000343192 313
57 3300009551 Ga0105238_10003835 Ga0105238_1000383516 313
58 3300013306 Ga0163162_10000489 Ga0163162_1000048912 313
59 3300025903 Ga0207680_10000005 Ga0207680_10000005461 313
60 3300025909 Ga0207705_10010341 Ga0207705_100103415 313
61 3300025924 Ga0207694_10009159 Ga0207694_100091597 313
62 3300025986 Ga0207658_10084659 Ga0207658_100846592 313
63 3300028379 Ga0268266_10000004 Ga0268266_100000041071 313
64 3300028381 Ga0268264_10056756 Ga0268264_100567563 313
65 3300031995 Ga0307409_100317436 Ga0307409_1003174362 313
66 3300033180 Ga0307510_10005230 Ga0307510_100052308 313
67 3300033180 Ga0307510_10021816 Ga0307510_100218168 313
68 3300045836 Ga0466958_0020369 Ga0466958_0020369_2179_3120 313
69 3300046471 Ga0495650_0000247 Ga0495650_0000247_3824_4774 313
70 3300046660 Ga0495625_0005535 Ga0495625_0005535_4978_5928 313
71 3300048924 Ga0496121_0315768 Ga0496121_0315768_43_993 313
72 3300048928 Ga0496125_0043076 Ga0496125_0043076_1776_2726 313
73 3300048929 Ga0496126_0176597 Ga0496126_0176597_574_1524 313
74 iso_pu_bacteria 2643221562 2643830300 313
75 iso_pu_bacteria 2687453130 2687583745 313
76 iso_pu_bacteria 2747842501 2748016040 313
77 iso_pu_bacteria 2857442823 2857446159 313
78 iso_pu_bacteria 2919130084 2919131369 313
79 iso_pu_bacteria 2928963466 2928967717 313
80 iso_pu_bacteria 2929195423 2929198212 313
81 3300005262 Ga0065165_1000118 Ga0065165_10001189 314
82 3300005344 Ga0070661_100122322 Ga0070661_1001223222 314
83 3300005614 Ga0068856_100004196 Ga0068856_1000041968 314
84 3300005618 Ga0068864_100022244 Ga0068864_1000222443 314
85 3300005841 Ga0068863_100046769 Ga0068863_1000467692 314
86 3300010375 Ga0105239_10067311 Ga0105239_100673112 314
87 3300010375 Ga0105239_10106232 Ga0105239_101062322 314
88 3300011119 Ga0105246_10003959 Ga0105246_100039597 314
89 3300013104 Ga0157370_10000293 Ga0157370_1000029343 314
90 3300013105 Ga0157369_10012900 Ga0157369_100129004 314
91 3300013296 Ga0157374_10019015 Ga0157374_100190151 314
92 3300014968 Ga0157379_10006837 Ga0157379_100068372 314
93 3300015265 Ga0182005_1000028 Ga0182005_1000028162 314
94 3300015265 Ga0182005_1004772 Ga0182005_10047722 314
95 3300025226 Ga0209674_102139 Ga0209674_1021393 314
96 3300025233 Ga0209437_102166 Ga0209437_1021663 314
97 3300025233 Ga0209437_103650 Ga0209437_1036501 314
98 3300025254 Ga0209148_1001285 Ga0209148_100128513 314
99 3300025299 Ga0209256_1004365 Ga0209256_10043656 314
100 3300025302 Ga0207426_1011861 Ga0207426_10118612 314
101 3300025904 Ga0207647_10000747 Ga0207647_1000074719 314
102 3300025920 Ga0207649_10157664 Ga0207649_101576642 314
103 3300025924 Ga0207694_10074068 Ga0207694_100740682 314
104 3300026078 Ga0207702_10008548 Ga0207702_100085486 314
105 3300026088 Ga0207641_10078202 Ga0207641_100782023 314
106 3300026095 Ga0207676_10066337 Ga0207676_100663372 314
107 3300031911 Ga0307412_10003347 Ga0307412_100033474 314
108 3300037312 Ga0395899_0219217 Ga0395899_0219217_222_1169 314
109 3300037418 Ga0395900_0007251 Ga0395900_0007251_8784_9731 314
110 3300037466 Ga0395898_0003336 Ga0395898_0003336_16607_17554 314
111 3300038443 Ga0395901_0004732 Ga0395901_0004732_4181_5128 314
112 3300038443 Ga0395901_0005132 Ga0395901_0005132_5121_6068 314
113 3300039437 Ga0436365_0838762 Ga0436365_0838762_805_1752 314
114 3300041404 Ga0439436_0000156 Ga0439436_0000156_5104_6051 314
115 3300046492 Ga0495585_0000104 Ga0495585_0000104_37551_38498 314
116 3300046501 Ga0495607_0008360 Ga0495607_0008360_3269_4216 314
117 3300046507 Ga0495606_0005269 Ga0495606_0005269_9996_10943 314
118 3300046512 Ga0495610_0002689 Ga0495610_0002689_3877_4824 314
119 3300046524 Ga0495648_0000914 Ga0495648_0000914_12457_13404 314
120 3300046665 Ga0495661_0000199 Ga0495661_0000199_61783_62730 314
121 3300046691 Ga0495670_0008599 Ga0495670_0008599_1528_2475 314
122 3300046810 Ga0495660_0000583 Ga0495660_0000583_23151_24098 314
123 3300047469 Ga0495673_0000004 Ga0495673_0000004_91182_92129 314
124 3300047472 Ga0495686_0000017 Ga0495686_0000017_166912_167859 314
125 3300048909 Ga0496106_0007333 Ga0496106_0007333_3344_4291 314
126 3300048918 Ga0496115_0000073 Ga0496115_0000073_46230_47180 314
127 3300048921 Ga0496118_0004645 Ga0496118_0004645_4972_5919 314
128 3300048921 Ga0496118_0019362 Ga0496118_0019362_67_1014 314
129 3300048924 Ga0496121_0000045 Ga0496121_0000045_329839_330786 314
130 3300048925 Ga0496122_0186607 Ga0496122_0186607_171_1118 314
131 3300048928 Ga0496125_0015635 Ga0496125_0015635_4221_5168 314
132 3300048929 Ga0496126_0000169 Ga0496126_0000169_55429_56379 314
133 3300049569 Ga0501032_0127980 Ga0501032_0127980_171_1121 314
134 3300049571 Ga0501034_0002029 Ga0501034_0002029_1383_2333 314
135 3300049573 Ga0501037_0054282 Ga0501037_0054282_44_1006 314
136 3300049580 Ga0501046_0078849 Ga0501046_0078849_806_1756 314
137 3300049581 Ga0501047_0001140 Ga0501047_0001140_20196_21146 314
138 3300049581 Ga0501047_0015754 Ga0501047_0015754_2912_3859 314
139 3300049581 Ga0501047_0041058 Ga0501047_0041058_2282_3244 314
140 3300049584 Ga0501068_0157228 Ga0501068_0157228_232_1182 314
141 3300049586 Ga0501070_0004034 Ga0501070_0004034_233_1183 314
142 3300049586 Ga0501070_0017920 Ga0501070_0017920_3510_4472 314
143 3300049587 Ga0501071_0006093 Ga0501071_0006093_254_1216 314
144 3300049590 Ga0501074_0014060 Ga0501074_0014060_3108_4070 314
145 3300049592 Ga0501076_0430481 Ga0501076_0430481_25_987 314
146 3300049742 Ga0501080_0002935 Ga0501080_0002935_10989_11939 314
147 3300049742 Ga0501080_0019215 Ga0501080_0019215_1082_2044 314
148 3300049822 Ga0501035_0179982 Ga0501035_0179982_281_1243 314
149 3300049823 Ga0501044_0036954 Ga0501044_0036954_1889_2851 314
150 3300054114 Ga0501084_0226009 Ga0501084_0226009_21_965 314
151 iso_pu_bacteria 2739367700 2739730279 314
152 iso_pu_bacteria 2818991440 2819563934 314
153 iso_pu_bacteria 2842780639 2842783844 314
154 iso_pu_bacteria 2884411467 2884412122 314
155 iso_pu_bacteria 2904463128 2904464570 314
156 3300003316 rootH1_10025459 rootH1_100254594 315
157 3300013307 Ga0157372_10056190 Ga0157372_100561903 315
158 3300014325 Ga0163163_10443403 Ga0163163_104434032 315
159 3300020081 Ga0206354_10560480 Ga0206354_105604802 315
160 3300032004 Ga0307414_10008972 Ga0307414_100089723 315
161 3300037466 Ga0395898_0012224 Ga0395898_0012224_2367_3317 315
162 3300038443 Ga0395901_0194078 Ga0395901_0194078_547_1497 315
163 3300049581 Ga0501047_0009456 Ga0501047_0009456_7986_8942 315
164 3300049585 Ga0501069_0012229 Ga0501069_0012229_2935_3891 315
165 3300049586 Ga0501070_0018070 Ga0501070_0018070_3073_4029 315
166 3300049586 Ga0501070_0027783 Ga0501070_0027783_3674_4630 315
167 3300049586 Ga0501070_0050818 Ga0501070_0050818_1775_2731 315
168 3300049586 Ga0501070_0090101 Ga0501070_0090101_414_1370 315
169 3300049589 Ga0501073_0052005 Ga0501073_0052005_1813_2769 315
170 3300049742 Ga0501080_0004845 Ga0501080_0004845_2947_3903 315
171 3300049822 Ga0501035_0001954 Ga0501035_0001954_3054_4013 315
172 3300049822 Ga0501035_0013820 Ga0501035_0013820_3323_4279 315
173 3300049823 Ga0501044_0044350 Ga0501044_0044350_1120_2076 315
174 iso_pu_bacteria 8002869464 8002872338 315
175 3300001915 JGI24741J21665_1004716 JGI24741J21665_10047163 316
176 3300001979 JGI24740J21852_10003993 JGI24740J21852_100039934 316
177 3300002705 JGI25156J39149_1000463 JGI25156J39149_100046324 316
178 3300002705 JGI25156J39149_1013976 JGI25156J39149_10139762 316
179 3300002737 JGI25162J39368_1000895 JGI25162J39368_100089519 316
180 3300002737 JGI25162J39368_1001410 JGI25162J39368_10014109 316
181 3300002741 JGI25157J39369_1000229 JGI25157J39369_100022926 316
182 3300002741 JGI25157J39369_1004101 JGI25157J39369_10041011 316
183 3300002772 JGI25164J39214_1000045 JGI25164J39214_100004568 316
184 3300003214 JGI25165J46597_1000072 JGI25165J46597_100007268 316
185 3300003760 Ga0055527_1001498 Ga0055527_10014984 316
186 3300003761 Ga0055535_1000831 Ga0055535_100083117 316
187 3300003762 Ga0055542_1000242 Ga0055542_10002429 316
188 3300003762 Ga0055542_1000349 Ga0055542_100034941 316
189 3300003763 Ga0055529_1000204 Ga0055529_100020425 316
190 3300003856 Ga0058692_1000012 Ga0058692_100001298 316
191 3300005337 Ga0070682_100005899 Ga0070682_1000058996 316
192 3300005347 Ga0070668_100269442 Ga0070668_1002694422 316
193 3300005455 Ga0070663_100230760 Ga0070663_1002307602 316
194 3300005457 Ga0070662_100015623 Ga0070662_1000156233 316
195 3300005535 Ga0070684_100015112 Ga0070684_1000151126 316
196 3300005539 Ga0068853_100249431 Ga0068853_1002494311 316
197 3300005546 Ga0070696_100021589 Ga0070696_1000215893 316
198 3300005578 Ga0068854_100135998 Ga0068854_1001359982 316
199 3300005614 Ga0068856_100030189 Ga0068856_1000301892 316
200 3300005616 Ga0068852_100103211 Ga0068852_1001032112 316
201 3300005834 Ga0068851_10013971 Ga0068851_100139712 316
202 3300009093 Ga0105240_10381373 Ga0105240_103813732 316
203 3300009174 Ga0105241_10273475 Ga0105241_102734752 316
204 3300009545 Ga0105237_10000007 Ga0105237_10000007134 316
205 3300009545 Ga0105237_10000637 Ga0105237_100006373 316
206 3300009551 Ga0105238_10054370 Ga0105238_100543703 316
207 3300009551 Ga0105238_10073353 Ga0105238_100733532 316
208 3300009551 Ga0105238_10210926 Ga0105238_102109261 316
209 3300009553 Ga0105249_10000272 Ga0105249_1000027244 316
210 3300013104 Ga0157370_10007298 Ga0157370_100072989 316
211 3300013308 Ga0157375_10014055 Ga0157375_100140554 316
212 3300015685 Ga0183369_1007 Ga0183369_1007401 316
213 3300017792 Ga0163161_10086921 Ga0163161_100869213 316
214 3300020610 Ga0154015_1237743 Ga0154015_12377432 316
215 3300025228 Ga0209672_100277 Ga0209672_10027723 316
216 3300025231 Ga0207427_100055 Ga0207427_100055143 316
217 3300025231 Ga0207427_103884 Ga0207427_1038843 316
218 3300025233 Ga0209437_100161 Ga0209437_10016186 316
219 3300025233 Ga0209437_100224 Ga0209437_10022420 316
220 3300025242 Ga0209258_100186 Ga0209258_10018658 316
221 3300025246 Ga0209646_1000760 Ga0209646_100076010 316
222 3300025250 Ga0209026_1000375 Ga0209026_100037511 316
223 3300025250 Ga0209026_1001302 Ga0209026_10013023 316
224 3300025254 Ga0209148_1000005 Ga0209148_1000005966 316
225 3300025254 Ga0209148_1000073 Ga0209148_100007384 316
226 3300025256 Ga0209759_1000103 Ga0209759_100010387 316
227 3300025256 Ga0209759_1013336 Ga0209759_10133362 316
228 3300025261 Ga0209233_1000063 Ga0209233_1000063293 316
229 3300025272 Ga0209455_1000177 Ga0209455_100017758 316
230 3300025272 Ga0209455_1000344 Ga0209455_100034410 316
231 3300025321 Ga0207656_10046545 Ga0207656_100465452 316
232 3300025904 Ga0207647_10000084 Ga0207647_1000008432 316
233 3300025909 Ga0207705_10008538 Ga0207705_100085383 316
234 3300025909 Ga0207705_10015167 Ga0207705_100151674 316
235 3300025911 Ga0207654_10004928 Ga0207654_100049284 316
236 3300025912 Ga0207707_10002692 Ga0207707_100026928 316
237 3300025913 Ga0207695_10003349 Ga0207695_1000334911 316
238 3300025913 Ga0207695_10019259 Ga0207695_100192597 316
239 3300025914 Ga0207671_10000074 Ga0207671_10000074123 316
240 3300025914 Ga0207671_10009987 Ga0207671_100099874 316
241 3300025917 Ga0207660_10002224 Ga0207660_100022245 316
242 3300025919 Ga0207657_10001633 Ga0207657_1000163313 316
243 3300025920 Ga0207649_10008395 Ga0207649_100083952 316
244 3300025924 Ga0207694_10011255 Ga0207694_100112556 316
245 3300025924 Ga0207694_10098035 Ga0207694_100980352 316
246 3300025924 Ga0207694_10332149 Ga0207694_103321491 316
247 3300025925 Ga0207650_10169429 Ga0207650_101694292 316
248 3300025933 Ga0207706_10026570 Ga0207706_100265703 316
249 3300025944 Ga0207661_10174231 Ga0207661_101742312 316
250 3300025949 Ga0207667_10011214 Ga0207667_100112142 316
251 3300025961 Ga0207712_10001053 Ga0207712_100010534 316
252 3300025972 Ga0207668_10204173 Ga0207668_102041732 316
253 3300025981 Ga0207640_10006105 Ga0207640_100061051 316
254 3300025981 Ga0207640_10113448 Ga0207640_101134482 316
255 3300026067 Ga0207678_10002211 Ga0207678_1000221113 316
256 3300026067 Ga0207678_10111048 Ga0207678_101110482 316
257 3300026116 Ga0207674_10002798 Ga0207674_1000279810 316
258 3300026142 Ga0207698_10100907 Ga0207698_101009072 316
259 3300027312 Ga0209371_1000007 Ga0209371_1000007292 316
260 3300030500 Ga0268256_1000008 Ga0268256_1000008658 316
261 3300031730 Ga0307516_10106044 Ga0307516_101060443 316
262 3300031911 Ga0307412_10100670 Ga0307412_101006701 316
263 3300037312 Ga0395899_0085820 Ga0395899_0085820_1300_2253 316
264 3300037418 Ga0395900_0047569 Ga0395900_0047569_3442_4395 316
265 3300037466 Ga0395898_0000049 Ga0395898_0000049_216015_216968 316
266 3300038443 Ga0395901_0010230 Ga0395901_0010230_463_1416 316
267 3300038443 Ga0395901_0165825 Ga0395901_0165825_149_1102 316
268 3300041459 Ga0451800_0027863 Ga0451800_0027863_636_1589 316
269 3300041459 Ga0451800_0163290 Ga0451800_0163290_2829_3782 316
270 3300041462 Ga0451806_619891 Ga0451806_619891_1280_2233 316
271 3300041463 Ga0451804_0794885 Ga0451804_0794885_1344_2297 316
272 3300041486 Ga0451807_1039361 Ga0451807_1039361_3936_4889 316
273 3300041512 Ga0451853_2514762 Ga0451853_2514762_176_1129 316
274 3300042438 Ga0439459_0006387 Ga0439459_0006387_618_1568 316
275 3300044693 Ga0466961_0004179 Ga0466961_0004179_4777_5736 316
276 3300044694 Ga0466963_0162984 Ga0466963_0162984_146_1099 316
277 3300046453 Ga0495627_025570 Ga0495627_025570_66_1019 316
278 3300046558 Ga0495633_0032712 Ga0495633_0032712_42_995 316
279 3300048920 Ga0496117_0098077 Ga0496117_0098077_120_1073 316
280 3300048921 Ga0496118_0015853 Ga0496118_0015853_5930_6883 316
281 3300048927 Ga0496124_0022699 Ga0496124_0022699_821_1774 316
282 3300049705 Ga0501225_0010582 Ga0501225_0010582_157_1107 316
283 3300053161 Ga0500634_0000051 Ga0500634_0000051_15366_16319 316
284 iso_pu_bacteria 2537561836 2538832291 316
285 iso_pu_bacteria 2643221579 2643908028 316
286 iso_pu_bacteria 2643221581 2643915770 316
287 iso_pu_bacteria 2895498888 2895498956 316
288 iso_pu_bacteria 2895511927 2895511995 316
289 iso_pu_bacteria 2895522137 2895524939 316
290 iso_pu_bacteria 2895525241 2895527938 316
291 iso_pu_bacteria 2923516293 2923518677 316
292 3300001990 JGI24737J22298_10009376 JGI24737J22298_100093762 317
293 3300002067 JGI24735J21928_10002797 JGI24735J21928_100027973 317
294 3300002705 JGI25156J39149_1013681 JGI25156J39149_10136811 317
295 3300002737 JGI25162J39368_1000163 JGI25162J39368_100016352 317
296 3300002741 JGI25157J39369_1000575 JGI25157J39369_100057514 317
297 3300002771 JGI25163J39215_1000538 JGI25163J39215_100053810 317
298 3300002772 JGI25164J39214_1000285 JGI25164J39214_100028513 317
299 3300003214 JGI25165J46597_1000215 JGI25165J46597_100021526 317
300 3300003320 rootH2_10012587 rootH2_100125873 317
301 3300003751 Ga0055538_1001046 Ga0055538_10010466 317
302 3300003761 Ga0055535_1000124 Ga0055535_100012426 317
303 3300003761 Ga0055535_1008706 Ga0055535_10087062 317
304 3300003762 Ga0055542_1000197 Ga0055542_100019726 317
305 3300003763 Ga0055529_1000197 Ga0055529_100019756 317
306 3300005327 Ga0070658_10094950 Ga0070658_100949502 317
307 3300005336 Ga0070680_100101701 Ga0070680_1001017012 317
308 3300005339 Ga0070660_100010300 Ga0070660_1000103005 317
309 3300005355 Ga0070671_100313027 Ga0070671_1003130272 317
310 3300005366 Ga0070659_100359423 Ga0070659_1003594231 317
311 3300005367 Ga0070667_100130011 Ga0070667_1001300112 317
312 3300005455 Ga0070663_100217132 Ga0070663_1002171322 317
313 3300005458 Ga0070681_10006071 Ga0070681_1000607111 317
314 3300005458 Ga0070681_10008891 Ga0070681_100088913 317
315 3300005458 Ga0070681_10051954 Ga0070681_100519543 317
316 3300005458 Ga0070681_10151614 Ga0070681_101516142 317
317 3300005530 Ga0070679_100005521 Ga0070679_10000552111 317
318 3300005539 Ga0068853_100000998 Ga0068853_1000009982 317
319 3300005546 Ga0070696_100013121 Ga0070696_1000131214 317
320 3300005546 Ga0070696_100019136 Ga0070696_1000191363 317
321 3300005547 Ga0070693_100024182 Ga0070693_1000241822 317
322 3300005563 Ga0068855_100054823 Ga0068855_1000548232 317
323 3300005577 Ga0068857_100046007 Ga0068857_1000460072 317
324 3300005841 Ga0068863_100040023 Ga0068863_1000400233 317
325 3300009093 Ga0105240_10008662 Ga0105240_1000866211 317
326 3300009093 Ga0105240_10028816 Ga0105240_100288162 317
327 3300009174 Ga0105241_10358131 Ga0105241_103581312 317
328 3300010375 Ga0105239_10000030 Ga0105239_10000030145 317
329 3300010375 Ga0105239_10039254 Ga0105239_100392544 317
330 3300010375 Ga0105239_10065148 Ga0105239_100651482 317
331 3300013100 Ga0157373_10248043 Ga0157373_102480432 317
332 3300013104 Ga0157370_10167371 Ga0157370_101673712 317
333 3300013307 Ga0157372_10011205 Ga0157372_100112057 317
334 3300013307 Ga0157372_10505534 Ga0157372_105055341 317
335 3300014497 Ga0182008_10033442 Ga0182008_100334422 317
336 3300014969 Ga0157376_10038489 Ga0157376_100384894 317
337 3300015687 Ga0183368_1003 Ga0183368_1003746 317
338 3300025206 Ga0209435_102200 Ga0209435_1022002 317
339 3300025206 Ga0209435_108134 Ga0209435_1081342 317
340 3300025224 Ga0209784_100120 Ga0209784_10012024 317
341 3300025226 Ga0209674_100012 Ga0209674_100012497 317
342 3300025228 Ga0209672_100911 Ga0209672_1009116 317
343 3300025231 Ga0207427_100013 Ga0207427_100013512 317
344 3300025233 Ga0209437_100015 Ga0209437_10001524 317
345 3300025242 Ga0209258_100049 Ga0209258_100049131 317
346 3300025242 Ga0209258_103422 Ga0209258_1034222 317
347 3300025246 Ga0209646_1000467 Ga0209646_100046712 317
348 3300025250 Ga0209026_1000204 Ga0209026_100020424 317
349 3300025254 Ga0209148_1000010 Ga0209148_1000010889 317
350 3300025256 Ga0209759_1000672 Ga0209759_100067224 317
351 3300025261 Ga0209233_1000009 Ga0209233_1000009281 317
352 3300025261 Ga0209233_1011780 Ga0209233_10117802 317
353 3300025272 Ga0209455_1000082 Ga0209455_100008224 317
354 3300025272 Ga0209455_1006368 Ga0209455_10063682 317
355 3300025904 Ga0207647_10010317 Ga0207647_100103174 317
356 3300025909 Ga0207705_10074272 Ga0207705_100742722 317
357 3300025909 Ga0207705_10081318 Ga0207705_100813181 317
358 3300025912 Ga0207707_10003858 Ga0207707_1000385811 317
359 3300025912 Ga0207707_10011681 Ga0207707_100116817 317
360 3300025912 Ga0207707_10058093 Ga0207707_100580932 317
361 3300025913 Ga0207695_10001749 Ga0207695_1000174925 317
362 3300025913 Ga0207695_10004269 Ga0207695_100042697 317
363 3300025917 Ga0207660_10045926 Ga0207660_100459263 317
364 3300025917 Ga0207660_10187936 Ga0207660_101879362 317
365 3300025921 Ga0207652_10005288 Ga0207652_100052889 317
366 3300025932 Ga0207690_10001160 Ga0207690_1000116014 317
367 3300025949 Ga0207667_10251913 Ga0207667_102519132 317
368 3300025961 Ga0207712_10026904 Ga0207712_100269043 317
369 3300025981 Ga0207640_10031945 Ga0207640_100319452 317
370 3300026041 Ga0207639_10012112 Ga0207639_100121122 317
371 3300026041 Ga0207639_10022813 Ga0207639_100228134 317
372 3300026067 Ga0207678_10120294 Ga0207678_101202942 317
373 3300026088 Ga0207641_10064929 Ga0207641_100649293 317
374 3300026116 Ga0207674_10018482 Ga0207674_100184825 317
375 3300026116 Ga0207674_10054334 Ga0207674_100543342 317
376 3300026116 Ga0207674_10105380 Ga0207674_101053802 317
377 3300026142 Ga0207698_10002926 Ga0207698_100029269 317
378 3300032005 Ga0307411_10075577 Ga0307411_100755772 317
379 3300037312 Ga0395899_0016207 Ga0395899_0016207_2880_3851 317
380 3300037418 Ga0395900_0005984 Ga0395900_0005984_7858_8829 317
381 3300037418 Ga0395900_0008909 Ga0395900_0008909_9264_10217 317
382 3300037466 Ga0395898_0004927 Ga0395898_0004927_5955_6926 317
383 3300038443 Ga0395901_0009707 Ga0395901_0009707_1938_2894 317
384 3300046460 Ga0495638_0000234 Ga0495638_0000234_51775_52731 317
385 3300046507 Ga0495606_0000401 Ga0495606_0000401_59309_60265 317
386 3300046557 Ga0495622_0006636 Ga0495622_0006636_675_1631 317
387 3300046660 Ga0495625_0016176 Ga0495625_0016176_1582_2538 317
388 3300046694 Ga0495649_0000553 Ga0495649_0000553_8414_9370 317
389 3300048903 Ga0496100_0115146 Ga0496100_0115146_877_1833 317
390 3300048907 Ga0496104_0030305 Ga0496104_0030305_2393_3349 317
391 3300048908 Ga0496105_0003042 Ga0496105_0003042_2952_3908 317
392 3300048909 Ga0496106_0111966 Ga0496106_0111966_469_1425 317
393 3300048910 Ga0496107_0094468 Ga0496107_0094468_483_1439 317
394 3300048911 Ga0496108_0158003 Ga0496108_0158003_804_1790 317
395 3300048916 Ga0496113_0014146 Ga0496113_0014146_272_1228 317
396 3300048916 Ga0496113_0193342 Ga0496113_0193342_192_1178 317
397 3300048918 Ga0496115_0000206 Ga0496115_0000206_12009_12965 317
398 3300048918 Ga0496115_0000946 Ga0496115_0000946_9641_10597 317
399 3300048920 Ga0496117_0008476 Ga0496117_0008476_7378_8334 317
400 3300048920 Ga0496117_0022641 Ga0496117_0022641_1426_2382 317
401 3300048920 Ga0496117_0025189 Ga0496117_0025189_1014_1970 317
402 3300048921 Ga0496118_0003118 Ga0496118_0003118_10928_11884 317
403 3300048921 Ga0496118_0006962 Ga0496118_0006962_1190_2146 317
404 3300048922 Ga0496119_0001081 Ga0496119_0001081_8470_9426 317
405 3300048922 Ga0496119_0014335 Ga0496119_0014335_4526_5482 317
406 3300048923 Ga0496120_0001250 Ga0496120_0001250_25029_25985 317
407 3300048923 Ga0496120_0001337 Ga0496120_0001337_23390_24346 317
408 3300048924 Ga0496121_0000743 Ga0496121_0000743_28763_29719 317
409 3300048924 Ga0496121_0037519 Ga0496121_0037519_1989_2945 317
410 3300048924 Ga0496121_0131079 Ga0496121_0131079_764_1720 317
411 3300048929 Ga0496126_0003516 Ga0496126_0003516_12783_13739 317
412 3300048929 Ga0496126_0072018 Ga0496126_0072018_1300_2256 317
413 3300049460 Ga0495682_0048565 Ga0495682_0048565_125_1081 317
414 3300049568 Ga0501031_0001179 Ga0501031_0001179_9412_10392 317
415 3300049568 Ga0501031_0091146 Ga0501031_0091146_250_1215 317
416 3300049568 Ga0501031_0168800 Ga0501031_0168800_31_996 317
417 3300049569 Ga0501032_0008047 Ga0501032_0008047_3029_4009 317
418 3300049570 Ga0501033_0006957 Ga0501033_0006957_5675_6655 317
419 3300049570 Ga0501033_0040160 Ga0501033_0040160_598_1566 317
420 3300049570 Ga0501033_0168701 Ga0501033_0168701_420_1388 317
421 3300049571 Ga0501034_0000091 Ga0501034_0000091_18839_19792 317
422 3300049571 Ga0501034_0010969 Ga0501034_0010969_3830_4810 317
423 3300049571 Ga0501034_0031976 Ga0501034_0031976_501_1466 317
424 3300049571 Ga0501034_0070728 Ga0501034_0070728_1757_2722 317
425 3300049572 Ga0501036_0010107 Ga0501036_0010107_3861_4841 317
426 3300049572 Ga0501036_0077353 Ga0501036_0077353_1123_2091 317
427 3300049572 Ga0501036_0206056 Ga0501036_0206056_556_1521 317
428 3300049573 Ga0501037_0014206 Ga0501037_0014206_1313_2293 317
429 3300049573 Ga0501037_0037219 Ga0501037_0037219_2156_3121 317
430 3300049573 Ga0501037_0157137 Ga0501037_0157137_117_1085 317
431 3300049574 Ga0501038_0017649 Ga0501038_0017649_3054_4034 317
432 3300049574 Ga0501038_0078887 Ga0501038_0078887_1510_2478 317
433 3300049579 Ga0501043_0002924 Ga0501043_0002924_10163_11143 317
434 3300049579 Ga0501043_0018714 Ga0501043_0018714_3025_3993 317
435 3300049579 Ga0501043_0031687 Ga0501043_0031687_319_1284 317
436 3300049579 Ga0501043_0091289 Ga0501043_0091289_1227_2195 317
437 3300049580 Ga0501046_0006397 Ga0501046_0006397_5966_6946 317
438 3300049581 Ga0501047_0042030 Ga0501047_0042030_2022_3002 317
439 3300049581 Ga0501047_0082045 Ga0501047_0082045_1244_2209 317
440 3300049584 Ga0501068_0202825 Ga0501068_0202825_119_1099 317
441 3300049586 Ga0501070_0000955 Ga0501070_0000955_5682_6668 317
442 3300049589 Ga0501073_0009510 Ga0501073_0009510_4306_5286 317
443 3300049589 Ga0501073_0072705 Ga0501073_0072705_1295_2263 317
444 3300049590 Ga0501074_0105751 Ga0501074_0105751_134_1120 317
445 3300049593 Ga0501077_0008784 Ga0501077_0008784_2462_3448 317
446 3300049742 Ga0501080_0028480 Ga0501080_0028480_687_1667 317
447 3300049742 Ga0501080_0049529 Ga0501080_0049529_503_1459 317
448 3300049822 Ga0501035_0001816 Ga0501035_0001816_14407_15372 317
449 3300049822 Ga0501035_0002968 Ga0501035_0002968_9726_10706 317
450 3300049822 Ga0501035_0023994 Ga0501035_0023994_4356_5321 317
451 3300049822 Ga0501035_0064924 Ga0501035_0064924_2041_3009 317
452 3300049823 Ga0501044_0017427 Ga0501044_0017427_5606_6586 317
453 3300049823 Ga0501044_0086361 Ga0501044_0086361_640_1605 317
454 3300049823 Ga0501044_0101792 Ga0501044_0101792_1262_2230 317
455 3300049823 Ga0501044_0131218 Ga0501044_0131218_504_1472 317
456 3300049823 Ga0501044_0153508 Ga0501044_0153508_261_1226 317
457 iso_pu_bacteria 2818991457 2819659931 317
458 iso_pu_bacteria 2852684882 2852685244 317
459 3300005344 Ga0070661_100083337 Ga0070661_1000833372 318
460 3300005535 Ga0070684_100268297 Ga0070684_1002682972 318
461 3300005547 Ga0070693_100057716 Ga0070693_1000577162 318
462 3300005614 Ga0068856_100000416 Ga0068856_10000041620 318
463 3300005617 Ga0068859_100507566 Ga0068859_1005075662 318
464 3300005618 Ga0068864_100175186 Ga0068864_1001751862 318
465 3300005842 Ga0068858_100237183 Ga0068858_1002371832 318
466 3300006237 Ga0097621_100039782 Ga0097621_1000397822 318
467 3300006881 Ga0068865_100217977 Ga0068865_1002179772 318
468 3300006931 Ga0097620_100507600 Ga0097620_1005076002 318
469 3300009177 Ga0105248_10216895 Ga0105248_102168952 318
470 3300013307 Ga0157372_10329461 Ga0157372_103294612 318
471 3300014325 Ga0163163_10053838 Ga0163163_100538383 318
472 3300025913 Ga0207695_10149108 Ga0207695_101491082 318
473 3300026078 Ga0207702_10000185 Ga0207702_1000018562 318
474 3300026078 Ga0207702_10184847 Ga0207702_101848472 318
475 3300037471 Ga0395905_0084163 Ga0395905_0084163_1300_2289 318
476 3300044684 Ga0466966_0013296 Ga0466966_0013296_996_1955 318
477 3300044719 Ga0466971_0019590 Ga0466971_0019590_1109_2068 318
478 3300044901 Ga0466960_0005921 Ga0466960_0005921_3025_3999 318
479 3300049582 Ga0501048_0018513 Ga0501048_0018513_3460_4419 318
480 3300049822 Ga0501035_0042186 Ga0501035_0042186_2045_3004 318
481 3300049823 Ga0501044_0097311 Ga0501044_0097311_898_1857 318
482 3300061719 Ga0466962_0004383 Ga0466962_0004383_1105_2064 318
483 3300002737 JGI25162J39368_1001323 JGI25162J39368_10013239 319
484 3300002741 JGI25157J39369_1000654 JGI25157J39369_100065414 319
485 3300002772 JGI25164J39214_1000485 JGI25164J39214_10004859 319
486 3300002772 JGI25164J39214_1000690 JGI25164J39214_10006907 319
487 3300003214 JGI25165J46597_1000812 JGI25165J46597_10008129 319
488 3300003760 Ga0055527_1000209 Ga0055527_100020921 319
489 3300003761 Ga0055535_1000451 Ga0055535_100045121 319
490 3300003762 Ga0055542_1000466 Ga0055542_100046621 319
491 3300003763 Ga0055529_1000671 Ga0055529_10006716 319
492 3300005336 Ga0070680_100054615 Ga0070680_1000546152 319
493 3300005341 Ga0070691_10011407 Ga0070691_100114073 319
494 3300005344 Ga0070661_100006026 Ga0070661_1000060268 319
495 3300005345 Ga0070692_10000760 Ga0070692_100007607 319
496 3300005435 Ga0070714_100053430 Ga0070714_1000534302 319
497 3300005436 Ga0070713_100230093 Ga0070713_1002300932 319
498 3300005458 Ga0070681_10002606 Ga0070681_100026066 319
499 3300005458 Ga0070681_10181467 Ga0070681_101814672 319
500 3300005530 Ga0070679_100001102 Ga0070679_10000110213 319
501 3300005530 Ga0070679_100258561 Ga0070679_1002585612 319
502 3300005535 Ga0070684_100106204 Ga0070684_1001062042 319
503 3300005539 Ga0068853_100015777 Ga0068853_1000157772 319
504 3300005563 Ga0068855_100042451 Ga0068855_1000424512 319
505 3300005578 Ga0068854_100017938 Ga0068854_1000179385 319
506 3300005578 Ga0068854_100198100 Ga0068854_1001981002 319
507 3300005614 Ga0068856_100132041 Ga0068856_1001320412 319
508 3300009093 Ga0105240_10090630 Ga0105240_100906303 319
509 3300009545 Ga0105237_10071696 Ga0105237_100716962 319
510 3300009551 Ga0105238_10036497 Ga0105238_100364973 319
511 3300013102 Ga0157371_10010073 Ga0157371_100100735 319
512 3300013104 Ga0157370_10001525 Ga0157370_1000152520 319
513 3300013307 Ga0157372_10003283 Ga0157372_1000328312 319
514 3300014497 Ga0182008_10007901 Ga0182008_100079011 319
515 3300020082 Ga0206353_10613403 Ga0206353_106134031 319
516 3300025226 Ga0209674_101824 Ga0209674_1018244 319
517 3300025228 Ga0209672_100005 Ga0209672_100005700 319
518 3300025230 Ga0209563_100023 Ga0209563_100023359 319
519 3300025231 Ga0207427_100244 Ga0207427_10024424 319
520 3300025231 Ga0207427_100248 Ga0207427_10024823 319
521 3300025233 Ga0209437_100020 Ga0209437_100020383 319
522 3300025233 Ga0209437_100079 Ga0209437_10007921 319
523 3300025242 Ga0209258_100006 Ga0209258_100006700 319
524 3300025250 Ga0209026_1000037 Ga0209026_1000037104 319
525 3300025254 Ga0209148_1000012 Ga0209148_1000012700 319
526 3300025261 Ga0209233_1000020 Ga0209233_1000020242 319
527 3300025261 Ga0209233_1000147 Ga0209233_100014723 319
528 3300025272 Ga0209455_1000008 Ga0209455_1000008700 319
529 3300025909 Ga0207705_10001128 Ga0207705_1000112814 319
530 3300025912 Ga0207707_10000274 Ga0207707_1000027440 319
531 3300025912 Ga0207707_10161666 Ga0207707_101616662 319
532 3300025913 Ga0207695_10003804 Ga0207695_1000380410 319
533 3300025914 Ga0207671_10103904 Ga0207671_101039042 319
534 3300025917 Ga0207660_10001041 Ga0207660_1000104113 319
535 3300025917 Ga0207660_10014264 Ga0207660_100142642 319
536 3300025919 Ga0207657_10002096 Ga0207657_1000209610 319
537 3300025921 Ga0207652_10000715 Ga0207652_1000071517 319
538 3300025921 Ga0207652_10234641 Ga0207652_102346412 319
539 3300025928 Ga0207700_10141960 Ga0207700_101419602 319
540 3300025929 Ga0207664_10098555 Ga0207664_100985553 319
541 3300025932 Ga0207690_10005361 Ga0207690_100053614 319
542 3300025949 Ga0207667_10002690 Ga0207667_100026907 319
543 3300025981 Ga0207640_10002743 Ga0207640_100027438 319
544 3300025981 Ga0207640_10008198 Ga0207640_100081986 319
545 3300026041 Ga0207639_10002830 Ga0207639_100028309 319
546 3300026067 Ga0207678_10001403 Ga0207678_1000140314 319
547 3300026078 Ga0207702_10096143 Ga0207702_100961432 319
548 3300026142 Ga0207698_10001786 Ga0207698_100017865 319
549 3300032004 Ga0307414_10004643 Ga0307414_100046434 319
550 3300032004 Ga0307414_10046183 Ga0307414_100461832 319
551 3300037466 Ga0395898_0114074 Ga0395898_0114074_96_1082 319
552 3300038443 Ga0395901_0186033 Ga0395901_0186033_96_1082 319
553 3300044656 Ga0466969_0003903 Ga0466969_0003903_2006_2977 319
554 3300044683 Ga0466965_0000550 Ga0466965_0000550_11130_12101 319
555 3300044684 Ga0466966_0001316 Ga0466966_0001316_2382_3353 319
556 3300044693 Ga0466961_0009981 Ga0466961_0009981_1542_2513 319
557 3300044693 Ga0466961_0013180 Ga0466961_0013180_1137_2108 319
558 3300044719 Ga0466971_0006496 Ga0466971_0006496_888_1859 319
559 3300044842 Ga0466957_0028237 Ga0466957_0028237_162_1133 319
560 3300044842 Ga0466957_0137941 Ga0466957_0137941_51_1028 319
561 3300045049 Ga0466959_0010673 Ga0466959_0010673_4708_5679 319
562 3300045049 Ga0466959_0045661 Ga0466959_0045661_747_1718 319
563 3300048925 Ga0496122_0025528 Ga0496122_0025528_104_1063 319
564 3300048926 Ga0496123_0039389 Ga0496123_0039389_1184_2143 319
565 3300061719 Ga0466962_0010142 Ga0466962_0010142_1587_2558 319
566 3300061719 Ga0466962_0090676 Ga0466962_0090676_73_1044 319
567 2162886007 SwRhRL2b_contig_723762 SwRhRL2b_0236.00007630 320
568 3300003781 Ga0055536_1002005 Ga0055536_10020057 320
569 3300003856 Ga0058692_1000006 Ga0058692_1000006233 320
570 3300005289 Ga0065704_10070476 Ga0065704_1007047613 320
571 3300005289 Ga0065704_10070915 Ga0065704_100709156 320
572 3300005466 Ga0070685_10016889 Ga0070685_100168892 320
573 3300009148 Ga0105243_10004981 Ga0105243_100049813 320
574 3300013296 Ga0157374_10039886 Ga0157374_100398865 320
575 3300025292 Ga0209676_1000034 Ga0209676_1000034417 320
576 3300025935 Ga0207709_10007378 Ga0207709_100073783 320
577 3300025942 Ga0207689_10042832 Ga0207689_100428322 320
578 3300027312 Ga0209371_1000016 Ga0209371_1000016233 320
579 3300030500 Ga0268256_1000015 Ga0268256_1000015337 320
580 3300032004 Ga0307414_10041317 Ga0307414_100413172 320
581 3300039145 Ga0237816_02346 Ga0237816_02346_323_1315 320
582 3300048917 Ga0496114_0016091 Ga0496114_0016091_3334_4296 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

136

290

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

7

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.9002 1 315
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8987 6 315
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.8942 2 315
8afu-assembly2.cif.gz_B daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.8929 1 315
8afv-assembly2.cif.gz_C daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8921 6 315
ID Description Score Start End Superfamily
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9183 134 289 3.30.360.10
af_Q2G1H4_169_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9047 155 289 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.898 133 289 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8869 134 293 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8817 134 293 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A367J6R2-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase 0.9801 200 317 GO:0016301
AF-T1AKM0-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9789 3 134 GO:0006526
GO:0016620
GO:0051287
AF-A0A2S6BA65-F1-model_v4 deleted 0.9779 219 314
AF-D5G7N8-F1-model_v4 (Perigord truffle) hypothetical protein 0.9765 184 315
AF-A0A2W5HSF8-F1-model_v4 deleted 0.9738 1 119

Feature Viewer

pLDDT pTM Quality
90.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map