F466106

General Info

Members Datasets Scaffolds Average Seq Length
581 371 504 353

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0217687|Ga0496110_0217687_316_1494
Length 392
Sequence VHRLSQQRNLPQLAPVTFLQLTHYDLKPSCGAGDDMREIKGPGIFLAQFLSDTAPFNSLRSITRWAADLGYVGVQVPTSDPKIFDLTKAAESQTYCDEIAGICRESGVVITELSTHLQGQMVACHPAYNDLFDAIVPAHVAPDLAQRSQWASDQLRLACRASKRLGLSAQATFSGSLLWHTVYPWPQRPANLVEQGFAELARRWKPLLDVADECGVDLCYEVHPSEDIHDGATFERFLDAVGNHKRANLLFDPSHFVLQQLDYLQYIDLYHERIRAFHVKDAEFRPNGRSGVYGGYQNWIDRPGRFRSLGDGQVDFRSIFSKLTQYDYPGWAVLEWECCIKHPEQGAKEGAPFIKEHIIRVAERAFDDFAGASGVGKKGDLEERNRRILGLP

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231031 Pseudomonas sp. GM16 Isolate Nodule
3 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
4 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
5 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
6 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
7 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
8 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
9 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
10 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
11 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
12 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
13 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
14 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
15 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
16 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
17 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
18 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
19 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
20 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
21 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
22 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
23 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
24 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
25 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
26 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
27 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
28 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
29 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
30 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
31 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
32 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
33 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
34 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
35 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
36 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
37 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
38 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
39 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
40 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
41 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
42 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
43 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
44 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
45 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
46 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
47 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
48 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
49 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
50 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
51 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
52 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
53 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
54 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
55 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
56 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
57 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
58 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
59 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
60 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
61 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
62 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
63 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
64 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
65 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
66 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
67 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
68 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
69 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
70 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
71 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
72 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
73 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
76 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
92 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
93 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
94 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
99 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
100 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
119 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
228 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
234 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
235 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
236 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
237 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
238 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
239 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
240 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
241 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
242 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
243 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
244 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
245 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
248 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
249 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
332 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
333 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
334 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
335 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
336 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
341 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
368 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
369 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
370 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
371 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.57
Metatranscriptomes 0.34
Isolates 13.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 4.99
Nodule 0.52
Rhizoplane 5.68
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10003422 3300003316 Bacteria 22736
2 rootH2_10062064 3300003320 Bacteria 9496
3 rootL2_10015926 3300003322 Bacteria 7511
4 rootH1_10001636 3300003323 Bacteria 76904
5 rootH1_10010775 3300003323 Bacteria 11348
6 rootH1_10011885 3300003323 Bacteria 6470
7 Ga0055525_1000099 3300003759 Bacteria 136491
8 Ga0055530_10000141 3300003791 Bacteria 64443
9 Ga0055540_1000171 3300003792 Bacteria 64443
10 Ga0055531_10000438 3300003794 Bacteria 39137
11 Ga0065714_10002454 3300005288 Bacteria 30842
12 Ga0070670_100000001 3300005331 Bacteria 728788
13 Ga0070666_10003916 3300005335 Bacteria 9045
14 Ga0070680_100248341 3300005336 Bacteria 1504
15 Ga0068868_100151962 3300005338 Bacteria 1907
16 Ga0070661_100242020 3300005344 Bacteria 1390
17 Ga0070668_100054348 3300005347 Bacteria 3089
18 Ga0070669_100001723 3300005353 Bacteria 15839
19 Ga0070671_100000033 3300005355 Bacteria 105788
20 Ga0070688_100000741 3300005365 Bacteria 16078
21 Ga0070667_100000405 3300005367 Bacteria 46253
22 Ga0070667_100082011 3300005367 Bacteria 2760
23 Ga0070709_10009626 3300005434 Bacteria 5337
24 Ga0070713_100096506 3300005436 Bacteria 2552
25 Ga0070705_100003644 3300005440 Bacteria 7544
26 Ga0070708_100109393 3300005445 Plasmid 2539
27 Ga0070663_100014470 3300005455 Bacteria 5065
28 Ga0070681_10064321 3300005458 Bacteria 3639
29 Ga0068867_100151545 3300005459 Bacteria 1822
30 Ga0070685_10000008 3300005466 Bacteria 166350
31 Ga0070685_10000770 3300005466 Bacteria 17432
32 Ga0070706_100022846 3300005467 Bacteria 5760
33 Ga0070706_100142872 3300005467 Bacteria 2234
34 Ga0070707_100269541 3300005468 Bacteria 1655
35 Ga0070679_100173451 3300005530 Bacteria 2129
36 Ga0070679_100185139 3300005530 Bacteria 2054
37 Ga0070679_100340213 3300005530 Bacteria 1449
38 Ga0070697_100009299 3300005536 Bacteria 7681
39 Ga0068853_100040948 3300005539 Bacteria 3955
40 Ga0070665_100000024 3300005548 Bacteria 374559
41 Ga0070665_100348785 3300005548 Bacteria 1485
42 Ga0068855_100013165 3300005563 Bacteria 9977
43 Ga0068855_100059932 3300005563 Bacteria 4452
44 Ga0068855_100079183 3300005563 Bacteria 3811
45 Ga0068855_100559691 3300005563 Bacteria 1237
46 Ga0068857_100064501 3300005577 Bacteria 3257
47 Ga0068854_100066540 3300005578 Bacteria 2623
48 Ga0068856_100074869 3300005614 Bacteria 3353
49 Ga0068852_100063549 3300005616 Bacteria 3214
50 Ga0068859_100219214 3300005617 Bacteria 1990
51 Ga0068864_100000006 3300005618 Bacteria 393838
52 Ga0068851_10001629 3300005834 Bacteria 9843
53 Ga0068863_100029887 3300005841 Bacteria 5205
54 Ga0068863_100095218 3300005841 Bacteria 2826
55 Ga0068858_100058058 3300005842 Bacteria 3577
56 Ga0068860_100000259 3300005843 Bacteria 77665
57 Ga0068860_100283076 3300005843 Bacteria 1621
58 Ga0068862_100079885 3300005844 Bacteria 2835
59 Ga0068862_100418351 3300005844 Bacteria 1257
60 Ga0081539_10026589 3300005985 Bacteria 3687
61 Ga0070717_10100861 3300006028 Bacteria 2451
62 Ga0075432_10013326 3300006058 Bacteria 2793
63 Ga0070712_100077561 3300006175 Bacteria 2395
64 Ga0075370_10055781 3300006353 Bacteria 2245
65 Ga0068871_100097303 3300006358 Bacteria 2460
66 Ga0075428_100000418 3300006844 Bacteria 42295
67 Ga0075428_100024961 3300006844 Bacteria 6613
68 Ga0075428_100043719 3300006844 Bacteria 4925
69 Ga0075428_100085428 3300006844 Bacteria 3441
70 Ga0075431_100432402 3300006847 Bacteria 1314
71 Ga0075433_10052856 3300006852 Bacteria 3540
72 Ga0075434_100076780 3300006871 Bacteria 3335
73 Ga0097620_100219215 3300006931 Bacteria 1990
74 Ga0075435_100078252 3300007076 Bacteria 2712
75 Ga0105251_10000001 3300009011 Bacteria 466643
76 Ga0105240_10001821 3300009093 Bacteria 35773
77 Ga0105240_10004139 3300009093 Bacteria 22222
78 Ga0105240_10043866 3300009093 Bacteria 5687
79 Ga0105240_10067898 3300009093 Bacteria 4418
80 Ga0105240_10078341 3300009093 Bacteria 4070
81 Ga0105240_10117107 3300009093 Bacteria 3213
82 Ga0105240_10591627 3300009093 Bacteria 1222
83 Ga0111539_10000310 3300009094 Bacteria 59421
84 Ga0111539_10024314 3300009094 Bacteria 7437
85 Ga0105247_10013121 3300009101 Bacteria 4969
86 Ga0114129_10090403 3300009147 Bacteria 4244
87 Ga0114129_10157919 3300009147 Bacteria 3100
88 Ga0105241_10103134 3300009174 Bacteria 2271
89 Ga0105248_10053484 3300009177 Bacteria 4530
90 Ga0105237_10129631 3300009545 Bacteria 2517
91 Ga0105238_10004018 3300009551 Bacteria 14588
92 Ga0105238_10008966 3300009551 Bacteria 10011
93 Ga0105238_10051029 3300009551 Bacteria 4162
94 Ga0105238_10316343 3300009551 Bacteria 1546
95 Ga0105249_10041879 3300009553 Bacteria 4164
96 Ga0105249_10056764 3300009553 Bacteria 3585
97 Ga0105239_10013244 3300010375 Bacteria 9167
98 Ga0105239_10189052 3300010375 Bacteria 2305
99 Ga0105239_10513851 3300010375 Bacteria 1362
100 Ga0157373_10182361 3300013100 Bacteria 1478
101 Ga0157371_10003910 3300013102 Bacteria 13258
102 Ga0157370_10153598 3300013104 Bacteria 2142
103 Ga0157369_10003028 3300013105 Bacteria 20066
104 Ga0157369_10033149 3300013105 Bacteria 5678
105 Ga0157374_10195488 3300013296 Bacteria 1979
106 Ga0157378_10113475 3300013297 Bacteria 2488
107 Ga0157372_10122660 3300013307 Bacteria 2986
108 Ga0157372_10287729 3300013307 Bacteria 1911
109 Ga0157375_10389373 3300013308 Bacteria 1561
110 Ga0163163_10000926 3300014325 Bacteria 24867
111 Ga0163163_10437431 3300014325 Bacteria 1367
112 Ga0182008_10008526 3300014497 Bacteria 5597
113 Ga0157376_10199507 3300014969 Bacteria 1840
114 Ga0182006_1000866 3300015261 Bacteria 20313
115 Ga0182006_1015267 3300015261 Bacteria 3294
116 Ga0182007_10002091 3300015262 Bacteria 10252
117 Ga0163161_10000066 3300017792 Bacteria 107442
118 Ga0163161_10012897 3300017792 Bacteria 5808
119 Ga0213872_10004350 3300021361 Bacteria 7543
120 Ga0213872_10008761 3300021361 Bacteria 4882
121 Ga0213872_10075372 3300021361 Bacteria 1518
122 Ga0213872_10095713 3300021361 Bacteria 1326
123 Ga0224712_10100038 3300022467 Bacteria 1228
124 Ga0209563_100081 3300025230 Bacteria 199455
125 Ga0209676_1000020 3300025292 Bacteria 617256
126 Ga0209676_1005941 3300025292 Bacteria 6177
127 Ga0209050_1000037 3300025298 Bacteria 415612
128 Ga0209050_1002215 3300025298 Bacteria 17439
129 Ga0209051_1000380 3300025303 Bacteria 63324
130 Ga0209257_1000005 3300025304 Bacteria 1592528
131 Ga0209257_1014591 3300025304 Bacteria 3361
132 Ga0207656_10011560 3300025321 Bacteria 3339
133 Ga0207655_1008877 3300025728 Bacteria 6317
134 Ga0207713_1001199 3300025735 Bacteria 21761
135 Ga0207710_10005804 3300025900 Bacteria 5298
136 Ga0207680_10039788 3300025903 Bacteria 2731
137 Ga0207680_10151269 3300025903 Bacteria 1547
138 Ga0207647_10005480 3300025904 Bacteria 9289
139 Ga0207705_10038096 3300025909 Bacteria 3441
140 Ga0207684_10019721 3300025910 Bacteria 5767
141 Ga0207684_10134703 3300025910 Bacteria 2121
142 Ga0207707_10367551 3300025912 Bacteria 1238
143 Ga0207695_10000014 3300025913 Bacteria 812599
144 Ga0207695_10028582 3300025913 Bacteria 6177
145 Ga0207695_10098368 3300025913 Bacteria 2925
146 Ga0207695_10170688 3300025913 Bacteria 2100
147 Ga0207695_10242658 3300025913 Bacteria 1702
148 Ga0207671_10015356 3300025914 Bacteria 5999
149 Ga0207671_10060535 3300025914 Bacteria 2809
150 Ga0207693_10312166 3300025915 Bacteria 1231
151 Ga0207652_10150030 3300025921 Bacteria 2087
152 Ga0207652_10225317 3300025921 Bacteria 1689
153 Ga0207652_10487129 3300025921 Bacteria 1110
154 Ga0207694_10002128 3300025924 Bacteria 16295
155 Ga0207694_10003412 3300025924 Bacteria 12649
156 Ga0207694_10007763 3300025924 Bacteria 8124
157 Ga0207694_10007982 3300025924 Bacteria 8003
158 Ga0207650_10000002 3300025925 Bacteria 1439222
159 Ga0207650_10043877 3300025925 Bacteria 3284
160 Ga0207700_10052436 3300025928 Bacteria 3050
161 Ga0207700_10059863 3300025928 Bacteria 2882
162 Ga0207644_10000176 3300025931 Bacteria 45641
163 Ga0207690_10072188 3300025932 Bacteria 2383
164 Ga0207706_10178706 3300025933 Bacteria 1864
165 Ga0207665_10111302 3300025939 Bacteria 1924
166 Ga0207711_10000366 3300025941 Bacteria 47938
167 Ga0207667_10107695 3300025949 Bacteria 2875
168 Ga0207667_10117154 3300025949 Bacteria 2745
169 Ga0207712_10003217 3300025961 Bacteria 10379
170 Ga0207640_10027516 3300025981 Bacteria 3466
171 Ga0207658_10000001 3300025986 Bacteria 1439333
172 Ga0207658_10005884 3300025986 Bacteria 8386
173 Ga0207658_10008847 3300025986 Bacteria 6832
174 Ga0207703_10006849 3300026035 Bacteria 9077
175 Ga0207639_10053310 3300026041 Bacteria 3086
176 Ga0207678_10003270 3300026067 Bacteria 14620
177 Ga0207702_10039872 3300026078 Bacteria 3937
178 Ga0207702_10148738 3300026078 Bacteria 2128
179 Ga0207641_10005339 3300026088 Bacteria 10977
180 Ga0207648_10285093 3300026089 Bacteria 1478
181 Ga0207676_10000001 3300026095 Bacteria 1439222
182 Ga0207674_10038560 3300026116 Bacteria 4956
183 Ga0209281_1001783 3300027111 Bacteria 10856
184 Ga0209371_1000929 3300027312 Bacteria 22972
185 Ga0207428_10026462 3300027907 Bacteria 4843
186 Ga0207428_10031821 3300027907 Bacteria 4346
187 Ga0268266_10000001 3300028379 Bacteria 4040580
188 Ga0268266_10000019 3300028379 Bacteria 556465
189 Ga0268266_10002914 3300028379 Bacteria 17699
190 Ga0268266_10004174 3300028379 Bacteria 13931
191 Ga0268266_10023213 3300028379 Bacteria 5282
192 Ga0268265_10008376 3300028380 Bacteria 6981
193 Ga0268265_10089273 3300028380 Bacteria 2458
194 Ga0268264_10000004 3300028381 Bacteria 1116842
195 Ga0268264_10246947 3300028381 Bacteria 1656
196 Ga0307515_10000016 3300028794 Bacteria 554870
197 Ga0265338_10011307 3300028800 Bacteria 10330
198 Ga0268256_1000782 3300030500 Bacteria 22972
199 Ga0316178_1094315 3300030735 Bacteria 3416
200 Ga0265340_10028829 3300031247 Bacteria 2790
201 Ga0307513_10029615 3300031456 Bacteria 6236
202 Ga0307509_10016260 3300031507 Bacteria 8618
203 Ga0307509_10035922 3300031507 Bacteria 5433
204 Ga0307408_100004852 3300031548 Bacteria 9058
205 Ga0307408_100006406 3300031548 Bacteria 7809
206 Ga0307408_100140781 3300031548 Bacteria 1893
207 Ga0307408_100173637 3300031548 Bacteria 1722
208 Ga0307516_10011068 3300031730 Bacteria 9851
209 Ga0307405_10012193 3300031731 Bacteria 4538
210 Ga0307405_10012466 3300031731 Bacteria 4502
211 Ga0307405_10019563 3300031731 Bacteria 3764
212 Ga0307405_10085820 3300031731 Bacteria 2070
213 Ga0307413_10013731 3300031824 Bacteria 4086
214 Ga0307413_10109375 3300031824 Bacteria 1847
215 Ga0307410_10011618 3300031852 Bacteria 5045
216 Ga0307410_10045378 3300031852 Bacteria 2926
217 Ga0307406_10001512 3300031901 Bacteria 12828
218 Ga0307406_10309899 3300031901 Bacteria 1216
219 Ga0307407_10007910 3300031903 Bacteria 4846
220 Ga0307407_10045144 3300031903 Bacteria 2488
221 Ga0307407_10048872 3300031903 Bacteria 2411
222 Ga0307412_10001066 3300031911 Bacteria 15684
223 Ga0307412_10001611 3300031911 Bacteria 12441
224 Ga0307412_10008226 3300031911 Bacteria 5945
225 Ga0307412_10016569 3300031911 Bacteria 4394
226 Ga0307412_10029367 3300031911 Bacteria 3450
227 Ga0307412_10037285 3300031911 Bacteria 3122
228 Ga0307409_100005311 3300031995 Bacteria 7396
229 Ga0307409_100053968 3300031995 Bacteria 3092
230 Ga0307409_100073065 3300031995 Bacteria 2734
231 Ga0307416_100097508 3300032002 Bacteria 2546
232 Ga0307416_100149830 3300032002 Bacteria 2137
233 Ga0307414_10007004 3300032004 Bacteria 6318
234 Ga0307414_10012649 3300032004 Bacteria 5000
235 Ga0307414_10053416 3300032004 Bacteria 2817
236 Ga0307414_10091649 3300032004 Bacteria 2259
237 Ga0307414_10290895 3300032004 Bacteria 1377
238 Ga0307411_10013774 3300032005 Bacteria 4477
239 Ga0307411_10020515 3300032005 Bacteria 3845
240 Ga0307411_10056382 3300032005 Bacteria 2590
241 Ga0307411_10067595 3300032005 Bacteria 2405
242 Ga0307411_10092844 3300032005 Bacteria 2111
243 Ga0307411_10157846 3300032005 Bacteria 1694
244 Ga0307411_10178706 3300032005 Bacteria 1608
245 Ga0307411_10291359 3300032005 Bacteria 1304
246 Ga0307415_100032773 3300032126 Bacteria 3365
247 Ga0307510_10000324 3300033180 Bacteria 44451
248 Ga0373954_0007899 3300035118 Bacteria 4660
249 Ga0373956_0000380 3300035119 Bacteria 18162
250 Ga0373927_0000025 3300035695 Bacteria 118042
251 Ga0395900_0050014 3300037418 Bacteria 4306
252 Ga0436365_1678853 3300039437 Bacteria 2751
253 Ga0436361_0112287 3300039447 Bacteria 22106
254 Ga0436361_0274973 3300039447 Bacteria 3666
255 Ga0436361_0377146 3300039447 Bacteria 2226
256 Ga0436361_0409483 3300039447 Bacteria 2633
257 Ga0436361_0409788 3300039447 Bacteria 4097
258 Ga0436361_1196017 3300039447 Bacteria 2130
259 Ga0439438_000039 3300041405 Bacteria 66110
260 Ga0439438_000379 3300041405 Bacteria 19968
261 Ga0439438_001196 3300041405 Bacteria 11531
262 Ga0439438_001599 3300041405 Bacteria 9946
263 Ga0439438_001845 3300041405 Bacteria 9275
264 Ga0439438_003426 3300041405 Bacteria 6412
265 Ga0439447_000475 3300041407 Bacteria 14959
266 Ga0439447_000519 3300041407 Bacteria 14291
267 Ga0439447_001031 3300041407 Bacteria 10122
268 Ga0439447_002865 3300041407 Bacteria 6185
269 Ga0439447_012694 3300041407 Bacteria 2412
270 Ga0439466_0000127 3300041411 Bacteria 29566
271 Ga0439466_0007364 3300041411 Bacteria 4168
272 Ga0439466_0008636 3300041411 Bacteria 3839
273 Ga0439465_0016836 3300041413 Bacteria 2281
274 Ga0451853_3253391 3300041512 Bacteria 1032
275 Ga0439431_0001988 3300041997 Bacteria 4534
276 Ga0439432_000233 3300042006 Bacteria 20049
277 Ga0439432_017912 3300042006 Bacteria 2373
278 Ga0439452_000081 3300042010 Bacteria 82231
279 Ga0439452_000250 3300042010 Bacteria 36960
280 Ga0439452_000684 3300042010 Bacteria 16690
281 Ga0439452_003373 3300042010 Bacteria 5608
282 Ga0439452_004311 3300042010 Bacteria 4799
283 Ga0439456_000527 3300042013 Bacteria 8137
284 Ga0439463_003192 3300042016 Bacteria 4159
285 Ga0450911_000010 3300042115 Bacteria 149605
286 Ga0450919_003157 3300042121 Bacteria 2092
287 Ga0450903_014865 3300042138 Bacteria 1229
288 Ga0450904_001143 3300042139 Bacteria 4045
289 Ga0450906_000050 3300042145 Bacteria 19133
290 Ga0450907_000001 3300042146 Bacteria 236562
291 Ga0450907_000365 3300042146 Bacteria 13879
292 Ga0450910_001903 3300042147 Bacteria 2698
293 Ga0439446_0009690 3300042156 Bacteria 2583
294 Ga0439446_0017814 3300042156 Bacteria 1986
295 Ga0450908_001083 3300042184 Bacteria 5280
296 Ga0439434_0000001 3300042435 Bacteria 86314
297 Ga0439434_0026766 3300042435 Bacteria 1742
298 Ga0439464_0005488 3300042439 Bacteria 3281
299 Ga0439460_0000239 3300042461 Bacteria 11172
300 Ga0450918_009972 3300042531 Bacteria 1660
301 Ga0451577_0023438 3300042876 Bacteria 5630
302 Ga0451577_0280901 3300042876 Bacteria 1508
303 Ga0451577_0359032 3300042876 Bacteria 1322
304 Ga0439440_0000156 3300042993 Bacteria 10106
305 Ga0466969_0000718 3300044656 Bacteria 17955
306 Ga0466969_0009636 3300044656 Bacteria 5120
307 Ga0453683_0038352 3300044673 Bacteria 3012
308 Ga0466966_0001140 3300044684 Bacteria 17084
309 Ga0466964_0011745 3300044706 Unclassified 3312
310 Ga0453684_0210277 3300044712 Bacteria 2262
311 Ga0466968_0000582 3300044735 Bacteria 12441
312 Ga0466970_0000527 3300044765 Bacteria 18760
313 Ga0451576_0048017 3300045051 Bacteria 4486
314 Ga0451576_0057093 3300045051 Bacteria 4080
315 Ga0466958_0000962 3300045836 Bacteria 13039
316 Ga0495617_009853 3300046452 Bacteria 3276
317 Ga0495617_018189 3300046452 Bacteria 2377
318 Ga0495627_000087 3300046453 Bacteria 110870
319 Ga0495627_000101 3300046453 Bacteria 105414
320 Ga0495627_008555 3300046453 Bacteria 3825
321 Ga0495591_000199 3300046458 Bacteria 61532
322 Ga0495591_000300 3300046458 Bacteria 45180
323 Ga0495591_003292 3300046458 Bacteria 8453
324 Ga0495591_005534 3300046458 Bacteria 5817
325 Ga0495638_0000048 3300046460 Bacteria 209787
326 Ga0495638_0000117 3300046460 Bacteria 127788
327 Ga0495650_0014388 3300046471 Bacteria 4120
328 Ga0495605_0023553 3300046474 Bacteria 3235
329 Ga0495584_0000739 3300046491 Bacteria 21572
330 Ga0495584_0013459 3300046491 Bacteria 4177
331 Ga0495585_0000185 3300046492 Bacteria 66442
332 Ga0495585_0032212 3300046492 Bacteria 2970
333 Ga0495607_0000517 3300046501 Bacteria 38004
334 Ga0495607_0014971 3300046501 Bacteria 5041
335 Ga0495607_0044492 3300046501 Bacteria 2618
336 Ga0495583_0005886 3300046506 Bacteria 8166
337 Ga0495583_0015656 3300046506 Bacteria 4111
338 Ga0495606_0000729 3300046507 Bacteria 50871
339 Ga0495606_0012470 3300046507 Bacteria 6810
340 Ga0495610_0005706 3300046512 Bacteria 8771
341 Ga0495616_0000454 3300046513 Bacteria 31292
342 Ga0495616_0019269 3300046513 Bacteria 3725
343 Ga0495620_0000257 3300046515 Bacteria 39311
344 Ga0495631_0005114 3300046518 Bacteria 6912
345 Ga0495631_0025683 3300046518 Bacteria 2709
346 Ga0495631_0029840 3300046518 Bacteria 2477
347 Ga0495632_0000097 3300046519 Bacteria 88746
348 Ga0495632_0008700 3300046519 Bacteria 6193
349 Ga0495632_0037832 3300046519 Bacteria 2445
350 Ga0495632_0069066 3300046519 Bacteria 1702
351 Ga0495632_0079751 3300046519 Bacteria 1562
352 Ga0495637_0001309 3300046520 Bacteria 14938
353 Ga0495637_0062129 3300046520 Bacteria 1529
354 Ga0495643_0000625 3300046522 Bacteria 42011
355 Ga0495644_0005578 3300046523 Bacteria 4909
356 Ga0495644_0051499 3300046523 Bacteria 1546
357 Ga0495648_0000172 3300046524 Bacteria 74485
358 Ga0495648_0000668 3300046524 Bacteria 36642
359 Ga0495648_0061494 3300046524 Bacteria 2230
360 Ga0495654_0001012 3300046530 Bacteria 20571
361 Ga0495654_0023484 3300046530 Bacteria 3193
362 Ga0495609_0000504 3300046538 Bacteria 31406
363 Ga0495609_0000982 3300046538 Bacteria 20389
364 Ga0495609_0067375 3300046538 Bacteria 1576
365 Ga0495597_0027264 3300046542 Bacteria 2620
366 Ga0495633_0047583 3300046558 Bacteria 2027
367 Ga0495668_0000024 3300046616 Bacteria 359469
368 Ga0495668_0044583 3300046616 Bacteria 2465
369 Ga0495611_0000024 3300046648 Bacteria 118898
370 Ga0495611_0002419 3300046648 Bacteria 8557
371 Ga0495611_0006686 3300046648 Bacteria 4906
372 Ga0495625_0000031 3300046660 Bacteria 238193
373 Ga0495625_0000861 3300046660 Bacteria 41279
374 Ga0495625_0075252 3300046660 Bacteria 2362
375 Ga0495659_0000641 3300046664 Bacteria 12731
376 Ga0495661_0000138 3300046665 Bacteria 85693
377 Ga0495661_0008477 3300046665 Bacteria 7106
378 Ga0495661_0016477 3300046665 Bacteria 4897
379 Ga0495661_0020395 3300046665 Bacteria 4327
380 Ga0495661_0032909 3300046665 Bacteria 3274
381 Ga0495647_0001756 3300046681 Bacteria 6720
382 Ga0495658_0274774 3300046683 Bacteria 1062
383 Ga0495670_0000020 3300046691 Bacteria 110171
384 Ga0495670_0000112 3300046691 Bacteria 36057
385 Ga0495671_0000273 3300046692 Bacteria 43292
386 Ga0495671_0000503 3300046692 Bacteria 30077
387 Ga0495671_0001542 3300046692 Bacteria 15358
388 Ga0495671_0006195 3300046692 Bacteria 6941
389 Ga0495671_0008699 3300046692 Bacteria 5701
390 Ga0495671_0037759 3300046692 Bacteria 2441
391 Ga0495649_0004543 3300046694 Bacteria 9052
392 Ga0495649_0031575 3300046694 Bacteria 2920
393 Ga0495589_0000477 3300046794 Bacteria 28860
394 Ga0495660_0004243 3300046810 Bacteria 8700
395 Ga0495660_0029491 3300046810 Bacteria 3094
396 Ga0495672_0002027 3300047320 Bacteria 19104
397 Ga0495672_0007290 3300047320 Bacteria 8341
398 Ga0495672_0014217 3300047320 Bacteria 5460
399 Ga0495687_000041 3300047443 Bacteria 229171
400 Ga0495673_0004428 3300047469 Bacteria 8792
401 Ga0495673_0005784 3300047469 Bacteria 7405
402 Ga0495673_0065922 3300047469 Bacteria 1537
403 Ga0495681_0000029 3300047470 Bacteria 134816
404 Ga0495681_0001171 3300047470 Bacteria 19926
405 Ga0495681_0005497 3300047470 Bacteria 8472
406 Ga0495686_0002983 3300047472 Bacteria 15069
407 Ga0495686_0008113 3300047472 Bacteria 7765
408 Ga0495686_0134086 3300047472 Bacteria 1466
409 Ga0495626_0006462 3300048091 Bacteria 6670
410 Ga0495626_0006994 3300048091 Bacteria 6344
411 Ga0496104_0022417 3300048907 Bacteria 5802
412 Ga0496110_0120403 3300048913 Bacteria 2364
413 Ga0496110_0217687 3300048913 Bacteria 1737
414 Ga0496117_0042697 3300048920 Bacteria 3306
415 Ga0496118_0000177 3300048921 Bacteria 114183
416 Ga0496118_0008563 3300048921 Bacteria 10538
417 Ga0496122_0000725 3300048925 Bacteria 64489
418 Ga0496122_0004406 3300048925 Bacteria 17523
419 Ga0496123_0001443 3300048926 Bacteria 33137
420 Ga0496123_0023465 3300048926 Bacteria 4720
421 Ga0496124_0142790 3300048927 Bacteria 1887
422 Ga0496124_0252345 3300048927 Bacteria 1304
423 Ga0496126_0000033 3300048929 Bacteria 368851
424 Ga0495678_001245 3300049459 Bacteria 20717
425 Ga0495678_004383 3300049459 Bacteria 8189
426 Ga0495678_005203 3300049459 Bacteria 7271
427 Ga0495678_032996 3300049459 Bacteria 2141
428 Ga0495682_0003820 3300049460 Bacteria 6617
429 Ga0501335_004705 3300049551 Bacteria 1202
430 Ga0501031_0002801 3300049568 Bacteria 11125
431 Ga0501032_0022864 3300049569 Bacteria 4329
432 Ga0501032_0034989 3300049569 Bacteria 3435
433 Ga0501033_0253906 3300049570 Bacteria 1245
434 Ga0501034_0030621 3300049571 Bacteria 5469
435 Ga0501037_0006783 3300049573 Bacteria 8370
436 Ga0501037_0013126 3300049573 Bacteria 6108
437 Ga0501038_0024541 3300049574 Bacteria 5378
438 Ga0501038_0072739 3300049574 Bacteria 2913
439 Ga0501039_0021805 3300049575 Bacteria 4914
440 Ga0501042_0046663 3300049578 Bacteria 3088
441 Ga0501043_0016922 3300049579 Bacteria 5714
442 Ga0501046_0005823 3300049580 Bacteria 10993
443 Ga0501046_0018614 3300049580 Bacteria 5773
444 Ga0501047_0003068 3300049581 Bacteria 15839
445 Ga0501047_0090819 3300049581 Bacteria 2931
446 Ga0501047_0147472 3300049581 Bacteria 2229
447 Ga0501047_0261669 3300049581 Bacteria 1577
448 Ga0501048_0027025 3300049582 Bacteria 4173
449 Ga0501067_0073824 3300049583 Bacteria 1889
450 Ga0501068_0106349 3300049584 Bacteria 1742
451 Ga0501070_0028683 3300049586 Bacteria 4666
452 Ga0501070_0151247 3300049586 Bacteria 1915
453 Ga0501073_0046641 3300049589 Bacteria 3046
454 Ga0501073_0143864 3300049589 Bacteria 1652
455 Ga0501074_0110310 3300049590 Bacteria 1968
456 Ga0501211_000203 3300049658 Bacteria 5083
457 Ga0501223_026011 3300049663 Bacteria 1139
458 Ga0501238_000036 3300049671 Bacteria 23260
459 Ga0501242_007344 3300049674 Bacteria 1270
460 Ga0501252_000895 3300049682 Bacteria 2554
461 Ga0501253_009362 3300049683 Bacteria 1442
462 Ga0501257_004973 3300049686 Bacteria 2915
463 Ga0501259_001750 3300049688 Bacteria 3597
464 Ga0501079_0023183 3300049741 Bacteria 4765
465 Ga0501083_0004690 3300049744 Bacteria 9657
466 Ga0501083_0065656 3300049744 Bacteria 2417
467 Ga0501241_004060 3300049758 Bacteria 2753
468 Ga0501035_0159639 3300049822 Bacteria 1952
469 Ga0501044_0021077 3300049823 Bacteria 6958
470 Ga0501044_0054213 3300049823 Bacteria 4122
471 Ga0501044_0071990 3300049823 Bacteria 3515
472 Ga0501044_0124058 3300049823 Bacteria 2581
473 Ga0501044_0262483 3300049823 Bacteria 1665
474 Ga0501044_0262807 3300049823 Bacteria 1664
475 Ga0501045_0098612 3300049824 Bacteria 2162
476 nmdc:mga05p37_308100_c1 3300050507 Bacteria 1878
477 nmdc:mga05p37_9912_c1 3300050507 Bacteria 11308
478 nmdc:mga08y16_12543_c1 3300050511 Bacteria 8918
479 nmdc:mga08y16_136861_c1 3300050511 Unclassified 2546
480 nmdc:mga0n895_39499_c1 3300050512 Bacteria 4579
481 nmdc:mga0n895_42311_c1 3300050512 Bacteria 4432
482 nmdc:mga0rr50_46484_c1 3300050513 Bacteria 3196
483 nmdc:mga0a205_39118_c1 3300050515 Bacteria 4564
484 Ga0495601_0062011 3300053077 Bacteria 2374
485 Ga0500643_002270 3300053087 Bacteria 10086
486 Ga0500583_0029264 3300053092 Bacteria 2399
487 Ga0500595_001265 3300053119 Bacteria 13897
488 Ga0500597_000186 3300053120 Bacteria 12755
489 Ga0500597_005241 3300053120 Bacteria 4151
490 Ga0500658_0000285 3300053134 Bacteria 22927
491 Ga0500568_0007831 3300053139 Bacteria 5205
492 Ga0500588_0000387 3300053146 Bacteria 6850
493 Ga0500616_0034755 3300053153 Bacteria 2744
494 Ga0500622_0000013 3300053156 Bacteria 371650
495 Ga0500624_000004 3300053157 Bacteria 196921
496 Ga0500637_0000006 3300053178 Bacteria 99157
497 Ga0500637_0020239 3300053178 Bacteria 3601
498 Ga0500625_000005 3300053729 Bacteria 209509
499 Ga0500645_018485 3300053730 Bacteria 2177
500 Ga0500609_000927 3300053731 Bacteria 4396
501 Ga0501084_0063654 3300054114 Bacteria 3088
502 Ga0501084_0126173 3300054114 Bacteria 2153
503 Ga0501082_0001156 3300060353 Bacteria 23260
504 Ga0501082_0109554 3300060353 Bacteria 2390

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10009626 Ga0070709_100096264 312
2 3300005440 Ga0070705_100003644 Ga0070705_1000036445 312
3 3300005536 Ga0070697_100009299 Ga0070697_1000092994 312
4 3300041512 Ga0451853_3253391 Ga0451853_3253391_50_994 314
5 3300044656 Ga0466969_0009636 Ga0466969_0009636_1314_2261 314
6 3300042876 Ga0451577_0280901 Ga0451577_0280901_541_1494 317
7 3300053087 Ga0500643_002270 Ga0500643_002270_9077_10042 320
8 3300046683 Ga0495658_0274774 Ga0495658_0274774_47_1021 324
9 3300053731 Ga0500609_000927 Ga0500609_000927_11_988 324
10 3300009093 Ga0105240_10591627 Ga0105240_105916271 327
11 3300009551 Ga0105238_10008966 Ga0105238_100089663 327
12 3300025924 Ga0207694_10007763 Ga0207694_100077632 327
13 3300049574 Ga0501038_0072739 Ga0501038_0072739_476_1474 331
14 3300005331 Ga0070670_100000001 Ga0070670_100000001246 333
15 3300005335 Ga0070666_10003916 Ga0070666_100039164 333
16 3300005353 Ga0070669_100001723 Ga0070669_10000172317 333
17 3300005355 Ga0070671_100000033 Ga0070671_10000003324 333
18 3300005365 Ga0070688_100000741 Ga0070688_1000007416 333
19 3300005367 Ga0070667_100000405 Ga0070667_10000040514 333
20 3300005466 Ga0070685_10000008 Ga0070685_10000008117 333
21 3300005618 Ga0068864_100000006 Ga0068864_100000006251 333
22 3300005842 Ga0068858_100058058 Ga0068858_1000580582 333
23 3300005843 Ga0068860_100000259 Ga0068860_1000002595 333
24 3300009101 Ga0105247_10013121 Ga0105247_100131212 333
25 3300009177 Ga0105248_10053484 Ga0105248_100534842 333
26 3300009553 Ga0105249_10056764 Ga0105249_100567642 333
27 3300014325 Ga0163163_10000926 Ga0163163_1000092613 333
28 3300025900 Ga0207710_10005804 Ga0207710_100058043 333
29 3300025903 Ga0207680_10151269 Ga0207680_101512691 333
30 3300025925 Ga0207650_10000002 Ga0207650_10000002924 333
31 3300025931 Ga0207644_10000176 Ga0207644_1000017635 333
32 3300025941 Ga0207711_10000366 Ga0207711_1000036631 333
33 3300025986 Ga0207658_10000001 Ga0207658_10000001430 333
34 3300026088 Ga0207641_10005339 Ga0207641_1000533910 333
35 3300026095 Ga0207676_10000001 Ga0207676_10000001924 333
36 3300028379 Ga0268266_10002914 Ga0268266_100029149 333
37 3300028380 Ga0268265_10008376 Ga0268265_100083764 333
38 3300028381 Ga0268264_10000004 Ga0268264_10000004945 333
39 3300048927 Ga0496124_0142790 Ga0496124_0142790_713_1762 333
40 3300025928 Ga0207700_10052436 Ga0207700_100524362 335
41 3300025915 Ga0207693_10312166 Ga0207693_103121662 336
42 3300046501 Ga0495607_0044492 Ga0495607_0044492_509_1528 336
43 3300047472 Ga0495686_0134086 Ga0495686_0134086_61_1080 336
44 3300049663 Ga0501223_026011 Ga0501223_026011_15_1025 336
45 3300053120 Ga0500597_005241 Ga0500597_005241_2345_3397 339
46 3300053157 Ga0500624_000004 Ga0500624_000004_109592_110644 339
47 3300053178 Ga0500637_0000006 Ga0500637_0000006_15299_16351 339
48 3300005530 Ga0070679_100185139 Ga0070679_1001851392 340
49 3300025921 Ga0207652_10225317 Ga0207652_102253172 340
50 3300046616 Ga0495668_0000024 Ga0495668_0000024_350082_351104 340
51 3300053729 Ga0500625_000005 Ga0500625_000005_24537_25589 340
52 3300053092 Ga0500583_0029264 Ga0500583_0029264_763_1806 342
53 3300031730 Ga0307516_10011068 Ga0307516_100110686 343
54 iso_pu_bacteria 2848297114 2848297722 343
55 iso_pu_bacteria 8054302542 8054304513 344
56 iso_pu_bacteria 2928027323 2928028656 345
57 3300006844 Ga0075428_100085428 Ga0075428_1000854282 346
58 3300009094 Ga0111539_10000310 Ga0111539_100003105 346
59 3300031824 Ga0307413_10013731 Ga0307413_100137313 346
60 3300031911 Ga0307412_10029367 Ga0307412_100293673 346
61 3300032005 Ga0307411_10056382 Ga0307411_100563822 346
62 3300053077 Ga0495601_0062011 Ga0495601_0062011_24_1064 346
63 iso_pu_bacteria 2643221541 2643731109 346
64 iso_pu_bacteria 2643221606 2644045385 346
65 iso_pu_bacteria 2643221671 2644391838 346
66 iso_pu_bacteria 2739367664 2739649532 346
67 iso_pu_bacteria 2739367865 2740028005 346
68 3300005530 Ga0070679_100173451 Ga0070679_1001734511 347
69 3300005548 Ga0070665_100000024 Ga0070665_10000002416 347
70 3300005563 Ga0068855_100013165 Ga0068855_1000131656 347
71 3300005985 Ga0081539_10026589 Ga0081539_100265893 347
72 3300006844 Ga0075428_100000418 Ga0075428_10000041813 347
73 3300009093 Ga0105240_10067898 Ga0105240_100678982 347
74 3300010375 Ga0105239_10189052 Ga0105239_101890522 347
75 3300017792 Ga0163161_10012897 Ga0163161_100128972 347
76 3300021361 Ga0213872_10004350 Ga0213872_100043505 347
77 3300021361 Ga0213872_10008761 Ga0213872_100087615 347
78 3300021361 Ga0213872_10075372 Ga0213872_100753722 347
79 3300021361 Ga0213872_10095713 Ga0213872_100957132 347
80 3300025912 Ga0207707_10367551 Ga0207707_103675511 347
81 3300025921 Ga0207652_10150030 Ga0207652_101500301 347
82 3300025932 Ga0207690_10072188 Ga0207690_100721883 347
83 3300027907 Ga0207428_10031821 Ga0207428_100318212 347
84 3300028379 Ga0268266_10000019 Ga0268266_10000019346 347
85 3300031247 Ga0265340_10028829 Ga0265340_100288292 347
86 3300031731 Ga0307405_10012193 Ga0307405_100121933 347
87 3300031824 Ga0307413_10109375 Ga0307413_101093752 347
88 3300031852 Ga0307410_10011618 Ga0307410_100116184 347
89 3300031852 Ga0307410_10045378 Ga0307410_100453782 347
90 3300031903 Ga0307407_10048872 Ga0307407_100488722 347
91 3300031911 Ga0307412_10016569 Ga0307412_100165694 347
92 3300031995 Ga0307409_100053968 Ga0307409_1000539683 347
93 3300031995 Ga0307409_100073065 Ga0307409_1000730653 347
94 3300032002 Ga0307416_100097508 Ga0307416_1000975082 347
95 3300032004 Ga0307414_10012649 Ga0307414_100126494 347
96 3300032004 Ga0307414_10053416 Ga0307414_100534163 347
97 3300032005 Ga0307411_10013774 Ga0307411_100137741 347
98 3300032005 Ga0307411_10020515 Ga0307411_100205153 347
99 3300032005 Ga0307411_10291359 Ga0307411_102913591 347
100 3300032126 Ga0307415_100032773 Ga0307415_1000327733 347
101 3300039447 Ga0436361_0112287 Ga0436361_0112287_4833_5879 347
102 3300039447 Ga0436361_0274973 Ga0436361_0274973_1149_2198 347
103 3300039447 Ga0436361_0377146 Ga0436361_0377146_807_1853 347
104 3300039447 Ga0436361_0409483 Ga0436361_0409483_811_1860 347
105 3300039447 Ga0436361_0409788 Ga0436361_0409788_914_1963 347
106 3300039447 Ga0436361_1196017 Ga0436361_1196017_485_1531 347
107 3300045051 Ga0451576_0048017 Ga0451576_0048017_1611_2657 347
108 3300045836 Ga0466958_0000962 Ga0466958_0000962_5594_6640 347
109 3300046460 Ga0495638_0000048 Ga0495638_0000048_57673_58722 347
110 3300046491 Ga0495584_0013459 Ga0495584_0013459_1431_2483 347
111 3300046506 Ga0495583_0005886 Ga0495583_0005886_2053_3105 347
112 3300046512 Ga0495610_0005706 Ga0495610_0005706_2658_3710 347
113 3300046519 Ga0495632_0079751 Ga0495632_0079751_270_1322 347
114 3300046523 Ga0495644_0051499 Ga0495644_0051499_230_1273 347
115 3300046538 Ga0495609_0000982 Ga0495609_0000982_14583_15635 347
116 3300046542 Ga0495597_0027264 Ga0495597_0027264_1343_2395 347
117 3300046616 Ga0495668_0044583 Ga0495668_0044583_1157_2209 347
118 3300046660 Ga0495625_0000031 Ga0495625_0000031_173640_174692 347
119 3300046660 Ga0495625_0075252 Ga0495625_0075252_178_1230 347
120 3300046681 Ga0495647_0001756 Ga0495647_0001756_5255_6298 347
121 3300046692 Ga0495671_0000273 Ga0495671_0000273_32505_33557 347
122 3300047470 Ga0495681_0000029 Ga0495681_0000029_12952_14004 347
123 3300049459 Ga0495678_005203 Ga0495678_005203_4250_5302 347
124 3300049568 Ga0501031_0002801 Ga0501031_0002801_209_1261 347
125 3300049569 Ga0501032_0022864 Ga0501032_0022864_193_1245 347
126 3300049570 Ga0501033_0253906 Ga0501033_0253906_10_1062 347
127 3300049571 Ga0501034_0030621 Ga0501034_0030621_301_1353 347
128 3300049573 Ga0501037_0006783 Ga0501037_0006783_3702_4754 347
129 3300049574 Ga0501038_0024541 Ga0501038_0024541_4117_5169 347
130 3300049575 Ga0501039_0021805 Ga0501039_0021805_195_1247 347
131 3300049578 Ga0501042_0046663 Ga0501042_0046663_223_1275 347
132 3300049579 Ga0501043_0016922 Ga0501043_0016922_4033_5085 347
133 3300049580 Ga0501046_0005823 Ga0501046_0005823_467_1519 347
134 3300049581 Ga0501047_0147472 Ga0501047_0147472_1069_2121 347
135 3300049581 Ga0501047_0261669 Ga0501047_0261669_315_1367 347
136 3300049582 Ga0501048_0027025 Ga0501048_0027025_226_1278 347
137 3300049583 Ga0501067_0073824 Ga0501067_0073824_53_1105 347
138 3300049584 Ga0501068_0106349 Ga0501068_0106349_290_1342 347
139 3300049586 Ga0501070_0028683 Ga0501070_0028683_530_1582 347
140 3300049589 Ga0501073_0143864 Ga0501073_0143864_390_1442 347
141 3300049590 Ga0501074_0110310 Ga0501074_0110310_122_1174 347
142 3300049741 Ga0501079_0023183 Ga0501079_0023183_10_1062 347
143 3300049744 Ga0501083_0004690 Ga0501083_0004690_214_1266 347
144 3300049822 Ga0501035_0159639 Ga0501035_0159639_271_1323 347
145 3300049823 Ga0501044_0054213 Ga0501044_0054213_114_1166 347
146 3300049823 Ga0501044_0124058 Ga0501044_0124058_92_1144 347
147 3300049823 Ga0501044_0262483 Ga0501044_0262483_114_1166 347
148 3300049824 Ga0501045_0098612 Ga0501045_0098612_341_1393 347
149 3300050511 nmdc:mga08y16_12543_c1 nmdc:mga08y16_12543_c1_3402_4448 347
150 3300053134 Ga0500658_0000285 Ga0500658_0000285_121_1167 347
151 3300053139 Ga0500568_0007831 Ga0500568_0007831_1500_2543 347
152 3300053153 Ga0500616_0034755 Ga0500616_0034755_613_1665 347
153 3300054114 Ga0501084_0126173 Ga0501084_0126173_888_1940 347
154 3300060353 Ga0501082_0109554 Ga0501082_0109554_881_1933 347
155 iso_pu_bacteria 2984555340 2984555543 347
156 iso_pu_bacteria 2984564862 2984566344 347
157 iso_pu_bacteria 2993356040 2993357359 347
158 iso_pu_bacteria 3007252601 3007253978 347
159 3300005336 Ga0070680_100248341 Ga0070680_1002483412 348
160 3300005436 Ga0070713_100096506 Ga0070713_1000965062 348
161 3300005445 Ga0070708_100109393 Ga0070708_1001093932 348
162 3300005458 Ga0070681_10064321 Ga0070681_100643212 348
163 3300005467 Ga0070706_100022846 Ga0070706_1000228463 348
164 3300005467 Ga0070706_100142872 Ga0070706_1001428721 348
165 3300005468 Ga0070707_100269541 Ga0070707_1002695411 348
166 3300005530 Ga0070679_100340213 Ga0070679_1003402131 348
167 3300005563 Ga0068855_100059932 Ga0068855_1000599322 348
168 3300005577 Ga0068857_100064501 Ga0068857_1000645013 348
169 3300005843 Ga0068860_100283076 Ga0068860_1002830762 348
170 3300006028 Ga0070717_10100861 Ga0070717_101008613 348
171 3300009093 Ga0105240_10004139 Ga0105240_1000413914 348
172 3300009147 Ga0114129_10157919 Ga0114129_101579193 348
173 3300015261 Ga0182006_1015267 Ga0182006_10152672 348
174 3300022467 Ga0224712_10100038 Ga0224712_101000381 348
175 3300025909 Ga0207705_10038096 Ga0207705_100380963 348
176 3300025910 Ga0207684_10019721 Ga0207684_100197212 348
177 3300025910 Ga0207684_10134703 Ga0207684_101347032 348
178 3300025913 Ga0207695_10028582 Ga0207695_100285823 348
179 3300025914 Ga0207671_10060535 Ga0207671_100605352 348
180 3300025921 Ga0207652_10487129 Ga0207652_104871291 348
181 3300025928 Ga0207700_10059863 Ga0207700_100598632 348
182 3300025949 Ga0207667_10107695 Ga0207667_101076952 348
183 3300026116 Ga0207674_10038560 Ga0207674_100385603 348
184 3300027312 Ga0209371_1000929 Ga0209371_100092917 348
185 3300028381 Ga0268264_10246947 Ga0268264_102469472 348
186 3300028800 Ga0265338_10011307 Ga0265338_100113077 348
187 3300030500 Ga0268256_1000782 Ga0268256_100078217 348
188 3300035118 Ga0373954_0007899 Ga0373954_0007899_441_1571 348
189 3300035119 Ga0373956_0000380 Ga0373956_0000380_6762_7892 348
190 3300035695 Ga0373927_0000025 Ga0373927_0000025_54877_55944 348
191 3300042439 Ga0439464_0005488 Ga0439464_0005488_322_1389 348
192 3300042876 Ga0451577_0359032 Ga0451577_0359032_118_1167 348
193 3300044656 Ga0466969_0000718 Ga0466969_0000718_12615_13667 348
194 3300044684 Ga0466966_0001140 Ga0466966_0001140_3384_4436 348
195 3300044706 Ga0466964_0011745 Ga0466964_0011745_1510_2562 348
196 3300044712 Ga0453684_0210277 Ga0453684_0210277_39_1088 348
197 3300044735 Ga0466968_0000582 Ga0466968_0000582_8090_9142 348
198 3300044765 Ga0466970_0000527 Ga0466970_0000527_726_1778 348
199 3300046458 Ga0495591_000300 Ga0495591_000300_37198_38268 348
200 3300046507 Ga0495606_0000729 Ga0495606_0000729_6624_7694 348
201 3300046519 Ga0495632_0008700 Ga0495632_0008700_4120_5190 348
202 3300046665 Ga0495661_0000138 Ga0495661_0000138_77560_78630 348
203 3300048907 Ga0496104_0022417 Ga0496104_0022417_4508_5596 348
204 3300049573 Ga0501037_0013126 Ga0501037_0013126_3560_4609 348
205 3300049586 Ga0501070_0151247 Ga0501070_0151247_747_1796 348
206 3300049823 Ga0501044_0021077 Ga0501044_0021077_5816_6865 348
207 3300053178 Ga0500637_0020239 Ga0500637_0020239_915_1991 348
208 iso_pu_bacteria 2511231031 2511414489 348
209 iso_pu_bacteria 2511231156 2511824198 348
210 iso_pu_bacteria 2599185248 2599769936 348
211 iso_pu_bacteria 2599185289 2599887260 348
212 iso_pu_bacteria 2599185291 2599898575 348
213 iso_pu_bacteria 2599185302 2599942652 348
214 iso_pu_bacteria 2599185304 2599953401 348
215 iso_pu_bacteria 2599185305 2599959034 348
216 iso_pu_bacteria 2599185306 2599964306 348
217 iso_pu_bacteria 2599185308 2599975823 348
218 iso_pu_bacteria 2599185309 2599982416 348
219 iso_pu_bacteria 2599185310 2599989199 348
220 iso_pu_bacteria 2599185311 2599994537 348
221 iso_pu_bacteria 2599185312 2599999393 348
222 iso_pu_bacteria 2599185313 2600005985 348
223 iso_pu_bacteria 2599185314 2600009540 348
224 iso_pu_bacteria 2599185315 2600017122 348
225 iso_pu_bacteria 2599185316 2600023490 348
226 iso_pu_bacteria 2599185317 2600029167 348
227 iso_pu_bacteria 2599185319 2600042100 348
228 iso_pu_bacteria 2599185320 2600047097 348
229 iso_pu_bacteria 2599185321 2600051945 348
230 iso_pu_bacteria 2599185323 2600064942 348
231 iso_pu_bacteria 2599185324 2600069824 348
232 iso_pu_bacteria 2599185325 2600077353 348
233 iso_pu_bacteria 2600254930 2600358541 348
234 iso_pu_bacteria 2667528170 2671091067 348
235 iso_pu_bacteria 2667528176 2671124635 348
236 iso_pu_bacteria 2713897148 2715753478 348
237 iso_pu_bacteria 2808606361 2808858542 348
238 iso_pu_bacteria 2808606376 2808925652 348
239 iso_pu_bacteria 2808606378 2808938731 348
240 iso_pu_bacteria 2808606380 2808947664 348
241 iso_pu_bacteria 2808606383 2808967027 348
242 iso_pu_bacteria 2808606389 2809001857 348
243 iso_pu_bacteria 2825651385 2825657122 348
244 iso_pu_bacteria 2842832357 2842835281 348
245 iso_pu_bacteria 2842843487 2842844100 348
246 iso_pu_bacteria 2842854478 2842855094 348
247 iso_pu_bacteria 2913036834 2913040445 348
248 iso_pu_bacteria 2919385768 2919391044 348
249 iso_pu_bacteria 2919487758 2919492197 348
250 iso_pu_bacteria 2923586266 2923587950 348
251 iso_pu_bacteria 2929144301 2929146384 348
252 iso_pu_bacteria 2931369376 2931374638 348
253 iso_pu_bacteria 2969304461 2969307067 348
254 iso_pu_bacteria 2974289157 2974291526 348
255 iso_pu_bacteria 2998139840 2998142251 348
256 iso_pu_bacteria 3007315729 3007317274 348
257 iso_pu_bacteria 3007861166 3007862457 348
258 iso_pu_bacteria 3007866637 3007868567 348
259 iso_pu_bacteria 8029995093 8029998459 348
260 iso_pu_bacteria 8056143049 8056146891 348
261 iso_pu_bacteria 8056166840 8056168821 348
262 3300003759 Ga0055525_1000099 Ga0055525_100009957 349
263 3300025230 Ga0209563_100081 Ga0209563_10008169 349
264 3300047443 Ga0495687_000041 Ga0495687_000041_80158_81255 349
265 3300049551 Ga0501335_004705 Ga0501335_004705_88_1146 349
266 3300049658 Ga0501211_000203 Ga0501211_000203_1854_2912 349
267 3300053730 Ga0500645_018485 Ga0500645_018485_902_1960 349
268 3300003316 rootH1_10003422 rootH1_1000342219 350
269 3300003320 rootH2_10062064 rootH2_100620644 350
270 3300003322 rootL2_10015926 rootL2_100159263 350
271 3300003323 rootH1_10001636 rootH1_100016369 350
272 3300003323 rootH1_10010775 rootH1_100107755 350
273 3300003323 rootH1_10011885 rootH1_100118854 350
274 3300003791 Ga0055530_10000141 Ga0055530_1000014141 350
275 3300003792 Ga0055540_1000171 Ga0055540_100017141 350
276 3300003794 Ga0055531_10000438 Ga0055531_1000043825 350
277 3300005288 Ga0065714_10002454 Ga0065714_1000245423 350
278 3300005338 Ga0068868_100151962 Ga0068868_1001519622 350
279 3300005344 Ga0070661_100242020 Ga0070661_1002420201 350
280 3300005347 Ga0070668_100054348 Ga0070668_1000543482 350
281 3300005367 Ga0070667_100082011 Ga0070667_1000820112 350
282 3300005455 Ga0070663_100014470 Ga0070663_1000144704 350
283 3300005459 Ga0068867_100151545 Ga0068867_1001515452 350
284 3300005466 Ga0070685_10000770 Ga0070685_1000077012 350
285 3300005539 Ga0068853_100040948 Ga0068853_1000409482 350
286 3300005548 Ga0070665_100348785 Ga0070665_1003487851 350
287 3300005563 Ga0068855_100079183 Ga0068855_1000791833 350
288 3300005563 Ga0068855_100559691 Ga0068855_1005596912 350
289 3300005578 Ga0068854_100066540 Ga0068854_1000665402 350
290 3300005614 Ga0068856_100074869 Ga0068856_1000748693 350
291 3300005616 Ga0068852_100063549 Ga0068852_1000635492 350
292 3300005617 Ga0068859_100219214 Ga0068859_1002192142 350
293 3300005834 Ga0068851_10001629 Ga0068851_100016292 350
294 3300005841 Ga0068863_100029887 Ga0068863_1000298875 350
295 3300005841 Ga0068863_100095218 Ga0068863_1000952182 350
296 3300005844 Ga0068862_100079885 Ga0068862_1000798852 350
297 3300005844 Ga0068862_100418351 Ga0068862_1004183511 350
298 3300006058 Ga0075432_10013326 Ga0075432_100133262 350
299 3300006175 Ga0070712_100077561 Ga0070712_1000775612 350
300 3300006353 Ga0075370_10055781 Ga0075370_100557812 350
301 3300006358 Ga0068871_100097303 Ga0068871_1000973032 350
302 3300006844 Ga0075428_100024961 Ga0075428_1000249612 350
303 3300006844 Ga0075428_100043719 Ga0075428_1000437193 350
304 3300006847 Ga0075431_100432402 Ga0075431_1004324021 350
305 3300006852 Ga0075433_10052856 Ga0075433_100528562 350
306 3300006871 Ga0075434_100076780 Ga0075434_1000767803 350
307 3300006931 Ga0097620_100219215 Ga0097620_1002192152 350
308 3300007076 Ga0075435_100078252 Ga0075435_1000782521 350
309 3300009011 Ga0105251_10000001 Ga0105251_10000001361 350
310 3300009093 Ga0105240_10001821 Ga0105240_1000182130 350
311 3300009093 Ga0105240_10043866 Ga0105240_100438662 350
312 3300009093 Ga0105240_10078341 Ga0105240_100783413 350
313 3300009093 Ga0105240_10117107 Ga0105240_101171072 350
314 3300009094 Ga0111539_10024314 Ga0111539_100243146 350
315 3300009147 Ga0114129_10090403 Ga0114129_100904033 350
316 3300009174 Ga0105241_10103134 Ga0105241_101031342 350
317 3300009545 Ga0105237_10129631 Ga0105237_101296312 350
318 3300009551 Ga0105238_10004018 Ga0105238_1000401811 350
319 3300009551 Ga0105238_10051029 Ga0105238_100510292 350
320 3300009551 Ga0105238_10316343 Ga0105238_103163432 350
321 3300009553 Ga0105249_10041879 Ga0105249_100418794 350
322 3300010375 Ga0105239_10013244 Ga0105239_100132442 350
323 3300010375 Ga0105239_10513851 Ga0105239_105138511 350
324 3300013100 Ga0157373_10182361 Ga0157373_101823612 350
325 3300013102 Ga0157371_10003910 Ga0157371_1000391010 350
326 3300013104 Ga0157370_10153598 Ga0157370_101535982 350
327 3300013105 Ga0157369_10003028 Ga0157369_1000302812 350
328 3300013105 Ga0157369_10033149 Ga0157369_100331494 350
329 3300013296 Ga0157374_10195488 Ga0157374_101954882 350
330 3300013297 Ga0157378_10113475 Ga0157378_101134752 350
331 3300013307 Ga0157372_10122660 Ga0157372_101226601 350
332 3300013307 Ga0157372_10287729 Ga0157372_102877292 350
333 3300013308 Ga0157375_10389373 Ga0157375_103893732 350
334 3300014325 Ga0163163_10437431 Ga0163163_104374311 350
335 3300014497 Ga0182008_10008526 Ga0182008_100085265 350
336 3300014969 Ga0157376_10199507 Ga0157376_101995072 350
337 3300015261 Ga0182006_1000866 Ga0182006_10008663 350
338 3300015262 Ga0182007_10002091 Ga0182007_100020919 350
339 3300017792 Ga0163161_10000066 Ga0163161_10000066111 350
340 3300025292 Ga0209676_1000020 Ga0209676_1000020400 350
341 3300025292 Ga0209676_1005941 Ga0209676_10059414 350
342 3300025298 Ga0209050_1000037 Ga0209050_1000037301 350
343 3300025298 Ga0209050_1002215 Ga0209050_10022158 350
344 3300025303 Ga0209051_1000380 Ga0209051_100038038 350
345 3300025304 Ga0209257_1000005 Ga0209257_10000051334 350
346 3300025304 Ga0209257_1014591 Ga0209257_10145912 350
347 3300025321 Ga0207656_10011560 Ga0207656_100115602 350
348 3300025728 Ga0207655_1008877 Ga0207655_10088776 350
349 3300025735 Ga0207713_1001199 Ga0207713_100119919 350
350 3300025903 Ga0207680_10039788 Ga0207680_100397882 350
351 3300025904 Ga0207647_10005480 Ga0207647_100054802 350
352 3300025913 Ga0207695_10000014 Ga0207695_1000001437 350
353 3300025913 Ga0207695_10098368 Ga0207695_100983682 350
354 3300025913 Ga0207695_10170688 Ga0207695_101706882 350
355 3300025913 Ga0207695_10242658 Ga0207695_102426582 350
356 3300025914 Ga0207671_10015356 Ga0207671_100153565 350
357 3300025924 Ga0207694_10002128 Ga0207694_100021283 350
358 3300025924 Ga0207694_10003412 Ga0207694_100034122 350
359 3300025924 Ga0207694_10007982 Ga0207694_100079829 350
360 3300025925 Ga0207650_10043877 Ga0207650_100438772 350
361 3300025933 Ga0207706_10178706 Ga0207706_101787062 350
362 3300025939 Ga0207665_10111302 Ga0207665_101113022 350
363 3300025949 Ga0207667_10117154 Ga0207667_101171543 350
364 3300025961 Ga0207712_10003217 Ga0207712_1000321710 350
365 3300025981 Ga0207640_10027516 Ga0207640_100275162 350
366 3300025986 Ga0207658_10005884 Ga0207658_100058845 350
367 3300025986 Ga0207658_10008847 Ga0207658_100088476 350
368 3300026035 Ga0207703_10006849 Ga0207703_100068494 350
369 3300026041 Ga0207639_10053310 Ga0207639_100533102 350
370 3300026067 Ga0207678_10003270 Ga0207678_100032705 350
371 3300026078 Ga0207702_10039872 Ga0207702_100398722 350
372 3300026078 Ga0207702_10148738 Ga0207702_101487382 350
373 3300026089 Ga0207648_10285093 Ga0207648_102850931 350
374 3300027111 Ga0209281_1001783 Ga0209281_10017836 350
375 3300027907 Ga0207428_10026462 Ga0207428_100264623 350
376 3300028379 Ga0268266_10000001 Ga0268266_100000012336 350
377 3300028379 Ga0268266_10000001 Ga0268266_100000012663 350
378 3300028379 Ga0268266_10004174 Ga0268266_1000417410 350
379 3300028379 Ga0268266_10023213 Ga0268266_100232135 350
380 3300028380 Ga0268265_10089273 Ga0268265_100892732 350
381 3300028794 Ga0307515_10000016 Ga0307515_10000016309 350
382 3300030735 Ga0316178_1094315 Ga0316178_10943153 350
383 3300031456 Ga0307513_10029615 Ga0307513_100296155 350
384 3300031507 Ga0307509_10016260 Ga0307509_100162603 350
385 3300031507 Ga0307509_10035922 Ga0307509_100359225 350
386 3300031548 Ga0307408_100004852 Ga0307408_1000048522 350
387 3300031548 Ga0307408_100006406 Ga0307408_1000064062 350
388 3300031548 Ga0307408_100140781 Ga0307408_1001407812 350
389 3300031548 Ga0307408_100173637 Ga0307408_1001736372 350
390 3300031731 Ga0307405_10012466 Ga0307405_100124665 350
391 3300031731 Ga0307405_10019563 Ga0307405_100195634 350
392 3300031731 Ga0307405_10085820 Ga0307405_100858201 350
393 3300031901 Ga0307406_10001512 Ga0307406_100015125 350
394 3300031901 Ga0307406_10309899 Ga0307406_103098991 350
395 3300031903 Ga0307407_10007910 Ga0307407_100079104 350
396 3300031903 Ga0307407_10045144 Ga0307407_100451442 350
397 3300031911 Ga0307412_10001066 Ga0307412_100010662 350
398 3300031911 Ga0307412_10001611 Ga0307412_100016115 350
399 3300031911 Ga0307412_10008226 Ga0307412_100082262 350
400 3300031911 Ga0307412_10037285 Ga0307412_100372853 350
401 3300031995 Ga0307409_100005311 Ga0307409_1000053115 350
402 3300032002 Ga0307416_100149830 Ga0307416_1001498303 350
403 3300032004 Ga0307414_10007004 Ga0307414_100070042 350
404 3300032004 Ga0307414_10091649 Ga0307414_100916492 350
405 3300032004 Ga0307414_10290895 Ga0307414_102908951 350
406 3300032005 Ga0307411_10067595 Ga0307411_100675952 350
407 3300032005 Ga0307411_10092844 Ga0307411_100928442 350
408 3300032005 Ga0307411_10157846 Ga0307411_101578462 350
409 3300032005 Ga0307411_10178706 Ga0307411_101787062 350
410 3300033180 Ga0307510_10000324 Ga0307510_1000032427 350
411 3300037418 Ga0395900_0050014 Ga0395900_0050014_3204_4268 350
412 3300039437 Ga0436365_1678853 Ga0436365_1678853_1399_2454 350
413 3300041405 Ga0439438_000039 Ga0439438_000039_15450_16550 350
414 3300041405 Ga0439438_000379 Ga0439438_000379_9412_10515 350
415 3300041405 Ga0439438_001196 Ga0439438_001196_8805_9890 350
416 3300041405 Ga0439438_001599 Ga0439438_001599_6082_7164 350
417 3300041405 Ga0439438_001845 Ga0439438_001845_5411_6493 350
418 3300041405 Ga0439438_003426 Ga0439438_003426_2142_3245 350
419 3300041407 Ga0439447_000475 Ga0439447_000475_149_1252 350
420 3300041407 Ga0439447_000519 Ga0439447_000519_7940_9043 350
421 3300041407 Ga0439447_001031 Ga0439447_001031_8631_9731 350
422 3300041407 Ga0439447_002865 Ga0439447_002865_245_1348 350
423 3300041407 Ga0439447_012694 Ga0439447_012694_831_1913 350
424 3300041411 Ga0439466_0000127 Ga0439466_0000127_6569_7672 350
425 3300041411 Ga0439466_0007364 Ga0439466_0007364_879_1979 350
426 3300041411 Ga0439466_0008636 Ga0439466_0008636_2165_3268 350
427 3300041413 Ga0439465_0016836 Ga0439465_0016836_358_1461 350
428 3300041997 Ga0439431_0001988 Ga0439431_0001988_2924_4024 350
429 3300042006 Ga0439432_000233 Ga0439432_000233_6852_7955 350
430 3300042006 Ga0439432_017912 Ga0439432_017912_928_2013 350
431 3300042010 Ga0439452_000081 Ga0439452_000081_45858_46940 350
432 3300042010 Ga0439452_000250 Ga0439452_000250_23347_24450 350
433 3300042010 Ga0439452_000684 Ga0439452_000684_14856_15959 350
434 3300042010 Ga0439452_003373 Ga0439452_003373_2874_3956 350
435 3300042010 Ga0439452_004311 Ga0439452_004311_3647_4750 350
436 3300042013 Ga0439456_000527 Ga0439456_000527_468_1550 350
437 3300042016 Ga0439463_003192 Ga0439463_003192_1214_2317 350
438 3300042115 Ga0450911_000010 Ga0450911_000010_127101_128183 350
439 3300042121 Ga0450919_003157 Ga0450919_003157_64_1167 350
440 3300042138 Ga0450903_014865 Ga0450903_014865_28_1131 350
441 3300042139 Ga0450904_001143 Ga0450904_001143_1254_2336 350
442 3300042145 Ga0450906_000050 Ga0450906_000050_6201_7283 350
443 3300042146 Ga0450907_000001 Ga0450907_000001_175759_176862 350
444 3300042146 Ga0450907_000365 Ga0450907_000365_12187_13290 350
445 3300042147 Ga0450910_001903 Ga0450910_001903_1343_2446 350
446 3300042156 Ga0439446_0009690 Ga0439446_0009690_34_1089 350
447 3300042156 Ga0439446_0017814 Ga0439446_0017814_149_1252 350
448 3300042184 Ga0450908_001083 Ga0450908_001083_2852_3955 350
449 3300042435 Ga0439434_0000001 Ga0439434_0000001_936_2039 350
450 3300042435 Ga0439434_0026766 Ga0439434_0026766_222_1325 350
451 3300042461 Ga0439460_0000239 Ga0439460_0000239_8127_9230 350
452 3300042531 Ga0450918_009972 Ga0450918_009972_413_1495 350
453 3300042876 Ga0451577_0023438 Ga0451577_0023438_1726_2778 350
454 3300042993 Ga0439440_0000156 Ga0439440_0000156_6138_7241 350
455 3300044673 Ga0453683_0038352 Ga0453683_0038352_513_1565 350
456 3300045051 Ga0451576_0057093 Ga0451576_0057093_546_1619 350
457 3300046452 Ga0495617_009853 Ga0495617_009853_1981_3063 350
458 3300046452 Ga0495617_018189 Ga0495617_018189_1116_2198 350
459 3300046453 Ga0495627_000087 Ga0495627_000087_39680_40762 350
460 3300046453 Ga0495627_000101 Ga0495627_000101_20698_21780 350
461 3300046453 Ga0495627_008555 Ga0495627_008555_1712_2794 350
462 3300046458 Ga0495591_000199 Ga0495591_000199_49775_50857 350
463 3300046458 Ga0495591_003292 Ga0495591_003292_2959_4041 350
464 3300046458 Ga0495591_005534 Ga0495591_005534_2847_3929 350
465 3300046460 Ga0495638_0000117 Ga0495638_0000117_97123_98205 350
466 3300046471 Ga0495650_0014388 Ga0495650_0014388_2919_4001 350
467 3300046474 Ga0495605_0023553 Ga0495605_0023553_426_1508 350
468 3300046491 Ga0495584_0000739 Ga0495584_0000739_18239_19321 350
469 3300046492 Ga0495585_0000185 Ga0495585_0000185_4554_5636 350
470 3300046492 Ga0495585_0032212 Ga0495585_0032212_440_1522 350
471 3300046501 Ga0495607_0000517 Ga0495607_0000517_9744_10841 350
472 3300046501 Ga0495607_0014971 Ga0495607_0014971_2532_3635 350
473 3300046506 Ga0495583_0015656 Ga0495583_0015656_2366_3448 350
474 3300046507 Ga0495606_0012470 Ga0495606_0012470_4176_5258 350
475 3300046513 Ga0495616_0000454 Ga0495616_0000454_18228_19310 350
476 3300046513 Ga0495616_0019269 Ga0495616_0019269_160_1242 350
477 3300046515 Ga0495620_0000257 Ga0495620_0000257_8128_9210 350
478 3300046518 Ga0495631_0005114 Ga0495631_0005114_126_1208 350
479 3300046518 Ga0495631_0025683 Ga0495631_0025683_273_1355 350
480 3300046518 Ga0495631_0029840 Ga0495631_0029840_1120_2202 350
481 3300046519 Ga0495632_0000097 Ga0495632_0000097_65032_66114 350
482 3300046519 Ga0495632_0037832 Ga0495632_0037832_14_1096 350
483 3300046519 Ga0495632_0069066 Ga0495632_0069066_413_1516 350
484 3300046520 Ga0495637_0001309 Ga0495637_0001309_368_1450 350
485 3300046520 Ga0495637_0062129 Ga0495637_0062129_136_1218 350
486 3300046522 Ga0495643_0000625 Ga0495643_0000625_15501_16583 350
487 3300046523 Ga0495644_0005578 Ga0495644_0005578_1736_2833 350
488 3300046524 Ga0495648_0000172 Ga0495648_0000172_68681_69763 350
489 3300046524 Ga0495648_0000668 Ga0495648_0000668_28835_29917 350
490 3300046524 Ga0495648_0061494 Ga0495648_0061494_776_1861 350
491 3300046530 Ga0495654_0001012 Ga0495654_0001012_11234_12316 350
492 3300046530 Ga0495654_0023484 Ga0495654_0023484_146_1228 350
493 3300046538 Ga0495609_0000504 Ga0495609_0000504_6176_7258 350
494 3300046538 Ga0495609_0067375 Ga0495609_0067375_152_1234 350
495 3300046558 Ga0495633_0047583 Ga0495633_0047583_247_1329 350
496 3300046648 Ga0495611_0000024 Ga0495611_0000024_30515_31597 350
497 3300046648 Ga0495611_0002419 Ga0495611_0002419_5777_6859 350
498 3300046648 Ga0495611_0006686 Ga0495611_0006686_3356_4438 350
499 3300046660 Ga0495625_0000861 Ga0495625_0000861_22725_23807 350
500 3300046664 Ga0495659_0000641 Ga0495659_0000641_8888_9991 350
501 3300046665 Ga0495661_0008477 Ga0495661_0008477_2686_3768 350
502 3300046665 Ga0495661_0016477 Ga0495661_0016477_853_1956 350
503 3300046665 Ga0495661_0020395 Ga0495661_0020395_390_1487 350
504 3300046665 Ga0495661_0032909 Ga0495661_0032909_1347_2429 350
505 3300046691 Ga0495670_0000020 Ga0495670_0000020_84346_85428 350
506 3300046691 Ga0495670_0000112 Ga0495670_0000112_5904_7007 350
507 3300046692 Ga0495671_0000503 Ga0495671_0000503_27640_28722 350
508 3300046692 Ga0495671_0001542 Ga0495671_0001542_12222_13304 350
509 3300046692 Ga0495671_0006195 Ga0495671_0006195_2197_3279 350
510 3300046692 Ga0495671_0008699 Ga0495671_0008699_1222_2304 350
511 3300046692 Ga0495671_0037759 Ga0495671_0037759_1150_2232 350
512 3300046694 Ga0495649_0004543 Ga0495649_0004543_1399_2481 350
513 3300046694 Ga0495649_0031575 Ga0495649_0031575_1273_2355 350
514 3300046794 Ga0495589_0000477 Ga0495589_0000477_1157_2239 350
515 3300046810 Ga0495660_0004243 Ga0495660_0004243_5521_6603 350
516 3300046810 Ga0495660_0029491 Ga0495660_0029491_847_1929 350
517 3300047320 Ga0495672_0002027 Ga0495672_0002027_1109_2191 350
518 3300047320 Ga0495672_0007290 Ga0495672_0007290_4267_5349 350
519 3300047320 Ga0495672_0014217 Ga0495672_0014217_1704_2786 350
520 3300047469 Ga0495673_0004428 Ga0495673_0004428_3760_4842 350
521 3300047469 Ga0495673_0005784 Ga0495673_0005784_1141_2244 350
522 3300047469 Ga0495673_0065922 Ga0495673_0065922_406_1488 350
523 3300047470 Ga0495681_0001171 Ga0495681_0001171_2120_3202 350
524 3300047470 Ga0495681_0005497 Ga0495681_0005497_1640_2722 350
525 3300047472 Ga0495686_0002983 Ga0495686_0002983_12525_13595 350
526 3300047472 Ga0495686_0008113 Ga0495686_0008113_1134_2216 350
527 3300048091 Ga0495626_0006462 Ga0495626_0006462_3973_5055 350
528 3300048091 Ga0495626_0006994 Ga0495626_0006994_4585_5667 350
529 3300048913 Ga0496110_0120403 Ga0496110_0120403_1151_2245 350
530 3300048913 Ga0496110_0217687 Ga0496110_0217687_316_1494 350
531 3300048920 Ga0496117_0042697 Ga0496117_0042697_2109_3164 350
532 3300048921 Ga0496118_0000177 Ga0496118_0000177_104901_105956 350
533 3300048921 Ga0496118_0008563 Ga0496118_0008563_4438_5493 350
534 3300048925 Ga0496122_0000725 Ga0496122_0000725_30768_31838 350
535 3300048925 Ga0496122_0004406 Ga0496122_0004406_1361_2425 350
536 3300048926 Ga0496123_0001443 Ga0496123_0001443_23994_25064 350
537 3300048926 Ga0496123_0023465 Ga0496123_0023465_1333_2397 350
538 3300048927 Ga0496124_0252345 Ga0496124_0252345_192_1256 350
539 3300048929 Ga0496126_0000033 Ga0496126_0000033_139843_140913 350
540 3300049459 Ga0495678_001245 Ga0495678_001245_1306_2409 350
541 3300049459 Ga0495678_004383 Ga0495678_004383_3937_5019 350
542 3300049459 Ga0495678_032996 Ga0495678_032996_679_1761 350
543 3300049460 Ga0495682_0003820 Ga0495682_0003820_1312_2415 350
544 3300049569 Ga0501032_0034989 Ga0501032_0034989_1540_2598 350
545 3300049580 Ga0501046_0018614 Ga0501046_0018614_322_1392 350
546 3300049581 Ga0501047_0003068 Ga0501047_0003068_3293_4351 350
547 3300049581 Ga0501047_0090819 Ga0501047_0090819_548_1618 350
548 3300049589 Ga0501073_0046641 Ga0501073_0046641_153_1223 350
549 3300049671 Ga0501238_000036 Ga0501238_000036_20262_21314 350
550 3300049674 Ga0501242_007344 Ga0501242_007344_115_1173 350
551 3300049682 Ga0501252_000895 Ga0501252_000895_180_1262 350
552 3300049683 Ga0501253_009362 Ga0501253_009362_127_1185 350
553 3300049686 Ga0501257_004973 Ga0501257_004973_712_1770 350
554 3300049688 Ga0501259_001750 Ga0501259_001750_1422_2480 350
555 3300049744 Ga0501083_0065656 Ga0501083_0065656_422_1492 350
556 3300049758 Ga0501241_004060 Ga0501241_004060_1185_2240 350
557 3300049823 Ga0501044_0071990 Ga0501044_0071990_2020_3084 350
558 3300049823 Ga0501044_0262807 Ga0501044_0262807_321_1391 350
559 3300050507 nmdc:mga05p37_308100_c1 nmdc:mga05p37_308100_c1_313_1383 350
560 3300050507 nmdc:mga05p37_9912_c1 nmdc:mga05p37_9912_c1_1996_3066 350
561 3300050511 nmdc:mga08y16_136861_c1 nmdc:mga08y16_136861_c1_860_1912 350
562 3300050512 nmdc:mga0n895_39499_c1 nmdc:mga0n895_39499_c1_1881_2951 350
563 3300050512 nmdc:mga0n895_42311_c1 nmdc:mga0n895_42311_c1_1629_2699 350
564 3300050513 nmdc:mga0rr50_46484_c1 nmdc:mga0rr50_46484_c1_536_1606 350
565 3300050515 nmdc:mga0a205_39118_c1 nmdc:mga0a205_39118_c1_1709_2779 350
566 3300053119 Ga0500595_001265 Ga0500595_001265_2614_3675 350
567 3300053120 Ga0500597_000186 Ga0500597_000186_4421_5491 350
568 3300053146 Ga0500588_0000387 Ga0500588_0000387_990_2051 350
569 3300053156 Ga0500622_0000013 Ga0500622_0000013_256145_257197 350
570 3300054114 Ga0501084_0063654 Ga0501084_0063654_1125_2195 350
571 3300060353 Ga0501082_0001156 Ga0501082_0001156_2283_3353 350
572 iso_pu_bacteria 2511231004 2511257121 350
573 iso_pu_bacteria 2599185188 2599502047 350
574 iso_pu_bacteria 2599185300 2599932893 350
575 iso_pu_bacteria 2599185318 2600035617 350
576 iso_pu_bacteria 2599185322 2600057160 350
577 iso_pu_bacteria 2643221650 2644282557 350
578 iso_pu_bacteria 2675903515 2678264054 350
579 iso_pu_bacteria 2744054620 2745004510 350
580 iso_pu_bacteria 2791355520 2794596872 350
581 iso_pu_bacteria 8056155041 8056160225 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

63

357

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.9345 5 322
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.9149 5 322
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8048 8 322
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.7982 1 321
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.7928 1 321
ID Description Score Start End Superfamily
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9381 8 322 3.20.20.150
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9096 8 322 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8356 5 326 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8331 5 326 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8008 5 321 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A3D5KL40-F1-model_v4 AP endonuclease 0.9984 1 307 GO:0004519
AF-A0A531KWC7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9974 18 318 GO:0016853
AF-A0A7J5WQ74-F1-model_v4 AP endonuclease 2 domain 0.9973 97 235 GO:0004519
AF-A0A519Y544-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9968 1 324 GO:0016853
AF-A0A3D2R7S0-F1-model_v4 AP endonuclease 0.9968 102 300 GO:0004519

Feature Viewer

pLDDT pTM Quality
96.09 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map