F466106
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 581 | 371 | 504 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0217687|Ga0496110_0217687_316_1494 |
| Length | 392 |
| Sequence | VHRLSQQRNLPQLAPVTFLQLTHYDLKPSCGAGDDMREIKGPGIFLAQFLSDTAPFNSLRSITRWAADLGYVGVQVPTSDPKIFDLTKAAESQTYCDEIAGICRESGVVITELSTHLQGQMVACHPAYNDLFDAIVPAHVAPDLAQRSQWASDQLRLACRASKRLGLSAQATFSGSLLWHTVYPWPQRPANLVEQGFAELARRWKPLLDVADECGVDLCYEVHPSEDIHDGATFERFLDAVGNHKRANLLFDPSHFVLQQLDYLQYIDLYHERIRAFHVKDAEFRPNGRSGVYGGYQNWIDRPGRFRSLGDGQVDFRSIFSKLTQYDYPGWAVLEWECCIKHPEQGAKEGAPFIKEHIIRVAERAFDDFAGASGVGKKGDLEERNRRILGLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 2 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 3 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 4 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 5 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 6 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 7 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 8 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 9 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 10 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 11 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 12 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 13 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 14 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 15 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 16 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 17 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 18 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 19 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 20 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 21 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 22 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 23 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 24 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 25 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 26 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 27 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 28 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 29 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 30 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 31 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 32 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 33 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 34 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 35 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 36 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 37 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 38 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 39 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 40 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 41 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 42 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 43 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 44 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 45 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 46 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 47 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 48 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 49 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 50 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 51 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 52 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 53 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 54 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 55 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 56 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 57 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 58 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 59 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 60 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 61 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 62 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 63 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 64 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 65 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 66 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 67 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 68 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 69 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 70 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 71 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 72 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 73 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 74 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 75 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 76 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 85 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 90 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 98 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 118 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 120 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 228 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 234 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 235 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 236 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 237 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 238 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 239 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 240 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 241 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 242 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 243 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 244 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 245 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 246 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 247 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 248 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 249 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 332 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 335 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 353 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 362 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 368 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 369 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 370 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 371 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.57 |
| Metatranscriptomes | 0.34 |
| Isolates | 13.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.52 |
| Bulb | 0 |
| Endosphere | 4.99 |
| Nodule | 0.52 |
| Rhizoplane | 5.68 |
| Rhizosphere | 80.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10003422 | 3300003316 | Bacteria | 22736 |
| 2 | rootH2_10062064 | 3300003320 | Bacteria | 9496 |
| 3 | rootL2_10015926 | 3300003322 | Bacteria | 7511 |
| 4 | rootH1_10001636 | 3300003323 | Bacteria | 76904 |
| 5 | rootH1_10010775 | 3300003323 | Bacteria | 11348 |
| 6 | rootH1_10011885 | 3300003323 | Bacteria | 6470 |
| 7 | Ga0055525_1000099 | 3300003759 | Bacteria | 136491 |
| 8 | Ga0055530_10000141 | 3300003791 | Bacteria | 64443 |
| 9 | Ga0055540_1000171 | 3300003792 | Bacteria | 64443 |
| 10 | Ga0055531_10000438 | 3300003794 | Bacteria | 39137 |
| 11 | Ga0065714_10002454 | 3300005288 | Bacteria | 30842 |
| 12 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 13 | Ga0070666_10003916 | 3300005335 | Bacteria | 9045 |
| 14 | Ga0070680_100248341 | 3300005336 | Bacteria | 1504 |
| 15 | Ga0068868_100151962 | 3300005338 | Bacteria | 1907 |
| 16 | Ga0070661_100242020 | 3300005344 | Bacteria | 1390 |
| 17 | Ga0070668_100054348 | 3300005347 | Bacteria | 3089 |
| 18 | Ga0070669_100001723 | 3300005353 | Bacteria | 15839 |
| 19 | Ga0070671_100000033 | 3300005355 | Bacteria | 105788 |
| 20 | Ga0070688_100000741 | 3300005365 | Bacteria | 16078 |
| 21 | Ga0070667_100000405 | 3300005367 | Bacteria | 46253 |
| 22 | Ga0070667_100082011 | 3300005367 | Bacteria | 2760 |
| 23 | Ga0070709_10009626 | 3300005434 | Bacteria | 5337 |
| 24 | Ga0070713_100096506 | 3300005436 | Bacteria | 2552 |
| 25 | Ga0070705_100003644 | 3300005440 | Bacteria | 7544 |
| 26 | Ga0070708_100109393 | 3300005445 | Plasmid | 2539 |
| 27 | Ga0070663_100014470 | 3300005455 | Bacteria | 5065 |
| 28 | Ga0070681_10064321 | 3300005458 | Bacteria | 3639 |
| 29 | Ga0068867_100151545 | 3300005459 | Bacteria | 1822 |
| 30 | Ga0070685_10000008 | 3300005466 | Bacteria | 166350 |
| 31 | Ga0070685_10000770 | 3300005466 | Bacteria | 17432 |
| 32 | Ga0070706_100022846 | 3300005467 | Bacteria | 5760 |
| 33 | Ga0070706_100142872 | 3300005467 | Bacteria | 2234 |
| 34 | Ga0070707_100269541 | 3300005468 | Bacteria | 1655 |
| 35 | Ga0070679_100173451 | 3300005530 | Bacteria | 2129 |
| 36 | Ga0070679_100185139 | 3300005530 | Bacteria | 2054 |
| 37 | Ga0070679_100340213 | 3300005530 | Bacteria | 1449 |
| 38 | Ga0070697_100009299 | 3300005536 | Bacteria | 7681 |
| 39 | Ga0068853_100040948 | 3300005539 | Bacteria | 3955 |
| 40 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 41 | Ga0070665_100348785 | 3300005548 | Bacteria | 1485 |
| 42 | Ga0068855_100013165 | 3300005563 | Bacteria | 9977 |
| 43 | Ga0068855_100059932 | 3300005563 | Bacteria | 4452 |
| 44 | Ga0068855_100079183 | 3300005563 | Bacteria | 3811 |
| 45 | Ga0068855_100559691 | 3300005563 | Bacteria | 1237 |
| 46 | Ga0068857_100064501 | 3300005577 | Bacteria | 3257 |
| 47 | Ga0068854_100066540 | 3300005578 | Bacteria | 2623 |
| 48 | Ga0068856_100074869 | 3300005614 | Bacteria | 3353 |
| 49 | Ga0068852_100063549 | 3300005616 | Bacteria | 3214 |
| 50 | Ga0068859_100219214 | 3300005617 | Bacteria | 1990 |
| 51 | Ga0068864_100000006 | 3300005618 | Bacteria | 393838 |
| 52 | Ga0068851_10001629 | 3300005834 | Bacteria | 9843 |
| 53 | Ga0068863_100029887 | 3300005841 | Bacteria | 5205 |
| 54 | Ga0068863_100095218 | 3300005841 | Bacteria | 2826 |
| 55 | Ga0068858_100058058 | 3300005842 | Bacteria | 3577 |
| 56 | Ga0068860_100000259 | 3300005843 | Bacteria | 77665 |
| 57 | Ga0068860_100283076 | 3300005843 | Bacteria | 1621 |
| 58 | Ga0068862_100079885 | 3300005844 | Bacteria | 2835 |
| 59 | Ga0068862_100418351 | 3300005844 | Bacteria | 1257 |
| 60 | Ga0081539_10026589 | 3300005985 | Bacteria | 3687 |
| 61 | Ga0070717_10100861 | 3300006028 | Bacteria | 2451 |
| 62 | Ga0075432_10013326 | 3300006058 | Bacteria | 2793 |
| 63 | Ga0070712_100077561 | 3300006175 | Bacteria | 2395 |
| 64 | Ga0075370_10055781 | 3300006353 | Bacteria | 2245 |
| 65 | Ga0068871_100097303 | 3300006358 | Bacteria | 2460 |
| 66 | Ga0075428_100000418 | 3300006844 | Bacteria | 42295 |
| 67 | Ga0075428_100024961 | 3300006844 | Bacteria | 6613 |
| 68 | Ga0075428_100043719 | 3300006844 | Bacteria | 4925 |
| 69 | Ga0075428_100085428 | 3300006844 | Bacteria | 3441 |
| 70 | Ga0075431_100432402 | 3300006847 | Bacteria | 1314 |
| 71 | Ga0075433_10052856 | 3300006852 | Bacteria | 3540 |
| 72 | Ga0075434_100076780 | 3300006871 | Bacteria | 3335 |
| 73 | Ga0097620_100219215 | 3300006931 | Bacteria | 1990 |
| 74 | Ga0075435_100078252 | 3300007076 | Bacteria | 2712 |
| 75 | Ga0105251_10000001 | 3300009011 | Bacteria | 466643 |
| 76 | Ga0105240_10001821 | 3300009093 | Bacteria | 35773 |
| 77 | Ga0105240_10004139 | 3300009093 | Bacteria | 22222 |
| 78 | Ga0105240_10043866 | 3300009093 | Bacteria | 5687 |
| 79 | Ga0105240_10067898 | 3300009093 | Bacteria | 4418 |
| 80 | Ga0105240_10078341 | 3300009093 | Bacteria | 4070 |
| 81 | Ga0105240_10117107 | 3300009093 | Bacteria | 3213 |
| 82 | Ga0105240_10591627 | 3300009093 | Bacteria | 1222 |
| 83 | Ga0111539_10000310 | 3300009094 | Bacteria | 59421 |
| 84 | Ga0111539_10024314 | 3300009094 | Bacteria | 7437 |
| 85 | Ga0105247_10013121 | 3300009101 | Bacteria | 4969 |
| 86 | Ga0114129_10090403 | 3300009147 | Bacteria | 4244 |
| 87 | Ga0114129_10157919 | 3300009147 | Bacteria | 3100 |
| 88 | Ga0105241_10103134 | 3300009174 | Bacteria | 2271 |
| 89 | Ga0105248_10053484 | 3300009177 | Bacteria | 4530 |
| 90 | Ga0105237_10129631 | 3300009545 | Bacteria | 2517 |
| 91 | Ga0105238_10004018 | 3300009551 | Bacteria | 14588 |
| 92 | Ga0105238_10008966 | 3300009551 | Bacteria | 10011 |
| 93 | Ga0105238_10051029 | 3300009551 | Bacteria | 4162 |
| 94 | Ga0105238_10316343 | 3300009551 | Bacteria | 1546 |
| 95 | Ga0105249_10041879 | 3300009553 | Bacteria | 4164 |
| 96 | Ga0105249_10056764 | 3300009553 | Bacteria | 3585 |
| 97 | Ga0105239_10013244 | 3300010375 | Bacteria | 9167 |
| 98 | Ga0105239_10189052 | 3300010375 | Bacteria | 2305 |
| 99 | Ga0105239_10513851 | 3300010375 | Bacteria | 1362 |
| 100 | Ga0157373_10182361 | 3300013100 | Bacteria | 1478 |
| 101 | Ga0157371_10003910 | 3300013102 | Bacteria | 13258 |
| 102 | Ga0157370_10153598 | 3300013104 | Bacteria | 2142 |
| 103 | Ga0157369_10003028 | 3300013105 | Bacteria | 20066 |
| 104 | Ga0157369_10033149 | 3300013105 | Bacteria | 5678 |
| 105 | Ga0157374_10195488 | 3300013296 | Bacteria | 1979 |
| 106 | Ga0157378_10113475 | 3300013297 | Bacteria | 2488 |
| 107 | Ga0157372_10122660 | 3300013307 | Bacteria | 2986 |
| 108 | Ga0157372_10287729 | 3300013307 | Bacteria | 1911 |
| 109 | Ga0157375_10389373 | 3300013308 | Bacteria | 1561 |
| 110 | Ga0163163_10000926 | 3300014325 | Bacteria | 24867 |
| 111 | Ga0163163_10437431 | 3300014325 | Bacteria | 1367 |
| 112 | Ga0182008_10008526 | 3300014497 | Bacteria | 5597 |
| 113 | Ga0157376_10199507 | 3300014969 | Bacteria | 1840 |
| 114 | Ga0182006_1000866 | 3300015261 | Bacteria | 20313 |
| 115 | Ga0182006_1015267 | 3300015261 | Bacteria | 3294 |
| 116 | Ga0182007_10002091 | 3300015262 | Bacteria | 10252 |
| 117 | Ga0163161_10000066 | 3300017792 | Bacteria | 107442 |
| 118 | Ga0163161_10012897 | 3300017792 | Bacteria | 5808 |
| 119 | Ga0213872_10004350 | 3300021361 | Bacteria | 7543 |
| 120 | Ga0213872_10008761 | 3300021361 | Bacteria | 4882 |
| 121 | Ga0213872_10075372 | 3300021361 | Bacteria | 1518 |
| 122 | Ga0213872_10095713 | 3300021361 | Bacteria | 1326 |
| 123 | Ga0224712_10100038 | 3300022467 | Bacteria | 1228 |
| 124 | Ga0209563_100081 | 3300025230 | Bacteria | 199455 |
| 125 | Ga0209676_1000020 | 3300025292 | Bacteria | 617256 |
| 126 | Ga0209676_1005941 | 3300025292 | Bacteria | 6177 |
| 127 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 128 | Ga0209050_1002215 | 3300025298 | Bacteria | 17439 |
| 129 | Ga0209051_1000380 | 3300025303 | Bacteria | 63324 |
| 130 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 131 | Ga0209257_1014591 | 3300025304 | Bacteria | 3361 |
| 132 | Ga0207656_10011560 | 3300025321 | Bacteria | 3339 |
| 133 | Ga0207655_1008877 | 3300025728 | Bacteria | 6317 |
| 134 | Ga0207713_1001199 | 3300025735 | Bacteria | 21761 |
| 135 | Ga0207710_10005804 | 3300025900 | Bacteria | 5298 |
| 136 | Ga0207680_10039788 | 3300025903 | Bacteria | 2731 |
| 137 | Ga0207680_10151269 | 3300025903 | Bacteria | 1547 |
| 138 | Ga0207647_10005480 | 3300025904 | Bacteria | 9289 |
| 139 | Ga0207705_10038096 | 3300025909 | Bacteria | 3441 |
| 140 | Ga0207684_10019721 | 3300025910 | Bacteria | 5767 |
| 141 | Ga0207684_10134703 | 3300025910 | Bacteria | 2121 |
| 142 | Ga0207707_10367551 | 3300025912 | Bacteria | 1238 |
| 143 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 144 | Ga0207695_10028582 | 3300025913 | Bacteria | 6177 |
| 145 | Ga0207695_10098368 | 3300025913 | Bacteria | 2925 |
| 146 | Ga0207695_10170688 | 3300025913 | Bacteria | 2100 |
| 147 | Ga0207695_10242658 | 3300025913 | Bacteria | 1702 |
| 148 | Ga0207671_10015356 | 3300025914 | Bacteria | 5999 |
| 149 | Ga0207671_10060535 | 3300025914 | Bacteria | 2809 |
| 150 | Ga0207693_10312166 | 3300025915 | Bacteria | 1231 |
| 151 | Ga0207652_10150030 | 3300025921 | Bacteria | 2087 |
| 152 | Ga0207652_10225317 | 3300025921 | Bacteria | 1689 |
| 153 | Ga0207652_10487129 | 3300025921 | Bacteria | 1110 |
| 154 | Ga0207694_10002128 | 3300025924 | Bacteria | 16295 |
| 155 | Ga0207694_10003412 | 3300025924 | Bacteria | 12649 |
| 156 | Ga0207694_10007763 | 3300025924 | Bacteria | 8124 |
| 157 | Ga0207694_10007982 | 3300025924 | Bacteria | 8003 |
| 158 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 159 | Ga0207650_10043877 | 3300025925 | Bacteria | 3284 |
| 160 | Ga0207700_10052436 | 3300025928 | Bacteria | 3050 |
| 161 | Ga0207700_10059863 | 3300025928 | Bacteria | 2882 |
| 162 | Ga0207644_10000176 | 3300025931 | Bacteria | 45641 |
| 163 | Ga0207690_10072188 | 3300025932 | Bacteria | 2383 |
| 164 | Ga0207706_10178706 | 3300025933 | Bacteria | 1864 |
| 165 | Ga0207665_10111302 | 3300025939 | Bacteria | 1924 |
| 166 | Ga0207711_10000366 | 3300025941 | Bacteria | 47938 |
| 167 | Ga0207667_10107695 | 3300025949 | Bacteria | 2875 |
| 168 | Ga0207667_10117154 | 3300025949 | Bacteria | 2745 |
| 169 | Ga0207712_10003217 | 3300025961 | Bacteria | 10379 |
| 170 | Ga0207640_10027516 | 3300025981 | Bacteria | 3466 |
| 171 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 172 | Ga0207658_10005884 | 3300025986 | Bacteria | 8386 |
| 173 | Ga0207658_10008847 | 3300025986 | Bacteria | 6832 |
| 174 | Ga0207703_10006849 | 3300026035 | Bacteria | 9077 |
| 175 | Ga0207639_10053310 | 3300026041 | Bacteria | 3086 |
| 176 | Ga0207678_10003270 | 3300026067 | Bacteria | 14620 |
| 177 | Ga0207702_10039872 | 3300026078 | Bacteria | 3937 |
| 178 | Ga0207702_10148738 | 3300026078 | Bacteria | 2128 |
| 179 | Ga0207641_10005339 | 3300026088 | Bacteria | 10977 |
| 180 | Ga0207648_10285093 | 3300026089 | Bacteria | 1478 |
| 181 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 182 | Ga0207674_10038560 | 3300026116 | Bacteria | 4956 |
| 183 | Ga0209281_1001783 | 3300027111 | Bacteria | 10856 |
| 184 | Ga0209371_1000929 | 3300027312 | Bacteria | 22972 |
| 185 | Ga0207428_10026462 | 3300027907 | Bacteria | 4843 |
| 186 | Ga0207428_10031821 | 3300027907 | Bacteria | 4346 |
| 187 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 188 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 189 | Ga0268266_10002914 | 3300028379 | Bacteria | 17699 |
| 190 | Ga0268266_10004174 | 3300028379 | Bacteria | 13931 |
| 191 | Ga0268266_10023213 | 3300028379 | Bacteria | 5282 |
| 192 | Ga0268265_10008376 | 3300028380 | Bacteria | 6981 |
| 193 | Ga0268265_10089273 | 3300028380 | Bacteria | 2458 |
| 194 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 195 | Ga0268264_10246947 | 3300028381 | Bacteria | 1656 |
| 196 | Ga0307515_10000016 | 3300028794 | Bacteria | 554870 |
| 197 | Ga0265338_10011307 | 3300028800 | Bacteria | 10330 |
| 198 | Ga0268256_1000782 | 3300030500 | Bacteria | 22972 |
| 199 | Ga0316178_1094315 | 3300030735 | Bacteria | 3416 |
| 200 | Ga0265340_10028829 | 3300031247 | Bacteria | 2790 |
| 201 | Ga0307513_10029615 | 3300031456 | Bacteria | 6236 |
| 202 | Ga0307509_10016260 | 3300031507 | Bacteria | 8618 |
| 203 | Ga0307509_10035922 | 3300031507 | Bacteria | 5433 |
| 204 | Ga0307408_100004852 | 3300031548 | Bacteria | 9058 |
| 205 | Ga0307408_100006406 | 3300031548 | Bacteria | 7809 |
| 206 | Ga0307408_100140781 | 3300031548 | Bacteria | 1893 |
| 207 | Ga0307408_100173637 | 3300031548 | Bacteria | 1722 |
| 208 | Ga0307516_10011068 | 3300031730 | Bacteria | 9851 |
| 209 | Ga0307405_10012193 | 3300031731 | Bacteria | 4538 |
| 210 | Ga0307405_10012466 | 3300031731 | Bacteria | 4502 |
| 211 | Ga0307405_10019563 | 3300031731 | Bacteria | 3764 |
| 212 | Ga0307405_10085820 | 3300031731 | Bacteria | 2070 |
| 213 | Ga0307413_10013731 | 3300031824 | Bacteria | 4086 |
| 214 | Ga0307413_10109375 | 3300031824 | Bacteria | 1847 |
| 215 | Ga0307410_10011618 | 3300031852 | Bacteria | 5045 |
| 216 | Ga0307410_10045378 | 3300031852 | Bacteria | 2926 |
| 217 | Ga0307406_10001512 | 3300031901 | Bacteria | 12828 |
| 218 | Ga0307406_10309899 | 3300031901 | Bacteria | 1216 |
| 219 | Ga0307407_10007910 | 3300031903 | Bacteria | 4846 |
| 220 | Ga0307407_10045144 | 3300031903 | Bacteria | 2488 |
| 221 | Ga0307407_10048872 | 3300031903 | Bacteria | 2411 |
| 222 | Ga0307412_10001066 | 3300031911 | Bacteria | 15684 |
| 223 | Ga0307412_10001611 | 3300031911 | Bacteria | 12441 |
| 224 | Ga0307412_10008226 | 3300031911 | Bacteria | 5945 |
| 225 | Ga0307412_10016569 | 3300031911 | Bacteria | 4394 |
| 226 | Ga0307412_10029367 | 3300031911 | Bacteria | 3450 |
| 227 | Ga0307412_10037285 | 3300031911 | Bacteria | 3122 |
| 228 | Ga0307409_100005311 | 3300031995 | Bacteria | 7396 |
| 229 | Ga0307409_100053968 | 3300031995 | Bacteria | 3092 |
| 230 | Ga0307409_100073065 | 3300031995 | Bacteria | 2734 |
| 231 | Ga0307416_100097508 | 3300032002 | Bacteria | 2546 |
| 232 | Ga0307416_100149830 | 3300032002 | Bacteria | 2137 |
| 233 | Ga0307414_10007004 | 3300032004 | Bacteria | 6318 |
| 234 | Ga0307414_10012649 | 3300032004 | Bacteria | 5000 |
| 235 | Ga0307414_10053416 | 3300032004 | Bacteria | 2817 |
| 236 | Ga0307414_10091649 | 3300032004 | Bacteria | 2259 |
| 237 | Ga0307414_10290895 | 3300032004 | Bacteria | 1377 |
| 238 | Ga0307411_10013774 | 3300032005 | Bacteria | 4477 |
| 239 | Ga0307411_10020515 | 3300032005 | Bacteria | 3845 |
| 240 | Ga0307411_10056382 | 3300032005 | Bacteria | 2590 |
| 241 | Ga0307411_10067595 | 3300032005 | Bacteria | 2405 |
| 242 | Ga0307411_10092844 | 3300032005 | Bacteria | 2111 |
| 243 | Ga0307411_10157846 | 3300032005 | Bacteria | 1694 |
| 244 | Ga0307411_10178706 | 3300032005 | Bacteria | 1608 |
| 245 | Ga0307411_10291359 | 3300032005 | Bacteria | 1304 |
| 246 | Ga0307415_100032773 | 3300032126 | Bacteria | 3365 |
| 247 | Ga0307510_10000324 | 3300033180 | Bacteria | 44451 |
| 248 | Ga0373954_0007899 | 3300035118 | Bacteria | 4660 |
| 249 | Ga0373956_0000380 | 3300035119 | Bacteria | 18162 |
| 250 | Ga0373927_0000025 | 3300035695 | Bacteria | 118042 |
| 251 | Ga0395900_0050014 | 3300037418 | Bacteria | 4306 |
| 252 | Ga0436365_1678853 | 3300039437 | Bacteria | 2751 |
| 253 | Ga0436361_0112287 | 3300039447 | Bacteria | 22106 |
| 254 | Ga0436361_0274973 | 3300039447 | Bacteria | 3666 |
| 255 | Ga0436361_0377146 | 3300039447 | Bacteria | 2226 |
| 256 | Ga0436361_0409483 | 3300039447 | Bacteria | 2633 |
| 257 | Ga0436361_0409788 | 3300039447 | Bacteria | 4097 |
| 258 | Ga0436361_1196017 | 3300039447 | Bacteria | 2130 |
| 259 | Ga0439438_000039 | 3300041405 | Bacteria | 66110 |
| 260 | Ga0439438_000379 | 3300041405 | Bacteria | 19968 |
| 261 | Ga0439438_001196 | 3300041405 | Bacteria | 11531 |
| 262 | Ga0439438_001599 | 3300041405 | Bacteria | 9946 |
| 263 | Ga0439438_001845 | 3300041405 | Bacteria | 9275 |
| 264 | Ga0439438_003426 | 3300041405 | Bacteria | 6412 |
| 265 | Ga0439447_000475 | 3300041407 | Bacteria | 14959 |
| 266 | Ga0439447_000519 | 3300041407 | Bacteria | 14291 |
| 267 | Ga0439447_001031 | 3300041407 | Bacteria | 10122 |
| 268 | Ga0439447_002865 | 3300041407 | Bacteria | 6185 |
| 269 | Ga0439447_012694 | 3300041407 | Bacteria | 2412 |
| 270 | Ga0439466_0000127 | 3300041411 | Bacteria | 29566 |
| 271 | Ga0439466_0007364 | 3300041411 | Bacteria | 4168 |
| 272 | Ga0439466_0008636 | 3300041411 | Bacteria | 3839 |
| 273 | Ga0439465_0016836 | 3300041413 | Bacteria | 2281 |
| 274 | Ga0451853_3253391 | 3300041512 | Bacteria | 1032 |
| 275 | Ga0439431_0001988 | 3300041997 | Bacteria | 4534 |
| 276 | Ga0439432_000233 | 3300042006 | Bacteria | 20049 |
| 277 | Ga0439432_017912 | 3300042006 | Bacteria | 2373 |
| 278 | Ga0439452_000081 | 3300042010 | Bacteria | 82231 |
| 279 | Ga0439452_000250 | 3300042010 | Bacteria | 36960 |
| 280 | Ga0439452_000684 | 3300042010 | Bacteria | 16690 |
| 281 | Ga0439452_003373 | 3300042010 | Bacteria | 5608 |
| 282 | Ga0439452_004311 | 3300042010 | Bacteria | 4799 |
| 283 | Ga0439456_000527 | 3300042013 | Bacteria | 8137 |
| 284 | Ga0439463_003192 | 3300042016 | Bacteria | 4159 |
| 285 | Ga0450911_000010 | 3300042115 | Bacteria | 149605 |
| 286 | Ga0450919_003157 | 3300042121 | Bacteria | 2092 |
| 287 | Ga0450903_014865 | 3300042138 | Bacteria | 1229 |
| 288 | Ga0450904_001143 | 3300042139 | Bacteria | 4045 |
| 289 | Ga0450906_000050 | 3300042145 | Bacteria | 19133 |
| 290 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 291 | Ga0450907_000365 | 3300042146 | Bacteria | 13879 |
| 292 | Ga0450910_001903 | 3300042147 | Bacteria | 2698 |
| 293 | Ga0439446_0009690 | 3300042156 | Bacteria | 2583 |
| 294 | Ga0439446_0017814 | 3300042156 | Bacteria | 1986 |
| 295 | Ga0450908_001083 | 3300042184 | Bacteria | 5280 |
| 296 | Ga0439434_0000001 | 3300042435 | Bacteria | 86314 |
| 297 | Ga0439434_0026766 | 3300042435 | Bacteria | 1742 |
| 298 | Ga0439464_0005488 | 3300042439 | Bacteria | 3281 |
| 299 | Ga0439460_0000239 | 3300042461 | Bacteria | 11172 |
| 300 | Ga0450918_009972 | 3300042531 | Bacteria | 1660 |
| 301 | Ga0451577_0023438 | 3300042876 | Bacteria | 5630 |
| 302 | Ga0451577_0280901 | 3300042876 | Bacteria | 1508 |
| 303 | Ga0451577_0359032 | 3300042876 | Bacteria | 1322 |
| 304 | Ga0439440_0000156 | 3300042993 | Bacteria | 10106 |
| 305 | Ga0466969_0000718 | 3300044656 | Bacteria | 17955 |
| 306 | Ga0466969_0009636 | 3300044656 | Bacteria | 5120 |
| 307 | Ga0453683_0038352 | 3300044673 | Bacteria | 3012 |
| 308 | Ga0466966_0001140 | 3300044684 | Bacteria | 17084 |
| 309 | Ga0466964_0011745 | 3300044706 | Unclassified | 3312 |
| 310 | Ga0453684_0210277 | 3300044712 | Bacteria | 2262 |
| 311 | Ga0466968_0000582 | 3300044735 | Bacteria | 12441 |
| 312 | Ga0466970_0000527 | 3300044765 | Bacteria | 18760 |
| 313 | Ga0451576_0048017 | 3300045051 | Bacteria | 4486 |
| 314 | Ga0451576_0057093 | 3300045051 | Bacteria | 4080 |
| 315 | Ga0466958_0000962 | 3300045836 | Bacteria | 13039 |
| 316 | Ga0495617_009853 | 3300046452 | Bacteria | 3276 |
| 317 | Ga0495617_018189 | 3300046452 | Bacteria | 2377 |
| 318 | Ga0495627_000087 | 3300046453 | Bacteria | 110870 |
| 319 | Ga0495627_000101 | 3300046453 | Bacteria | 105414 |
| 320 | Ga0495627_008555 | 3300046453 | Bacteria | 3825 |
| 321 | Ga0495591_000199 | 3300046458 | Bacteria | 61532 |
| 322 | Ga0495591_000300 | 3300046458 | Bacteria | 45180 |
| 323 | Ga0495591_003292 | 3300046458 | Bacteria | 8453 |
| 324 | Ga0495591_005534 | 3300046458 | Bacteria | 5817 |
| 325 | Ga0495638_0000048 | 3300046460 | Bacteria | 209787 |
| 326 | Ga0495638_0000117 | 3300046460 | Bacteria | 127788 |
| 327 | Ga0495650_0014388 | 3300046471 | Bacteria | 4120 |
| 328 | Ga0495605_0023553 | 3300046474 | Bacteria | 3235 |
| 329 | Ga0495584_0000739 | 3300046491 | Bacteria | 21572 |
| 330 | Ga0495584_0013459 | 3300046491 | Bacteria | 4177 |
| 331 | Ga0495585_0000185 | 3300046492 | Bacteria | 66442 |
| 332 | Ga0495585_0032212 | 3300046492 | Bacteria | 2970 |
| 333 | Ga0495607_0000517 | 3300046501 | Bacteria | 38004 |
| 334 | Ga0495607_0014971 | 3300046501 | Bacteria | 5041 |
| 335 | Ga0495607_0044492 | 3300046501 | Bacteria | 2618 |
| 336 | Ga0495583_0005886 | 3300046506 | Bacteria | 8166 |
| 337 | Ga0495583_0015656 | 3300046506 | Bacteria | 4111 |
| 338 | Ga0495606_0000729 | 3300046507 | Bacteria | 50871 |
| 339 | Ga0495606_0012470 | 3300046507 | Bacteria | 6810 |
| 340 | Ga0495610_0005706 | 3300046512 | Bacteria | 8771 |
| 341 | Ga0495616_0000454 | 3300046513 | Bacteria | 31292 |
| 342 | Ga0495616_0019269 | 3300046513 | Bacteria | 3725 |
| 343 | Ga0495620_0000257 | 3300046515 | Bacteria | 39311 |
| 344 | Ga0495631_0005114 | 3300046518 | Bacteria | 6912 |
| 345 | Ga0495631_0025683 | 3300046518 | Bacteria | 2709 |
| 346 | Ga0495631_0029840 | 3300046518 | Bacteria | 2477 |
| 347 | Ga0495632_0000097 | 3300046519 | Bacteria | 88746 |
| 348 | Ga0495632_0008700 | 3300046519 | Bacteria | 6193 |
| 349 | Ga0495632_0037832 | 3300046519 | Bacteria | 2445 |
| 350 | Ga0495632_0069066 | 3300046519 | Bacteria | 1702 |
| 351 | Ga0495632_0079751 | 3300046519 | Bacteria | 1562 |
| 352 | Ga0495637_0001309 | 3300046520 | Bacteria | 14938 |
| 353 | Ga0495637_0062129 | 3300046520 | Bacteria | 1529 |
| 354 | Ga0495643_0000625 | 3300046522 | Bacteria | 42011 |
| 355 | Ga0495644_0005578 | 3300046523 | Bacteria | 4909 |
| 356 | Ga0495644_0051499 | 3300046523 | Bacteria | 1546 |
| 357 | Ga0495648_0000172 | 3300046524 | Bacteria | 74485 |
| 358 | Ga0495648_0000668 | 3300046524 | Bacteria | 36642 |
| 359 | Ga0495648_0061494 | 3300046524 | Bacteria | 2230 |
| 360 | Ga0495654_0001012 | 3300046530 | Bacteria | 20571 |
| 361 | Ga0495654_0023484 | 3300046530 | Bacteria | 3193 |
| 362 | Ga0495609_0000504 | 3300046538 | Bacteria | 31406 |
| 363 | Ga0495609_0000982 | 3300046538 | Bacteria | 20389 |
| 364 | Ga0495609_0067375 | 3300046538 | Bacteria | 1576 |
| 365 | Ga0495597_0027264 | 3300046542 | Bacteria | 2620 |
| 366 | Ga0495633_0047583 | 3300046558 | Bacteria | 2027 |
| 367 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 368 | Ga0495668_0044583 | 3300046616 | Bacteria | 2465 |
| 369 | Ga0495611_0000024 | 3300046648 | Bacteria | 118898 |
| 370 | Ga0495611_0002419 | 3300046648 | Bacteria | 8557 |
| 371 | Ga0495611_0006686 | 3300046648 | Bacteria | 4906 |
| 372 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 373 | Ga0495625_0000861 | 3300046660 | Bacteria | 41279 |
| 374 | Ga0495625_0075252 | 3300046660 | Bacteria | 2362 |
| 375 | Ga0495659_0000641 | 3300046664 | Bacteria | 12731 |
| 376 | Ga0495661_0000138 | 3300046665 | Bacteria | 85693 |
| 377 | Ga0495661_0008477 | 3300046665 | Bacteria | 7106 |
| 378 | Ga0495661_0016477 | 3300046665 | Bacteria | 4897 |
| 379 | Ga0495661_0020395 | 3300046665 | Bacteria | 4327 |
| 380 | Ga0495661_0032909 | 3300046665 | Bacteria | 3274 |
| 381 | Ga0495647_0001756 | 3300046681 | Bacteria | 6720 |
| 382 | Ga0495658_0274774 | 3300046683 | Bacteria | 1062 |
| 383 | Ga0495670_0000020 | 3300046691 | Bacteria | 110171 |
| 384 | Ga0495670_0000112 | 3300046691 | Bacteria | 36057 |
| 385 | Ga0495671_0000273 | 3300046692 | Bacteria | 43292 |
| 386 | Ga0495671_0000503 | 3300046692 | Bacteria | 30077 |
| 387 | Ga0495671_0001542 | 3300046692 | Bacteria | 15358 |
| 388 | Ga0495671_0006195 | 3300046692 | Bacteria | 6941 |
| 389 | Ga0495671_0008699 | 3300046692 | Bacteria | 5701 |
| 390 | Ga0495671_0037759 | 3300046692 | Bacteria | 2441 |
| 391 | Ga0495649_0004543 | 3300046694 | Bacteria | 9052 |
| 392 | Ga0495649_0031575 | 3300046694 | Bacteria | 2920 |
| 393 | Ga0495589_0000477 | 3300046794 | Bacteria | 28860 |
| 394 | Ga0495660_0004243 | 3300046810 | Bacteria | 8700 |
| 395 | Ga0495660_0029491 | 3300046810 | Bacteria | 3094 |
| 396 | Ga0495672_0002027 | 3300047320 | Bacteria | 19104 |
| 397 | Ga0495672_0007290 | 3300047320 | Bacteria | 8341 |
| 398 | Ga0495672_0014217 | 3300047320 | Bacteria | 5460 |
| 399 | Ga0495687_000041 | 3300047443 | Bacteria | 229171 |
| 400 | Ga0495673_0004428 | 3300047469 | Bacteria | 8792 |
| 401 | Ga0495673_0005784 | 3300047469 | Bacteria | 7405 |
| 402 | Ga0495673_0065922 | 3300047469 | Bacteria | 1537 |
| 403 | Ga0495681_0000029 | 3300047470 | Bacteria | 134816 |
| 404 | Ga0495681_0001171 | 3300047470 | Bacteria | 19926 |
| 405 | Ga0495681_0005497 | 3300047470 | Bacteria | 8472 |
| 406 | Ga0495686_0002983 | 3300047472 | Bacteria | 15069 |
| 407 | Ga0495686_0008113 | 3300047472 | Bacteria | 7765 |
| 408 | Ga0495686_0134086 | 3300047472 | Bacteria | 1466 |
| 409 | Ga0495626_0006462 | 3300048091 | Bacteria | 6670 |
| 410 | Ga0495626_0006994 | 3300048091 | Bacteria | 6344 |
| 411 | Ga0496104_0022417 | 3300048907 | Bacteria | 5802 |
| 412 | Ga0496110_0120403 | 3300048913 | Bacteria | 2364 |
| 413 | Ga0496110_0217687 | 3300048913 | Bacteria | 1737 |
| 414 | Ga0496117_0042697 | 3300048920 | Bacteria | 3306 |
| 415 | Ga0496118_0000177 | 3300048921 | Bacteria | 114183 |
| 416 | Ga0496118_0008563 | 3300048921 | Bacteria | 10538 |
| 417 | Ga0496122_0000725 | 3300048925 | Bacteria | 64489 |
| 418 | Ga0496122_0004406 | 3300048925 | Bacteria | 17523 |
| 419 | Ga0496123_0001443 | 3300048926 | Bacteria | 33137 |
| 420 | Ga0496123_0023465 | 3300048926 | Bacteria | 4720 |
| 421 | Ga0496124_0142790 | 3300048927 | Bacteria | 1887 |
| 422 | Ga0496124_0252345 | 3300048927 | Bacteria | 1304 |
| 423 | Ga0496126_0000033 | 3300048929 | Bacteria | 368851 |
| 424 | Ga0495678_001245 | 3300049459 | Bacteria | 20717 |
| 425 | Ga0495678_004383 | 3300049459 | Bacteria | 8189 |
| 426 | Ga0495678_005203 | 3300049459 | Bacteria | 7271 |
| 427 | Ga0495678_032996 | 3300049459 | Bacteria | 2141 |
| 428 | Ga0495682_0003820 | 3300049460 | Bacteria | 6617 |
| 429 | Ga0501335_004705 | 3300049551 | Bacteria | 1202 |
| 430 | Ga0501031_0002801 | 3300049568 | Bacteria | 11125 |
| 431 | Ga0501032_0022864 | 3300049569 | Bacteria | 4329 |
| 432 | Ga0501032_0034989 | 3300049569 | Bacteria | 3435 |
| 433 | Ga0501033_0253906 | 3300049570 | Bacteria | 1245 |
| 434 | Ga0501034_0030621 | 3300049571 | Bacteria | 5469 |
| 435 | Ga0501037_0006783 | 3300049573 | Bacteria | 8370 |
| 436 | Ga0501037_0013126 | 3300049573 | Bacteria | 6108 |
| 437 | Ga0501038_0024541 | 3300049574 | Bacteria | 5378 |
| 438 | Ga0501038_0072739 | 3300049574 | Bacteria | 2913 |
| 439 | Ga0501039_0021805 | 3300049575 | Bacteria | 4914 |
| 440 | Ga0501042_0046663 | 3300049578 | Bacteria | 3088 |
| 441 | Ga0501043_0016922 | 3300049579 | Bacteria | 5714 |
| 442 | Ga0501046_0005823 | 3300049580 | Bacteria | 10993 |
| 443 | Ga0501046_0018614 | 3300049580 | Bacteria | 5773 |
| 444 | Ga0501047_0003068 | 3300049581 | Bacteria | 15839 |
| 445 | Ga0501047_0090819 | 3300049581 | Bacteria | 2931 |
| 446 | Ga0501047_0147472 | 3300049581 | Bacteria | 2229 |
| 447 | Ga0501047_0261669 | 3300049581 | Bacteria | 1577 |
| 448 | Ga0501048_0027025 | 3300049582 | Bacteria | 4173 |
| 449 | Ga0501067_0073824 | 3300049583 | Bacteria | 1889 |
| 450 | Ga0501068_0106349 | 3300049584 | Bacteria | 1742 |
| 451 | Ga0501070_0028683 | 3300049586 | Bacteria | 4666 |
| 452 | Ga0501070_0151247 | 3300049586 | Bacteria | 1915 |
| 453 | Ga0501073_0046641 | 3300049589 | Bacteria | 3046 |
| 454 | Ga0501073_0143864 | 3300049589 | Bacteria | 1652 |
| 455 | Ga0501074_0110310 | 3300049590 | Bacteria | 1968 |
| 456 | Ga0501211_000203 | 3300049658 | Bacteria | 5083 |
| 457 | Ga0501223_026011 | 3300049663 | Bacteria | 1139 |
| 458 | Ga0501238_000036 | 3300049671 | Bacteria | 23260 |
| 459 | Ga0501242_007344 | 3300049674 | Bacteria | 1270 |
| 460 | Ga0501252_000895 | 3300049682 | Bacteria | 2554 |
| 461 | Ga0501253_009362 | 3300049683 | Bacteria | 1442 |
| 462 | Ga0501257_004973 | 3300049686 | Bacteria | 2915 |
| 463 | Ga0501259_001750 | 3300049688 | Bacteria | 3597 |
| 464 | Ga0501079_0023183 | 3300049741 | Bacteria | 4765 |
| 465 | Ga0501083_0004690 | 3300049744 | Bacteria | 9657 |
| 466 | Ga0501083_0065656 | 3300049744 | Bacteria | 2417 |
| 467 | Ga0501241_004060 | 3300049758 | Bacteria | 2753 |
| 468 | Ga0501035_0159639 | 3300049822 | Bacteria | 1952 |
| 469 | Ga0501044_0021077 | 3300049823 | Bacteria | 6958 |
| 470 | Ga0501044_0054213 | 3300049823 | Bacteria | 4122 |
| 471 | Ga0501044_0071990 | 3300049823 | Bacteria | 3515 |
| 472 | Ga0501044_0124058 | 3300049823 | Bacteria | 2581 |
| 473 | Ga0501044_0262483 | 3300049823 | Bacteria | 1665 |
| 474 | Ga0501044_0262807 | 3300049823 | Bacteria | 1664 |
| 475 | Ga0501045_0098612 | 3300049824 | Bacteria | 2162 |
| 476 | nmdc:mga05p37_308100_c1 | 3300050507 | Bacteria | 1878 |
| 477 | nmdc:mga05p37_9912_c1 | 3300050507 | Bacteria | 11308 |
| 478 | nmdc:mga08y16_12543_c1 | 3300050511 | Bacteria | 8918 |
| 479 | nmdc:mga08y16_136861_c1 | 3300050511 | Unclassified | 2546 |
| 480 | nmdc:mga0n895_39499_c1 | 3300050512 | Bacteria | 4579 |
| 481 | nmdc:mga0n895_42311_c1 | 3300050512 | Bacteria | 4432 |
| 482 | nmdc:mga0rr50_46484_c1 | 3300050513 | Bacteria | 3196 |
| 483 | nmdc:mga0a205_39118_c1 | 3300050515 | Bacteria | 4564 |
| 484 | Ga0495601_0062011 | 3300053077 | Bacteria | 2374 |
| 485 | Ga0500643_002270 | 3300053087 | Bacteria | 10086 |
| 486 | Ga0500583_0029264 | 3300053092 | Bacteria | 2399 |
| 487 | Ga0500595_001265 | 3300053119 | Bacteria | 13897 |
| 488 | Ga0500597_000186 | 3300053120 | Bacteria | 12755 |
| 489 | Ga0500597_005241 | 3300053120 | Bacteria | 4151 |
| 490 | Ga0500658_0000285 | 3300053134 | Bacteria | 22927 |
| 491 | Ga0500568_0007831 | 3300053139 | Bacteria | 5205 |
| 492 | Ga0500588_0000387 | 3300053146 | Bacteria | 6850 |
| 493 | Ga0500616_0034755 | 3300053153 | Bacteria | 2744 |
| 494 | Ga0500622_0000013 | 3300053156 | Bacteria | 371650 |
| 495 | Ga0500624_000004 | 3300053157 | Bacteria | 196921 |
| 496 | Ga0500637_0000006 | 3300053178 | Bacteria | 99157 |
| 497 | Ga0500637_0020239 | 3300053178 | Bacteria | 3601 |
| 498 | Ga0500625_000005 | 3300053729 | Bacteria | 209509 |
| 499 | Ga0500645_018485 | 3300053730 | Bacteria | 2177 |
| 500 | Ga0500609_000927 | 3300053731 | Bacteria | 4396 |
| 501 | Ga0501084_0063654 | 3300054114 | Bacteria | 3088 |
| 502 | Ga0501084_0126173 | 3300054114 | Bacteria | 2153 |
| 503 | Ga0501082_0001156 | 3300060353 | Bacteria | 23260 |
| 504 | Ga0501082_0109554 | 3300060353 | Bacteria | 2390 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10009626 | Ga0070709_100096264 | 312 |
| 2 | 3300005440 | Ga0070705_100003644 | Ga0070705_1000036445 | 312 |
| 3 | 3300005536 | Ga0070697_100009299 | Ga0070697_1000092994 | 312 |
| 4 | 3300041512 | Ga0451853_3253391 | Ga0451853_3253391_50_994 | 314 |
| 5 | 3300044656 | Ga0466969_0009636 | Ga0466969_0009636_1314_2261 | 314 |
| 6 | 3300042876 | Ga0451577_0280901 | Ga0451577_0280901_541_1494 | 317 |
| 7 | 3300053087 | Ga0500643_002270 | Ga0500643_002270_9077_10042 | 320 |
| 8 | 3300046683 | Ga0495658_0274774 | Ga0495658_0274774_47_1021 | 324 |
| 9 | 3300053731 | Ga0500609_000927 | Ga0500609_000927_11_988 | 324 |
| 10 | 3300009093 | Ga0105240_10591627 | Ga0105240_105916271 | 327 |
| 11 | 3300009551 | Ga0105238_10008966 | Ga0105238_100089663 | 327 |
| 12 | 3300025924 | Ga0207694_10007763 | Ga0207694_100077632 | 327 |
| 13 | 3300049574 | Ga0501038_0072739 | Ga0501038_0072739_476_1474 | 331 |
| 14 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001246 | 333 |
| 15 | 3300005335 | Ga0070666_10003916 | Ga0070666_100039164 | 333 |
| 16 | 3300005353 | Ga0070669_100001723 | Ga0070669_10000172317 | 333 |
| 17 | 3300005355 | Ga0070671_100000033 | Ga0070671_10000003324 | 333 |
| 18 | 3300005365 | Ga0070688_100000741 | Ga0070688_1000007416 | 333 |
| 19 | 3300005367 | Ga0070667_100000405 | Ga0070667_10000040514 | 333 |
| 20 | 3300005466 | Ga0070685_10000008 | Ga0070685_10000008117 | 333 |
| 21 | 3300005618 | Ga0068864_100000006 | Ga0068864_100000006251 | 333 |
| 22 | 3300005842 | Ga0068858_100058058 | Ga0068858_1000580582 | 333 |
| 23 | 3300005843 | Ga0068860_100000259 | Ga0068860_1000002595 | 333 |
| 24 | 3300009101 | Ga0105247_10013121 | Ga0105247_100131212 | 333 |
| 25 | 3300009177 | Ga0105248_10053484 | Ga0105248_100534842 | 333 |
| 26 | 3300009553 | Ga0105249_10056764 | Ga0105249_100567642 | 333 |
| 27 | 3300014325 | Ga0163163_10000926 | Ga0163163_1000092613 | 333 |
| 28 | 3300025900 | Ga0207710_10005804 | Ga0207710_100058043 | 333 |
| 29 | 3300025903 | Ga0207680_10151269 | Ga0207680_101512691 | 333 |
| 30 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002924 | 333 |
| 31 | 3300025931 | Ga0207644_10000176 | Ga0207644_1000017635 | 333 |
| 32 | 3300025941 | Ga0207711_10000366 | Ga0207711_1000036631 | 333 |
| 33 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001430 | 333 |
| 34 | 3300026088 | Ga0207641_10005339 | Ga0207641_1000533910 | 333 |
| 35 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001924 | 333 |
| 36 | 3300028379 | Ga0268266_10002914 | Ga0268266_100029149 | 333 |
| 37 | 3300028380 | Ga0268265_10008376 | Ga0268265_100083764 | 333 |
| 38 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004945 | 333 |
| 39 | 3300048927 | Ga0496124_0142790 | Ga0496124_0142790_713_1762 | 333 |
| 40 | 3300025928 | Ga0207700_10052436 | Ga0207700_100524362 | 335 |
| 41 | 3300025915 | Ga0207693_10312166 | Ga0207693_103121662 | 336 |
| 42 | 3300046501 | Ga0495607_0044492 | Ga0495607_0044492_509_1528 | 336 |
| 43 | 3300047472 | Ga0495686_0134086 | Ga0495686_0134086_61_1080 | 336 |
| 44 | 3300049663 | Ga0501223_026011 | Ga0501223_026011_15_1025 | 336 |
| 45 | 3300053120 | Ga0500597_005241 | Ga0500597_005241_2345_3397 | 339 |
| 46 | 3300053157 | Ga0500624_000004 | Ga0500624_000004_109592_110644 | 339 |
| 47 | 3300053178 | Ga0500637_0000006 | Ga0500637_0000006_15299_16351 | 339 |
| 48 | 3300005530 | Ga0070679_100185139 | Ga0070679_1001851392 | 340 |
| 49 | 3300025921 | Ga0207652_10225317 | Ga0207652_102253172 | 340 |
| 50 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_350082_351104 | 340 |
| 51 | 3300053729 | Ga0500625_000005 | Ga0500625_000005_24537_25589 | 340 |
| 52 | 3300053092 | Ga0500583_0029264 | Ga0500583_0029264_763_1806 | 342 |
| 53 | 3300031730 | Ga0307516_10011068 | Ga0307516_100110686 | 343 |
| 54 | iso_pu_bacteria | 2848297114 | 2848297722 | 343 |
| 55 | iso_pu_bacteria | 8054302542 | 8054304513 | 344 |
| 56 | iso_pu_bacteria | 2928027323 | 2928028656 | 345 |
| 57 | 3300006844 | Ga0075428_100085428 | Ga0075428_1000854282 | 346 |
| 58 | 3300009094 | Ga0111539_10000310 | Ga0111539_100003105 | 346 |
| 59 | 3300031824 | Ga0307413_10013731 | Ga0307413_100137313 | 346 |
| 60 | 3300031911 | Ga0307412_10029367 | Ga0307412_100293673 | 346 |
| 61 | 3300032005 | Ga0307411_10056382 | Ga0307411_100563822 | 346 |
| 62 | 3300053077 | Ga0495601_0062011 | Ga0495601_0062011_24_1064 | 346 |
| 63 | iso_pu_bacteria | 2643221541 | 2643731109 | 346 |
| 64 | iso_pu_bacteria | 2643221606 | 2644045385 | 346 |
| 65 | iso_pu_bacteria | 2643221671 | 2644391838 | 346 |
| 66 | iso_pu_bacteria | 2739367664 | 2739649532 | 346 |
| 67 | iso_pu_bacteria | 2739367865 | 2740028005 | 346 |
| 68 | 3300005530 | Ga0070679_100173451 | Ga0070679_1001734511 | 347 |
| 69 | 3300005548 | Ga0070665_100000024 | Ga0070665_10000002416 | 347 |
| 70 | 3300005563 | Ga0068855_100013165 | Ga0068855_1000131656 | 347 |
| 71 | 3300005985 | Ga0081539_10026589 | Ga0081539_100265893 | 347 |
| 72 | 3300006844 | Ga0075428_100000418 | Ga0075428_10000041813 | 347 |
| 73 | 3300009093 | Ga0105240_10067898 | Ga0105240_100678982 | 347 |
| 74 | 3300010375 | Ga0105239_10189052 | Ga0105239_101890522 | 347 |
| 75 | 3300017792 | Ga0163161_10012897 | Ga0163161_100128972 | 347 |
| 76 | 3300021361 | Ga0213872_10004350 | Ga0213872_100043505 | 347 |
| 77 | 3300021361 | Ga0213872_10008761 | Ga0213872_100087615 | 347 |
| 78 | 3300021361 | Ga0213872_10075372 | Ga0213872_100753722 | 347 |
| 79 | 3300021361 | Ga0213872_10095713 | Ga0213872_100957132 | 347 |
| 80 | 3300025912 | Ga0207707_10367551 | Ga0207707_103675511 | 347 |
| 81 | 3300025921 | Ga0207652_10150030 | Ga0207652_101500301 | 347 |
| 82 | 3300025932 | Ga0207690_10072188 | Ga0207690_100721883 | 347 |
| 83 | 3300027907 | Ga0207428_10031821 | Ga0207428_100318212 | 347 |
| 84 | 3300028379 | Ga0268266_10000019 | Ga0268266_10000019346 | 347 |
| 85 | 3300031247 | Ga0265340_10028829 | Ga0265340_100288292 | 347 |
| 86 | 3300031731 | Ga0307405_10012193 | Ga0307405_100121933 | 347 |
| 87 | 3300031824 | Ga0307413_10109375 | Ga0307413_101093752 | 347 |
| 88 | 3300031852 | Ga0307410_10011618 | Ga0307410_100116184 | 347 |
| 89 | 3300031852 | Ga0307410_10045378 | Ga0307410_100453782 | 347 |
| 90 | 3300031903 | Ga0307407_10048872 | Ga0307407_100488722 | 347 |
| 91 | 3300031911 | Ga0307412_10016569 | Ga0307412_100165694 | 347 |
| 92 | 3300031995 | Ga0307409_100053968 | Ga0307409_1000539683 | 347 |
| 93 | 3300031995 | Ga0307409_100073065 | Ga0307409_1000730653 | 347 |
| 94 | 3300032002 | Ga0307416_100097508 | Ga0307416_1000975082 | 347 |
| 95 | 3300032004 | Ga0307414_10012649 | Ga0307414_100126494 | 347 |
| 96 | 3300032004 | Ga0307414_10053416 | Ga0307414_100534163 | 347 |
| 97 | 3300032005 | Ga0307411_10013774 | Ga0307411_100137741 | 347 |
| 98 | 3300032005 | Ga0307411_10020515 | Ga0307411_100205153 | 347 |
| 99 | 3300032005 | Ga0307411_10291359 | Ga0307411_102913591 | 347 |
| 100 | 3300032126 | Ga0307415_100032773 | Ga0307415_1000327733 | 347 |
| 101 | 3300039447 | Ga0436361_0112287 | Ga0436361_0112287_4833_5879 | 347 |
| 102 | 3300039447 | Ga0436361_0274973 | Ga0436361_0274973_1149_2198 | 347 |
| 103 | 3300039447 | Ga0436361_0377146 | Ga0436361_0377146_807_1853 | 347 |
| 104 | 3300039447 | Ga0436361_0409483 | Ga0436361_0409483_811_1860 | 347 |
| 105 | 3300039447 | Ga0436361_0409788 | Ga0436361_0409788_914_1963 | 347 |
| 106 | 3300039447 | Ga0436361_1196017 | Ga0436361_1196017_485_1531 | 347 |
| 107 | 3300045051 | Ga0451576_0048017 | Ga0451576_0048017_1611_2657 | 347 |
| 108 | 3300045836 | Ga0466958_0000962 | Ga0466958_0000962_5594_6640 | 347 |
| 109 | 3300046460 | Ga0495638_0000048 | Ga0495638_0000048_57673_58722 | 347 |
| 110 | 3300046491 | Ga0495584_0013459 | Ga0495584_0013459_1431_2483 | 347 |
| 111 | 3300046506 | Ga0495583_0005886 | Ga0495583_0005886_2053_3105 | 347 |
| 112 | 3300046512 | Ga0495610_0005706 | Ga0495610_0005706_2658_3710 | 347 |
| 113 | 3300046519 | Ga0495632_0079751 | Ga0495632_0079751_270_1322 | 347 |
| 114 | 3300046523 | Ga0495644_0051499 | Ga0495644_0051499_230_1273 | 347 |
| 115 | 3300046538 | Ga0495609_0000982 | Ga0495609_0000982_14583_15635 | 347 |
| 116 | 3300046542 | Ga0495597_0027264 | Ga0495597_0027264_1343_2395 | 347 |
| 117 | 3300046616 | Ga0495668_0044583 | Ga0495668_0044583_1157_2209 | 347 |
| 118 | 3300046660 | Ga0495625_0000031 | Ga0495625_0000031_173640_174692 | 347 |
| 119 | 3300046660 | Ga0495625_0075252 | Ga0495625_0075252_178_1230 | 347 |
| 120 | 3300046681 | Ga0495647_0001756 | Ga0495647_0001756_5255_6298 | 347 |
| 121 | 3300046692 | Ga0495671_0000273 | Ga0495671_0000273_32505_33557 | 347 |
| 122 | 3300047470 | Ga0495681_0000029 | Ga0495681_0000029_12952_14004 | 347 |
| 123 | 3300049459 | Ga0495678_005203 | Ga0495678_005203_4250_5302 | 347 |
| 124 | 3300049568 | Ga0501031_0002801 | Ga0501031_0002801_209_1261 | 347 |
| 125 | 3300049569 | Ga0501032_0022864 | Ga0501032_0022864_193_1245 | 347 |
| 126 | 3300049570 | Ga0501033_0253906 | Ga0501033_0253906_10_1062 | 347 |
| 127 | 3300049571 | Ga0501034_0030621 | Ga0501034_0030621_301_1353 | 347 |
| 128 | 3300049573 | Ga0501037_0006783 | Ga0501037_0006783_3702_4754 | 347 |
| 129 | 3300049574 | Ga0501038_0024541 | Ga0501038_0024541_4117_5169 | 347 |
| 130 | 3300049575 | Ga0501039_0021805 | Ga0501039_0021805_195_1247 | 347 |
| 131 | 3300049578 | Ga0501042_0046663 | Ga0501042_0046663_223_1275 | 347 |
| 132 | 3300049579 | Ga0501043_0016922 | Ga0501043_0016922_4033_5085 | 347 |
| 133 | 3300049580 | Ga0501046_0005823 | Ga0501046_0005823_467_1519 | 347 |
| 134 | 3300049581 | Ga0501047_0147472 | Ga0501047_0147472_1069_2121 | 347 |
| 135 | 3300049581 | Ga0501047_0261669 | Ga0501047_0261669_315_1367 | 347 |
| 136 | 3300049582 | Ga0501048_0027025 | Ga0501048_0027025_226_1278 | 347 |
| 137 | 3300049583 | Ga0501067_0073824 | Ga0501067_0073824_53_1105 | 347 |
| 138 | 3300049584 | Ga0501068_0106349 | Ga0501068_0106349_290_1342 | 347 |
| 139 | 3300049586 | Ga0501070_0028683 | Ga0501070_0028683_530_1582 | 347 |
| 140 | 3300049589 | Ga0501073_0143864 | Ga0501073_0143864_390_1442 | 347 |
| 141 | 3300049590 | Ga0501074_0110310 | Ga0501074_0110310_122_1174 | 347 |
| 142 | 3300049741 | Ga0501079_0023183 | Ga0501079_0023183_10_1062 | 347 |
| 143 | 3300049744 | Ga0501083_0004690 | Ga0501083_0004690_214_1266 | 347 |
| 144 | 3300049822 | Ga0501035_0159639 | Ga0501035_0159639_271_1323 | 347 |
| 145 | 3300049823 | Ga0501044_0054213 | Ga0501044_0054213_114_1166 | 347 |
| 146 | 3300049823 | Ga0501044_0124058 | Ga0501044_0124058_92_1144 | 347 |
| 147 | 3300049823 | Ga0501044_0262483 | Ga0501044_0262483_114_1166 | 347 |
| 148 | 3300049824 | Ga0501045_0098612 | Ga0501045_0098612_341_1393 | 347 |
| 149 | 3300050511 | nmdc:mga08y16_12543_c1 | nmdc:mga08y16_12543_c1_3402_4448 | 347 |
| 150 | 3300053134 | Ga0500658_0000285 | Ga0500658_0000285_121_1167 | 347 |
| 151 | 3300053139 | Ga0500568_0007831 | Ga0500568_0007831_1500_2543 | 347 |
| 152 | 3300053153 | Ga0500616_0034755 | Ga0500616_0034755_613_1665 | 347 |
| 153 | 3300054114 | Ga0501084_0126173 | Ga0501084_0126173_888_1940 | 347 |
| 154 | 3300060353 | Ga0501082_0109554 | Ga0501082_0109554_881_1933 | 347 |
| 155 | iso_pu_bacteria | 2984555340 | 2984555543 | 347 |
| 156 | iso_pu_bacteria | 2984564862 | 2984566344 | 347 |
| 157 | iso_pu_bacteria | 2993356040 | 2993357359 | 347 |
| 158 | iso_pu_bacteria | 3007252601 | 3007253978 | 347 |
| 159 | 3300005336 | Ga0070680_100248341 | Ga0070680_1002483412 | 348 |
| 160 | 3300005436 | Ga0070713_100096506 | Ga0070713_1000965062 | 348 |
| 161 | 3300005445 | Ga0070708_100109393 | Ga0070708_1001093932 | 348 |
| 162 | 3300005458 | Ga0070681_10064321 | Ga0070681_100643212 | 348 |
| 163 | 3300005467 | Ga0070706_100022846 | Ga0070706_1000228463 | 348 |
| 164 | 3300005467 | Ga0070706_100142872 | Ga0070706_1001428721 | 348 |
| 165 | 3300005468 | Ga0070707_100269541 | Ga0070707_1002695411 | 348 |
| 166 | 3300005530 | Ga0070679_100340213 | Ga0070679_1003402131 | 348 |
| 167 | 3300005563 | Ga0068855_100059932 | Ga0068855_1000599322 | 348 |
| 168 | 3300005577 | Ga0068857_100064501 | Ga0068857_1000645013 | 348 |
| 169 | 3300005843 | Ga0068860_100283076 | Ga0068860_1002830762 | 348 |
| 170 | 3300006028 | Ga0070717_10100861 | Ga0070717_101008613 | 348 |
| 171 | 3300009093 | Ga0105240_10004139 | Ga0105240_1000413914 | 348 |
| 172 | 3300009147 | Ga0114129_10157919 | Ga0114129_101579193 | 348 |
| 173 | 3300015261 | Ga0182006_1015267 | Ga0182006_10152672 | 348 |
| 174 | 3300022467 | Ga0224712_10100038 | Ga0224712_101000381 | 348 |
| 175 | 3300025909 | Ga0207705_10038096 | Ga0207705_100380963 | 348 |
| 176 | 3300025910 | Ga0207684_10019721 | Ga0207684_100197212 | 348 |
| 177 | 3300025910 | Ga0207684_10134703 | Ga0207684_101347032 | 348 |
| 178 | 3300025913 | Ga0207695_10028582 | Ga0207695_100285823 | 348 |
| 179 | 3300025914 | Ga0207671_10060535 | Ga0207671_100605352 | 348 |
| 180 | 3300025921 | Ga0207652_10487129 | Ga0207652_104871291 | 348 |
| 181 | 3300025928 | Ga0207700_10059863 | Ga0207700_100598632 | 348 |
| 182 | 3300025949 | Ga0207667_10107695 | Ga0207667_101076952 | 348 |
| 183 | 3300026116 | Ga0207674_10038560 | Ga0207674_100385603 | 348 |
| 184 | 3300027312 | Ga0209371_1000929 | Ga0209371_100092917 | 348 |
| 185 | 3300028381 | Ga0268264_10246947 | Ga0268264_102469472 | 348 |
| 186 | 3300028800 | Ga0265338_10011307 | Ga0265338_100113077 | 348 |
| 187 | 3300030500 | Ga0268256_1000782 | Ga0268256_100078217 | 348 |
| 188 | 3300035118 | Ga0373954_0007899 | Ga0373954_0007899_441_1571 | 348 |
| 189 | 3300035119 | Ga0373956_0000380 | Ga0373956_0000380_6762_7892 | 348 |
| 190 | 3300035695 | Ga0373927_0000025 | Ga0373927_0000025_54877_55944 | 348 |
| 191 | 3300042439 | Ga0439464_0005488 | Ga0439464_0005488_322_1389 | 348 |
| 192 | 3300042876 | Ga0451577_0359032 | Ga0451577_0359032_118_1167 | 348 |
| 193 | 3300044656 | Ga0466969_0000718 | Ga0466969_0000718_12615_13667 | 348 |
| 194 | 3300044684 | Ga0466966_0001140 | Ga0466966_0001140_3384_4436 | 348 |
| 195 | 3300044706 | Ga0466964_0011745 | Ga0466964_0011745_1510_2562 | 348 |
| 196 | 3300044712 | Ga0453684_0210277 | Ga0453684_0210277_39_1088 | 348 |
| 197 | 3300044735 | Ga0466968_0000582 | Ga0466968_0000582_8090_9142 | 348 |
| 198 | 3300044765 | Ga0466970_0000527 | Ga0466970_0000527_726_1778 | 348 |
| 199 | 3300046458 | Ga0495591_000300 | Ga0495591_000300_37198_38268 | 348 |
| 200 | 3300046507 | Ga0495606_0000729 | Ga0495606_0000729_6624_7694 | 348 |
| 201 | 3300046519 | Ga0495632_0008700 | Ga0495632_0008700_4120_5190 | 348 |
| 202 | 3300046665 | Ga0495661_0000138 | Ga0495661_0000138_77560_78630 | 348 |
| 203 | 3300048907 | Ga0496104_0022417 | Ga0496104_0022417_4508_5596 | 348 |
| 204 | 3300049573 | Ga0501037_0013126 | Ga0501037_0013126_3560_4609 | 348 |
| 205 | 3300049586 | Ga0501070_0151247 | Ga0501070_0151247_747_1796 | 348 |
| 206 | 3300049823 | Ga0501044_0021077 | Ga0501044_0021077_5816_6865 | 348 |
| 207 | 3300053178 | Ga0500637_0020239 | Ga0500637_0020239_915_1991 | 348 |
| 208 | iso_pu_bacteria | 2511231031 | 2511414489 | 348 |
| 209 | iso_pu_bacteria | 2511231156 | 2511824198 | 348 |
| 210 | iso_pu_bacteria | 2599185248 | 2599769936 | 348 |
| 211 | iso_pu_bacteria | 2599185289 | 2599887260 | 348 |
| 212 | iso_pu_bacteria | 2599185291 | 2599898575 | 348 |
| 213 | iso_pu_bacteria | 2599185302 | 2599942652 | 348 |
| 214 | iso_pu_bacteria | 2599185304 | 2599953401 | 348 |
| 215 | iso_pu_bacteria | 2599185305 | 2599959034 | 348 |
| 216 | iso_pu_bacteria | 2599185306 | 2599964306 | 348 |
| 217 | iso_pu_bacteria | 2599185308 | 2599975823 | 348 |
| 218 | iso_pu_bacteria | 2599185309 | 2599982416 | 348 |
| 219 | iso_pu_bacteria | 2599185310 | 2599989199 | 348 |
| 220 | iso_pu_bacteria | 2599185311 | 2599994537 | 348 |
| 221 | iso_pu_bacteria | 2599185312 | 2599999393 | 348 |
| 222 | iso_pu_bacteria | 2599185313 | 2600005985 | 348 |
| 223 | iso_pu_bacteria | 2599185314 | 2600009540 | 348 |
| 224 | iso_pu_bacteria | 2599185315 | 2600017122 | 348 |
| 225 | iso_pu_bacteria | 2599185316 | 2600023490 | 348 |
| 226 | iso_pu_bacteria | 2599185317 | 2600029167 | 348 |
| 227 | iso_pu_bacteria | 2599185319 | 2600042100 | 348 |
| 228 | iso_pu_bacteria | 2599185320 | 2600047097 | 348 |
| 229 | iso_pu_bacteria | 2599185321 | 2600051945 | 348 |
| 230 | iso_pu_bacteria | 2599185323 | 2600064942 | 348 |
| 231 | iso_pu_bacteria | 2599185324 | 2600069824 | 348 |
| 232 | iso_pu_bacteria | 2599185325 | 2600077353 | 348 |
| 233 | iso_pu_bacteria | 2600254930 | 2600358541 | 348 |
| 234 | iso_pu_bacteria | 2667528170 | 2671091067 | 348 |
| 235 | iso_pu_bacteria | 2667528176 | 2671124635 | 348 |
| 236 | iso_pu_bacteria | 2713897148 | 2715753478 | 348 |
| 237 | iso_pu_bacteria | 2808606361 | 2808858542 | 348 |
| 238 | iso_pu_bacteria | 2808606376 | 2808925652 | 348 |
| 239 | iso_pu_bacteria | 2808606378 | 2808938731 | 348 |
| 240 | iso_pu_bacteria | 2808606380 | 2808947664 | 348 |
| 241 | iso_pu_bacteria | 2808606383 | 2808967027 | 348 |
| 242 | iso_pu_bacteria | 2808606389 | 2809001857 | 348 |
| 243 | iso_pu_bacteria | 2825651385 | 2825657122 | 348 |
| 244 | iso_pu_bacteria | 2842832357 | 2842835281 | 348 |
| 245 | iso_pu_bacteria | 2842843487 | 2842844100 | 348 |
| 246 | iso_pu_bacteria | 2842854478 | 2842855094 | 348 |
| 247 | iso_pu_bacteria | 2913036834 | 2913040445 | 348 |
| 248 | iso_pu_bacteria | 2919385768 | 2919391044 | 348 |
| 249 | iso_pu_bacteria | 2919487758 | 2919492197 | 348 |
| 250 | iso_pu_bacteria | 2923586266 | 2923587950 | 348 |
| 251 | iso_pu_bacteria | 2929144301 | 2929146384 | 348 |
| 252 | iso_pu_bacteria | 2931369376 | 2931374638 | 348 |
| 253 | iso_pu_bacteria | 2969304461 | 2969307067 | 348 |
| 254 | iso_pu_bacteria | 2974289157 | 2974291526 | 348 |
| 255 | iso_pu_bacteria | 2998139840 | 2998142251 | 348 |
| 256 | iso_pu_bacteria | 3007315729 | 3007317274 | 348 |
| 257 | iso_pu_bacteria | 3007861166 | 3007862457 | 348 |
| 258 | iso_pu_bacteria | 3007866637 | 3007868567 | 348 |
| 259 | iso_pu_bacteria | 8029995093 | 8029998459 | 348 |
| 260 | iso_pu_bacteria | 8056143049 | 8056146891 | 348 |
| 261 | iso_pu_bacteria | 8056166840 | 8056168821 | 348 |
| 262 | 3300003759 | Ga0055525_1000099 | Ga0055525_100009957 | 349 |
| 263 | 3300025230 | Ga0209563_100081 | Ga0209563_10008169 | 349 |
| 264 | 3300047443 | Ga0495687_000041 | Ga0495687_000041_80158_81255 | 349 |
| 265 | 3300049551 | Ga0501335_004705 | Ga0501335_004705_88_1146 | 349 |
| 266 | 3300049658 | Ga0501211_000203 | Ga0501211_000203_1854_2912 | 349 |
| 267 | 3300053730 | Ga0500645_018485 | Ga0500645_018485_902_1960 | 349 |
| 268 | 3300003316 | rootH1_10003422 | rootH1_1000342219 | 350 |
| 269 | 3300003320 | rootH2_10062064 | rootH2_100620644 | 350 |
| 270 | 3300003322 | rootL2_10015926 | rootL2_100159263 | 350 |
| 271 | 3300003323 | rootH1_10001636 | rootH1_100016369 | 350 |
| 272 | 3300003323 | rootH1_10010775 | rootH1_100107755 | 350 |
| 273 | 3300003323 | rootH1_10011885 | rootH1_100118854 | 350 |
| 274 | 3300003791 | Ga0055530_10000141 | Ga0055530_1000014141 | 350 |
| 275 | 3300003792 | Ga0055540_1000171 | Ga0055540_100017141 | 350 |
| 276 | 3300003794 | Ga0055531_10000438 | Ga0055531_1000043825 | 350 |
| 277 | 3300005288 | Ga0065714_10002454 | Ga0065714_1000245423 | 350 |
| 278 | 3300005338 | Ga0068868_100151962 | Ga0068868_1001519622 | 350 |
| 279 | 3300005344 | Ga0070661_100242020 | Ga0070661_1002420201 | 350 |
| 280 | 3300005347 | Ga0070668_100054348 | Ga0070668_1000543482 | 350 |
| 281 | 3300005367 | Ga0070667_100082011 | Ga0070667_1000820112 | 350 |
| 282 | 3300005455 | Ga0070663_100014470 | Ga0070663_1000144704 | 350 |
| 283 | 3300005459 | Ga0068867_100151545 | Ga0068867_1001515452 | 350 |
| 284 | 3300005466 | Ga0070685_10000770 | Ga0070685_1000077012 | 350 |
| 285 | 3300005539 | Ga0068853_100040948 | Ga0068853_1000409482 | 350 |
| 286 | 3300005548 | Ga0070665_100348785 | Ga0070665_1003487851 | 350 |
| 287 | 3300005563 | Ga0068855_100079183 | Ga0068855_1000791833 | 350 |
| 288 | 3300005563 | Ga0068855_100559691 | Ga0068855_1005596912 | 350 |
| 289 | 3300005578 | Ga0068854_100066540 | Ga0068854_1000665402 | 350 |
| 290 | 3300005614 | Ga0068856_100074869 | Ga0068856_1000748693 | 350 |
| 291 | 3300005616 | Ga0068852_100063549 | Ga0068852_1000635492 | 350 |
| 292 | 3300005617 | Ga0068859_100219214 | Ga0068859_1002192142 | 350 |
| 293 | 3300005834 | Ga0068851_10001629 | Ga0068851_100016292 | 350 |
| 294 | 3300005841 | Ga0068863_100029887 | Ga0068863_1000298875 | 350 |
| 295 | 3300005841 | Ga0068863_100095218 | Ga0068863_1000952182 | 350 |
| 296 | 3300005844 | Ga0068862_100079885 | Ga0068862_1000798852 | 350 |
| 297 | 3300005844 | Ga0068862_100418351 | Ga0068862_1004183511 | 350 |
| 298 | 3300006058 | Ga0075432_10013326 | Ga0075432_100133262 | 350 |
| 299 | 3300006175 | Ga0070712_100077561 | Ga0070712_1000775612 | 350 |
| 300 | 3300006353 | Ga0075370_10055781 | Ga0075370_100557812 | 350 |
| 301 | 3300006358 | Ga0068871_100097303 | Ga0068871_1000973032 | 350 |
| 302 | 3300006844 | Ga0075428_100024961 | Ga0075428_1000249612 | 350 |
| 303 | 3300006844 | Ga0075428_100043719 | Ga0075428_1000437193 | 350 |
| 304 | 3300006847 | Ga0075431_100432402 | Ga0075431_1004324021 | 350 |
| 305 | 3300006852 | Ga0075433_10052856 | Ga0075433_100528562 | 350 |
| 306 | 3300006871 | Ga0075434_100076780 | Ga0075434_1000767803 | 350 |
| 307 | 3300006931 | Ga0097620_100219215 | Ga0097620_1002192152 | 350 |
| 308 | 3300007076 | Ga0075435_100078252 | Ga0075435_1000782521 | 350 |
| 309 | 3300009011 | Ga0105251_10000001 | Ga0105251_10000001361 | 350 |
| 310 | 3300009093 | Ga0105240_10001821 | Ga0105240_1000182130 | 350 |
| 311 | 3300009093 | Ga0105240_10043866 | Ga0105240_100438662 | 350 |
| 312 | 3300009093 | Ga0105240_10078341 | Ga0105240_100783413 | 350 |
| 313 | 3300009093 | Ga0105240_10117107 | Ga0105240_101171072 | 350 |
| 314 | 3300009094 | Ga0111539_10024314 | Ga0111539_100243146 | 350 |
| 315 | 3300009147 | Ga0114129_10090403 | Ga0114129_100904033 | 350 |
| 316 | 3300009174 | Ga0105241_10103134 | Ga0105241_101031342 | 350 |
| 317 | 3300009545 | Ga0105237_10129631 | Ga0105237_101296312 | 350 |
| 318 | 3300009551 | Ga0105238_10004018 | Ga0105238_1000401811 | 350 |
| 319 | 3300009551 | Ga0105238_10051029 | Ga0105238_100510292 | 350 |
| 320 | 3300009551 | Ga0105238_10316343 | Ga0105238_103163432 | 350 |
| 321 | 3300009553 | Ga0105249_10041879 | Ga0105249_100418794 | 350 |
| 322 | 3300010375 | Ga0105239_10013244 | Ga0105239_100132442 | 350 |
| 323 | 3300010375 | Ga0105239_10513851 | Ga0105239_105138511 | 350 |
| 324 | 3300013100 | Ga0157373_10182361 | Ga0157373_101823612 | 350 |
| 325 | 3300013102 | Ga0157371_10003910 | Ga0157371_1000391010 | 350 |
| 326 | 3300013104 | Ga0157370_10153598 | Ga0157370_101535982 | 350 |
| 327 | 3300013105 | Ga0157369_10003028 | Ga0157369_1000302812 | 350 |
| 328 | 3300013105 | Ga0157369_10033149 | Ga0157369_100331494 | 350 |
| 329 | 3300013296 | Ga0157374_10195488 | Ga0157374_101954882 | 350 |
| 330 | 3300013297 | Ga0157378_10113475 | Ga0157378_101134752 | 350 |
| 331 | 3300013307 | Ga0157372_10122660 | Ga0157372_101226601 | 350 |
| 332 | 3300013307 | Ga0157372_10287729 | Ga0157372_102877292 | 350 |
| 333 | 3300013308 | Ga0157375_10389373 | Ga0157375_103893732 | 350 |
| 334 | 3300014325 | Ga0163163_10437431 | Ga0163163_104374311 | 350 |
| 335 | 3300014497 | Ga0182008_10008526 | Ga0182008_100085265 | 350 |
| 336 | 3300014969 | Ga0157376_10199507 | Ga0157376_101995072 | 350 |
| 337 | 3300015261 | Ga0182006_1000866 | Ga0182006_10008663 | 350 |
| 338 | 3300015262 | Ga0182007_10002091 | Ga0182007_100020919 | 350 |
| 339 | 3300017792 | Ga0163161_10000066 | Ga0163161_10000066111 | 350 |
| 340 | 3300025292 | Ga0209676_1000020 | Ga0209676_1000020400 | 350 |
| 341 | 3300025292 | Ga0209676_1005941 | Ga0209676_10059414 | 350 |
| 342 | 3300025298 | Ga0209050_1000037 | Ga0209050_1000037301 | 350 |
| 343 | 3300025298 | Ga0209050_1002215 | Ga0209050_10022158 | 350 |
| 344 | 3300025303 | Ga0209051_1000380 | Ga0209051_100038038 | 350 |
| 345 | 3300025304 | Ga0209257_1000005 | Ga0209257_10000051334 | 350 |
| 346 | 3300025304 | Ga0209257_1014591 | Ga0209257_10145912 | 350 |
| 347 | 3300025321 | Ga0207656_10011560 | Ga0207656_100115602 | 350 |
| 348 | 3300025728 | Ga0207655_1008877 | Ga0207655_10088776 | 350 |
| 349 | 3300025735 | Ga0207713_1001199 | Ga0207713_100119919 | 350 |
| 350 | 3300025903 | Ga0207680_10039788 | Ga0207680_100397882 | 350 |
| 351 | 3300025904 | Ga0207647_10005480 | Ga0207647_100054802 | 350 |
| 352 | 3300025913 | Ga0207695_10000014 | Ga0207695_1000001437 | 350 |
| 353 | 3300025913 | Ga0207695_10098368 | Ga0207695_100983682 | 350 |
| 354 | 3300025913 | Ga0207695_10170688 | Ga0207695_101706882 | 350 |
| 355 | 3300025913 | Ga0207695_10242658 | Ga0207695_102426582 | 350 |
| 356 | 3300025914 | Ga0207671_10015356 | Ga0207671_100153565 | 350 |
| 357 | 3300025924 | Ga0207694_10002128 | Ga0207694_100021283 | 350 |
| 358 | 3300025924 | Ga0207694_10003412 | Ga0207694_100034122 | 350 |
| 359 | 3300025924 | Ga0207694_10007982 | Ga0207694_100079829 | 350 |
| 360 | 3300025925 | Ga0207650_10043877 | Ga0207650_100438772 | 350 |
| 361 | 3300025933 | Ga0207706_10178706 | Ga0207706_101787062 | 350 |
| 362 | 3300025939 | Ga0207665_10111302 | Ga0207665_101113022 | 350 |
| 363 | 3300025949 | Ga0207667_10117154 | Ga0207667_101171543 | 350 |
| 364 | 3300025961 | Ga0207712_10003217 | Ga0207712_1000321710 | 350 |
| 365 | 3300025981 | Ga0207640_10027516 | Ga0207640_100275162 | 350 |
| 366 | 3300025986 | Ga0207658_10005884 | Ga0207658_100058845 | 350 |
| 367 | 3300025986 | Ga0207658_10008847 | Ga0207658_100088476 | 350 |
| 368 | 3300026035 | Ga0207703_10006849 | Ga0207703_100068494 | 350 |
| 369 | 3300026041 | Ga0207639_10053310 | Ga0207639_100533102 | 350 |
| 370 | 3300026067 | Ga0207678_10003270 | Ga0207678_100032705 | 350 |
| 371 | 3300026078 | Ga0207702_10039872 | Ga0207702_100398722 | 350 |
| 372 | 3300026078 | Ga0207702_10148738 | Ga0207702_101487382 | 350 |
| 373 | 3300026089 | Ga0207648_10285093 | Ga0207648_102850931 | 350 |
| 374 | 3300027111 | Ga0209281_1001783 | Ga0209281_10017836 | 350 |
| 375 | 3300027907 | Ga0207428_10026462 | Ga0207428_100264623 | 350 |
| 376 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012336 | 350 |
| 377 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012663 | 350 |
| 378 | 3300028379 | Ga0268266_10004174 | Ga0268266_1000417410 | 350 |
| 379 | 3300028379 | Ga0268266_10023213 | Ga0268266_100232135 | 350 |
| 380 | 3300028380 | Ga0268265_10089273 | Ga0268265_100892732 | 350 |
| 381 | 3300028794 | Ga0307515_10000016 | Ga0307515_10000016309 | 350 |
| 382 | 3300030735 | Ga0316178_1094315 | Ga0316178_10943153 | 350 |
| 383 | 3300031456 | Ga0307513_10029615 | Ga0307513_100296155 | 350 |
| 384 | 3300031507 | Ga0307509_10016260 | Ga0307509_100162603 | 350 |
| 385 | 3300031507 | Ga0307509_10035922 | Ga0307509_100359225 | 350 |
| 386 | 3300031548 | Ga0307408_100004852 | Ga0307408_1000048522 | 350 |
| 387 | 3300031548 | Ga0307408_100006406 | Ga0307408_1000064062 | 350 |
| 388 | 3300031548 | Ga0307408_100140781 | Ga0307408_1001407812 | 350 |
| 389 | 3300031548 | Ga0307408_100173637 | Ga0307408_1001736372 | 350 |
| 390 | 3300031731 | Ga0307405_10012466 | Ga0307405_100124665 | 350 |
| 391 | 3300031731 | Ga0307405_10019563 | Ga0307405_100195634 | 350 |
| 392 | 3300031731 | Ga0307405_10085820 | Ga0307405_100858201 | 350 |
| 393 | 3300031901 | Ga0307406_10001512 | Ga0307406_100015125 | 350 |
| 394 | 3300031901 | Ga0307406_10309899 | Ga0307406_103098991 | 350 |
| 395 | 3300031903 | Ga0307407_10007910 | Ga0307407_100079104 | 350 |
| 396 | 3300031903 | Ga0307407_10045144 | Ga0307407_100451442 | 350 |
| 397 | 3300031911 | Ga0307412_10001066 | Ga0307412_100010662 | 350 |
| 398 | 3300031911 | Ga0307412_10001611 | Ga0307412_100016115 | 350 |
| 399 | 3300031911 | Ga0307412_10008226 | Ga0307412_100082262 | 350 |
| 400 | 3300031911 | Ga0307412_10037285 | Ga0307412_100372853 | 350 |
| 401 | 3300031995 | Ga0307409_100005311 | Ga0307409_1000053115 | 350 |
| 402 | 3300032002 | Ga0307416_100149830 | Ga0307416_1001498303 | 350 |
| 403 | 3300032004 | Ga0307414_10007004 | Ga0307414_100070042 | 350 |
| 404 | 3300032004 | Ga0307414_10091649 | Ga0307414_100916492 | 350 |
| 405 | 3300032004 | Ga0307414_10290895 | Ga0307414_102908951 | 350 |
| 406 | 3300032005 | Ga0307411_10067595 | Ga0307411_100675952 | 350 |
| 407 | 3300032005 | Ga0307411_10092844 | Ga0307411_100928442 | 350 |
| 408 | 3300032005 | Ga0307411_10157846 | Ga0307411_101578462 | 350 |
| 409 | 3300032005 | Ga0307411_10178706 | Ga0307411_101787062 | 350 |
| 410 | 3300033180 | Ga0307510_10000324 | Ga0307510_1000032427 | 350 |
| 411 | 3300037418 | Ga0395900_0050014 | Ga0395900_0050014_3204_4268 | 350 |
| 412 | 3300039437 | Ga0436365_1678853 | Ga0436365_1678853_1399_2454 | 350 |
| 413 | 3300041405 | Ga0439438_000039 | Ga0439438_000039_15450_16550 | 350 |
| 414 | 3300041405 | Ga0439438_000379 | Ga0439438_000379_9412_10515 | 350 |
| 415 | 3300041405 | Ga0439438_001196 | Ga0439438_001196_8805_9890 | 350 |
| 416 | 3300041405 | Ga0439438_001599 | Ga0439438_001599_6082_7164 | 350 |
| 417 | 3300041405 | Ga0439438_001845 | Ga0439438_001845_5411_6493 | 350 |
| 418 | 3300041405 | Ga0439438_003426 | Ga0439438_003426_2142_3245 | 350 |
| 419 | 3300041407 | Ga0439447_000475 | Ga0439447_000475_149_1252 | 350 |
| 420 | 3300041407 | Ga0439447_000519 | Ga0439447_000519_7940_9043 | 350 |
| 421 | 3300041407 | Ga0439447_001031 | Ga0439447_001031_8631_9731 | 350 |
| 422 | 3300041407 | Ga0439447_002865 | Ga0439447_002865_245_1348 | 350 |
| 423 | 3300041407 | Ga0439447_012694 | Ga0439447_012694_831_1913 | 350 |
| 424 | 3300041411 | Ga0439466_0000127 | Ga0439466_0000127_6569_7672 | 350 |
| 425 | 3300041411 | Ga0439466_0007364 | Ga0439466_0007364_879_1979 | 350 |
| 426 | 3300041411 | Ga0439466_0008636 | Ga0439466_0008636_2165_3268 | 350 |
| 427 | 3300041413 | Ga0439465_0016836 | Ga0439465_0016836_358_1461 | 350 |
| 428 | 3300041997 | Ga0439431_0001988 | Ga0439431_0001988_2924_4024 | 350 |
| 429 | 3300042006 | Ga0439432_000233 | Ga0439432_000233_6852_7955 | 350 |
| 430 | 3300042006 | Ga0439432_017912 | Ga0439432_017912_928_2013 | 350 |
| 431 | 3300042010 | Ga0439452_000081 | Ga0439452_000081_45858_46940 | 350 |
| 432 | 3300042010 | Ga0439452_000250 | Ga0439452_000250_23347_24450 | 350 |
| 433 | 3300042010 | Ga0439452_000684 | Ga0439452_000684_14856_15959 | 350 |
| 434 | 3300042010 | Ga0439452_003373 | Ga0439452_003373_2874_3956 | 350 |
| 435 | 3300042010 | Ga0439452_004311 | Ga0439452_004311_3647_4750 | 350 |
| 436 | 3300042013 | Ga0439456_000527 | Ga0439456_000527_468_1550 | 350 |
| 437 | 3300042016 | Ga0439463_003192 | Ga0439463_003192_1214_2317 | 350 |
| 438 | 3300042115 | Ga0450911_000010 | Ga0450911_000010_127101_128183 | 350 |
| 439 | 3300042121 | Ga0450919_003157 | Ga0450919_003157_64_1167 | 350 |
| 440 | 3300042138 | Ga0450903_014865 | Ga0450903_014865_28_1131 | 350 |
| 441 | 3300042139 | Ga0450904_001143 | Ga0450904_001143_1254_2336 | 350 |
| 442 | 3300042145 | Ga0450906_000050 | Ga0450906_000050_6201_7283 | 350 |
| 443 | 3300042146 | Ga0450907_000001 | Ga0450907_000001_175759_176862 | 350 |
| 444 | 3300042146 | Ga0450907_000365 | Ga0450907_000365_12187_13290 | 350 |
| 445 | 3300042147 | Ga0450910_001903 | Ga0450910_001903_1343_2446 | 350 |
| 446 | 3300042156 | Ga0439446_0009690 | Ga0439446_0009690_34_1089 | 350 |
| 447 | 3300042156 | Ga0439446_0017814 | Ga0439446_0017814_149_1252 | 350 |
| 448 | 3300042184 | Ga0450908_001083 | Ga0450908_001083_2852_3955 | 350 |
| 449 | 3300042435 | Ga0439434_0000001 | Ga0439434_0000001_936_2039 | 350 |
| 450 | 3300042435 | Ga0439434_0026766 | Ga0439434_0026766_222_1325 | 350 |
| 451 | 3300042461 | Ga0439460_0000239 | Ga0439460_0000239_8127_9230 | 350 |
| 452 | 3300042531 | Ga0450918_009972 | Ga0450918_009972_413_1495 | 350 |
| 453 | 3300042876 | Ga0451577_0023438 | Ga0451577_0023438_1726_2778 | 350 |
| 454 | 3300042993 | Ga0439440_0000156 | Ga0439440_0000156_6138_7241 | 350 |
| 455 | 3300044673 | Ga0453683_0038352 | Ga0453683_0038352_513_1565 | 350 |
| 456 | 3300045051 | Ga0451576_0057093 | Ga0451576_0057093_546_1619 | 350 |
| 457 | 3300046452 | Ga0495617_009853 | Ga0495617_009853_1981_3063 | 350 |
| 458 | 3300046452 | Ga0495617_018189 | Ga0495617_018189_1116_2198 | 350 |
| 459 | 3300046453 | Ga0495627_000087 | Ga0495627_000087_39680_40762 | 350 |
| 460 | 3300046453 | Ga0495627_000101 | Ga0495627_000101_20698_21780 | 350 |
| 461 | 3300046453 | Ga0495627_008555 | Ga0495627_008555_1712_2794 | 350 |
| 462 | 3300046458 | Ga0495591_000199 | Ga0495591_000199_49775_50857 | 350 |
| 463 | 3300046458 | Ga0495591_003292 | Ga0495591_003292_2959_4041 | 350 |
| 464 | 3300046458 | Ga0495591_005534 | Ga0495591_005534_2847_3929 | 350 |
| 465 | 3300046460 | Ga0495638_0000117 | Ga0495638_0000117_97123_98205 | 350 |
| 466 | 3300046471 | Ga0495650_0014388 | Ga0495650_0014388_2919_4001 | 350 |
| 467 | 3300046474 | Ga0495605_0023553 | Ga0495605_0023553_426_1508 | 350 |
| 468 | 3300046491 | Ga0495584_0000739 | Ga0495584_0000739_18239_19321 | 350 |
| 469 | 3300046492 | Ga0495585_0000185 | Ga0495585_0000185_4554_5636 | 350 |
| 470 | 3300046492 | Ga0495585_0032212 | Ga0495585_0032212_440_1522 | 350 |
| 471 | 3300046501 | Ga0495607_0000517 | Ga0495607_0000517_9744_10841 | 350 |
| 472 | 3300046501 | Ga0495607_0014971 | Ga0495607_0014971_2532_3635 | 350 |
| 473 | 3300046506 | Ga0495583_0015656 | Ga0495583_0015656_2366_3448 | 350 |
| 474 | 3300046507 | Ga0495606_0012470 | Ga0495606_0012470_4176_5258 | 350 |
| 475 | 3300046513 | Ga0495616_0000454 | Ga0495616_0000454_18228_19310 | 350 |
| 476 | 3300046513 | Ga0495616_0019269 | Ga0495616_0019269_160_1242 | 350 |
| 477 | 3300046515 | Ga0495620_0000257 | Ga0495620_0000257_8128_9210 | 350 |
| 478 | 3300046518 | Ga0495631_0005114 | Ga0495631_0005114_126_1208 | 350 |
| 479 | 3300046518 | Ga0495631_0025683 | Ga0495631_0025683_273_1355 | 350 |
| 480 | 3300046518 | Ga0495631_0029840 | Ga0495631_0029840_1120_2202 | 350 |
| 481 | 3300046519 | Ga0495632_0000097 | Ga0495632_0000097_65032_66114 | 350 |
| 482 | 3300046519 | Ga0495632_0037832 | Ga0495632_0037832_14_1096 | 350 |
| 483 | 3300046519 | Ga0495632_0069066 | Ga0495632_0069066_413_1516 | 350 |
| 484 | 3300046520 | Ga0495637_0001309 | Ga0495637_0001309_368_1450 | 350 |
| 485 | 3300046520 | Ga0495637_0062129 | Ga0495637_0062129_136_1218 | 350 |
| 486 | 3300046522 | Ga0495643_0000625 | Ga0495643_0000625_15501_16583 | 350 |
| 487 | 3300046523 | Ga0495644_0005578 | Ga0495644_0005578_1736_2833 | 350 |
| 488 | 3300046524 | Ga0495648_0000172 | Ga0495648_0000172_68681_69763 | 350 |
| 489 | 3300046524 | Ga0495648_0000668 | Ga0495648_0000668_28835_29917 | 350 |
| 490 | 3300046524 | Ga0495648_0061494 | Ga0495648_0061494_776_1861 | 350 |
| 491 | 3300046530 | Ga0495654_0001012 | Ga0495654_0001012_11234_12316 | 350 |
| 492 | 3300046530 | Ga0495654_0023484 | Ga0495654_0023484_146_1228 | 350 |
| 493 | 3300046538 | Ga0495609_0000504 | Ga0495609_0000504_6176_7258 | 350 |
| 494 | 3300046538 | Ga0495609_0067375 | Ga0495609_0067375_152_1234 | 350 |
| 495 | 3300046558 | Ga0495633_0047583 | Ga0495633_0047583_247_1329 | 350 |
| 496 | 3300046648 | Ga0495611_0000024 | Ga0495611_0000024_30515_31597 | 350 |
| 497 | 3300046648 | Ga0495611_0002419 | Ga0495611_0002419_5777_6859 | 350 |
| 498 | 3300046648 | Ga0495611_0006686 | Ga0495611_0006686_3356_4438 | 350 |
| 499 | 3300046660 | Ga0495625_0000861 | Ga0495625_0000861_22725_23807 | 350 |
| 500 | 3300046664 | Ga0495659_0000641 | Ga0495659_0000641_8888_9991 | 350 |
| 501 | 3300046665 | Ga0495661_0008477 | Ga0495661_0008477_2686_3768 | 350 |
| 502 | 3300046665 | Ga0495661_0016477 | Ga0495661_0016477_853_1956 | 350 |
| 503 | 3300046665 | Ga0495661_0020395 | Ga0495661_0020395_390_1487 | 350 |
| 504 | 3300046665 | Ga0495661_0032909 | Ga0495661_0032909_1347_2429 | 350 |
| 505 | 3300046691 | Ga0495670_0000020 | Ga0495670_0000020_84346_85428 | 350 |
| 506 | 3300046691 | Ga0495670_0000112 | Ga0495670_0000112_5904_7007 | 350 |
| 507 | 3300046692 | Ga0495671_0000503 | Ga0495671_0000503_27640_28722 | 350 |
| 508 | 3300046692 | Ga0495671_0001542 | Ga0495671_0001542_12222_13304 | 350 |
| 509 | 3300046692 | Ga0495671_0006195 | Ga0495671_0006195_2197_3279 | 350 |
| 510 | 3300046692 | Ga0495671_0008699 | Ga0495671_0008699_1222_2304 | 350 |
| 511 | 3300046692 | Ga0495671_0037759 | Ga0495671_0037759_1150_2232 | 350 |
| 512 | 3300046694 | Ga0495649_0004543 | Ga0495649_0004543_1399_2481 | 350 |
| 513 | 3300046694 | Ga0495649_0031575 | Ga0495649_0031575_1273_2355 | 350 |
| 514 | 3300046794 | Ga0495589_0000477 | Ga0495589_0000477_1157_2239 | 350 |
| 515 | 3300046810 | Ga0495660_0004243 | Ga0495660_0004243_5521_6603 | 350 |
| 516 | 3300046810 | Ga0495660_0029491 | Ga0495660_0029491_847_1929 | 350 |
| 517 | 3300047320 | Ga0495672_0002027 | Ga0495672_0002027_1109_2191 | 350 |
| 518 | 3300047320 | Ga0495672_0007290 | Ga0495672_0007290_4267_5349 | 350 |
| 519 | 3300047320 | Ga0495672_0014217 | Ga0495672_0014217_1704_2786 | 350 |
| 520 | 3300047469 | Ga0495673_0004428 | Ga0495673_0004428_3760_4842 | 350 |
| 521 | 3300047469 | Ga0495673_0005784 | Ga0495673_0005784_1141_2244 | 350 |
| 522 | 3300047469 | Ga0495673_0065922 | Ga0495673_0065922_406_1488 | 350 |
| 523 | 3300047470 | Ga0495681_0001171 | Ga0495681_0001171_2120_3202 | 350 |
| 524 | 3300047470 | Ga0495681_0005497 | Ga0495681_0005497_1640_2722 | 350 |
| 525 | 3300047472 | Ga0495686_0002983 | Ga0495686_0002983_12525_13595 | 350 |
| 526 | 3300047472 | Ga0495686_0008113 | Ga0495686_0008113_1134_2216 | 350 |
| 527 | 3300048091 | Ga0495626_0006462 | Ga0495626_0006462_3973_5055 | 350 |
| 528 | 3300048091 | Ga0495626_0006994 | Ga0495626_0006994_4585_5667 | 350 |
| 529 | 3300048913 | Ga0496110_0120403 | Ga0496110_0120403_1151_2245 | 350 |
| 530 | 3300048913 | Ga0496110_0217687 | Ga0496110_0217687_316_1494 | 350 |
| 531 | 3300048920 | Ga0496117_0042697 | Ga0496117_0042697_2109_3164 | 350 |
| 532 | 3300048921 | Ga0496118_0000177 | Ga0496118_0000177_104901_105956 | 350 |
| 533 | 3300048921 | Ga0496118_0008563 | Ga0496118_0008563_4438_5493 | 350 |
| 534 | 3300048925 | Ga0496122_0000725 | Ga0496122_0000725_30768_31838 | 350 |
| 535 | 3300048925 | Ga0496122_0004406 | Ga0496122_0004406_1361_2425 | 350 |
| 536 | 3300048926 | Ga0496123_0001443 | Ga0496123_0001443_23994_25064 | 350 |
| 537 | 3300048926 | Ga0496123_0023465 | Ga0496123_0023465_1333_2397 | 350 |
| 538 | 3300048927 | Ga0496124_0252345 | Ga0496124_0252345_192_1256 | 350 |
| 539 | 3300048929 | Ga0496126_0000033 | Ga0496126_0000033_139843_140913 | 350 |
| 540 | 3300049459 | Ga0495678_001245 | Ga0495678_001245_1306_2409 | 350 |
| 541 | 3300049459 | Ga0495678_004383 | Ga0495678_004383_3937_5019 | 350 |
| 542 | 3300049459 | Ga0495678_032996 | Ga0495678_032996_679_1761 | 350 |
| 543 | 3300049460 | Ga0495682_0003820 | Ga0495682_0003820_1312_2415 | 350 |
| 544 | 3300049569 | Ga0501032_0034989 | Ga0501032_0034989_1540_2598 | 350 |
| 545 | 3300049580 | Ga0501046_0018614 | Ga0501046_0018614_322_1392 | 350 |
| 546 | 3300049581 | Ga0501047_0003068 | Ga0501047_0003068_3293_4351 | 350 |
| 547 | 3300049581 | Ga0501047_0090819 | Ga0501047_0090819_548_1618 | 350 |
| 548 | 3300049589 | Ga0501073_0046641 | Ga0501073_0046641_153_1223 | 350 |
| 549 | 3300049671 | Ga0501238_000036 | Ga0501238_000036_20262_21314 | 350 |
| 550 | 3300049674 | Ga0501242_007344 | Ga0501242_007344_115_1173 | 350 |
| 551 | 3300049682 | Ga0501252_000895 | Ga0501252_000895_180_1262 | 350 |
| 552 | 3300049683 | Ga0501253_009362 | Ga0501253_009362_127_1185 | 350 |
| 553 | 3300049686 | Ga0501257_004973 | Ga0501257_004973_712_1770 | 350 |
| 554 | 3300049688 | Ga0501259_001750 | Ga0501259_001750_1422_2480 | 350 |
| 555 | 3300049744 | Ga0501083_0065656 | Ga0501083_0065656_422_1492 | 350 |
| 556 | 3300049758 | Ga0501241_004060 | Ga0501241_004060_1185_2240 | 350 |
| 557 | 3300049823 | Ga0501044_0071990 | Ga0501044_0071990_2020_3084 | 350 |
| 558 | 3300049823 | Ga0501044_0262807 | Ga0501044_0262807_321_1391 | 350 |
| 559 | 3300050507 | nmdc:mga05p37_308100_c1 | nmdc:mga05p37_308100_c1_313_1383 | 350 |
| 560 | 3300050507 | nmdc:mga05p37_9912_c1 | nmdc:mga05p37_9912_c1_1996_3066 | 350 |
| 561 | 3300050511 | nmdc:mga08y16_136861_c1 | nmdc:mga08y16_136861_c1_860_1912 | 350 |
| 562 | 3300050512 | nmdc:mga0n895_39499_c1 | nmdc:mga0n895_39499_c1_1881_2951 | 350 |
| 563 | 3300050512 | nmdc:mga0n895_42311_c1 | nmdc:mga0n895_42311_c1_1629_2699 | 350 |
| 564 | 3300050513 | nmdc:mga0rr50_46484_c1 | nmdc:mga0rr50_46484_c1_536_1606 | 350 |
| 565 | 3300050515 | nmdc:mga0a205_39118_c1 | nmdc:mga0a205_39118_c1_1709_2779 | 350 |
| 566 | 3300053119 | Ga0500595_001265 | Ga0500595_001265_2614_3675 | 350 |
| 567 | 3300053120 | Ga0500597_000186 | Ga0500597_000186_4421_5491 | 350 |
| 568 | 3300053146 | Ga0500588_0000387 | Ga0500588_0000387_990_2051 | 350 |
| 569 | 3300053156 | Ga0500622_0000013 | Ga0500622_0000013_256145_257197 | 350 |
| 570 | 3300054114 | Ga0501084_0063654 | Ga0501084_0063654_1125_2195 | 350 |
| 571 | 3300060353 | Ga0501082_0001156 | Ga0501082_0001156_2283_3353 | 350 |
| 572 | iso_pu_bacteria | 2511231004 | 2511257121 | 350 |
| 573 | iso_pu_bacteria | 2599185188 | 2599502047 | 350 |
| 574 | iso_pu_bacteria | 2599185300 | 2599932893 | 350 |
| 575 | iso_pu_bacteria | 2599185318 | 2600035617 | 350 |
| 576 | iso_pu_bacteria | 2599185322 | 2600057160 | 350 |
| 577 | iso_pu_bacteria | 2643221650 | 2644282557 | 350 |
| 578 | iso_pu_bacteria | 2675903515 | 2678264054 | 350 |
| 579 | iso_pu_bacteria | 2744054620 | 2745004510 | 350 |
| 580 | iso_pu_bacteria | 2791355520 | 2794596872 | 350 |
| 581 | iso_pu_bacteria | 8056155041 | 8056160225 | 350 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zds-assembly1.cif.gz_F | crystal structure of sco6571 from streptomyces coelicolor a3(2) | 0.9345 | 5 | 322 |
| 2zds-assembly1.cif.gz_F | crystal structure of sco6571 from streptomyces coelicolor a3(2) | 0.9149 | 5 | 322 |
| 3p6l-assembly1.cif.gz_A | crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution | 0.8048 | 8 | 322 |
| 6wn6-assembly1.cif.gz_A | crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form | 0.7982 | 1 | 321 |
| 6wn6-assembly1.cif.gz_A | crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form | 0.7928 | 1 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zdsA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9381 | 8 | 322 | 3.20.20.150 |
| 2zdsA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9096 | 8 | 322 | 3.20.20.150 |
| af_Q2G1E4_1_314_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8356 | 5 | 326 | 3.20.20.150 |
| af_Q2G1E4_1_314_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8331 | 5 | 326 | 3.20.20.150 |
| af_P76044_1_262_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8008 | 5 | 321 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5KL40-F1-model_v4 | AP endonuclease | 0.9984 | 1 | 307 |
GO:0004519
|
| AF-A0A531KWC7-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.9974 | 18 | 318 |
GO:0016853
|
| AF-A0A7J5WQ74-F1-model_v4 | AP endonuclease 2 domain | 0.9973 | 97 | 235 |
GO:0004519
|
| AF-A0A519Y544-F1-model_v4 | Sugar phosphate isomerase/epimerase | 0.9968 | 1 | 324 |
GO:0016853
|
| AF-A0A3D2R7S0-F1-model_v4 | AP endonuclease | 0.9968 | 102 | 300 |
GO:0004519
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar