F465926

General Info

Members Datasets Scaffolds Average Seq Length
580 238 1160 259

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10030578|Ga0081539_100305784
Length 274
Sequence VGRAHRPYPYVVRLLMIEEPYRWVEAIANRREYIEGQLAPGSPIAALGYGEGILFVTLGQTRQKLFEVYDRIAMGAIGHPGDIERLRMAAIELASTEGFTRSAADVSLRRLAHYSLSPVMKSAFEQVYGPPYLARMLFAEVGALPEDDLFLRIEYDGEIASNGATYARARQDFAVLSGTHQSVELMEAFLKNEHKPNASFETAVNSALDAWSVGHMLLQASEAKELPARDAIAQHRQEQLAIAAIEAAVLDRDSGSPIRYRSIADKELRSIITQ

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 7.24
Rhizosphere 88.79
Stem 0
Stem Tuber 0
Unclassified 35.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10030578 3300005985 Unclassified 3339
2 JGI24743J22301_10009040 3300001991 Unclassified 1759
3 JGI24744J21845_10024455 3300002077 Unclassified 1181
4 JGI24035J26624_1001336 3300002126 Unclassified 2337
5 JGI24035J26624_1001905 3300002126 Bacteria 1949
6 JGI25406J46586_10000016 3300003203 Bacteria 91056
7 rootL2_10040785 3300003322 Bacteria 31784
8 JGI25405J52794_10001125 3300003911 Bacteria 4287
9 JGI25405J52794_10001203 3300003911 Bacteria 4193
10 JGI25405J52794_10001342 3300003911 Bacteria 4028
11 Ga0065714_10079066 3300005288 Unclassified 2546
12 Ga0065704_10012683 3300005289 Bacteria 2152
13 Ga0065704_10016265 3300005289 Unclassified 3128
14 Ga0065712_10000912 3300005290 Bacteria 7479
15 Ga0065712_10009302 3300005290 Unclassified 4100
16 Ga0065712_10032649 3300005290 Unclassified 1471
17 Ga0065712_10096819 3300005290 Unclassified 2159
18 Ga0065712_10113215 3300005290 Bacteria 1787
19 Ga0065715_10000600 3300005293 Bacteria 17837
20 Ga0065715_10003434 3300005293 Unclassified 4390
21 Ga0065715_10039043 3300005293 Bacteria 1655
22 Ga0065715_10110158 3300005293 Unclassified 2631
23 Ga0065715_10142203 3300005293 Bacteria 1837
24 Ga0065715_10164132 3300005293 Unclassified 1557
25 Ga0065707_10025553 3300005295 Bacteria 1661
26 Ga0070658_10217045 3300005327 Unclassified 1617
27 Ga0070676_10034987 3300005328 Unclassified 2886
28 Ga0070676_10042381 3300005328 Bacteria 2643
29 Ga0070683_100030957 3300005329 Unclassified 4862
30 Ga0070683_100046482 3300005329 Bacteria 4011
31 Ga0070683_100907983 3300005329 Unclassified 845
32 Ga0070690_100019451 3300005330 Bacteria 4121
33 Ga0070690_100033761 3300005330 Unclassified 3204
34 Ga0070670_100007753 3300005331 Bacteria 9132
35 Ga0070670_100116839 3300005331 Unclassified 2300
36 Ga0070666_10002573 3300005335 Bacteria 10963
37 Ga0070666_10062640 3300005335 Unclassified 2520
38 Ga0070666_10101079 3300005335 Bacteria 1987
39 Ga0070666_10164190 3300005335 Unclassified 1553
40 Ga0070680_100090978 3300005336 Unclassified 2526
41 Ga0070682_100040964 3300005337 Unclassified 2853
42 Ga0068868_100045918 3300005338 Bacteria 3419
43 Ga0068868_100063376 3300005338 Unclassified 2932
44 Ga0070660_100110171 3300005339 Bacteria 2189
45 Ga0070689_100003689 3300005340 Bacteria 10227
46 Ga0070689_100008475 3300005340 Bacteria 7243
47 Ga0070689_100043981 3300005340 Bacteria 3435
48 Ga0070689_100593013 3300005340 Unclassified 959
49 Ga0070687_100005822 3300005343 Bacteria 5012
50 Ga0070687_100087234 3300005343 Bacteria 1717
51 Ga0070661_100073698 3300005344 Unclassified 2513
52 Ga0070668_100013088 3300005347 Bacteria 6181
53 Ga0070668_100087581 3300005347 Bacteria 2450
54 Ga0070668_100099625 3300005347 Unclassified 2301
55 Ga0070668_100379736 3300005347 Bacteria 1202
56 Ga0070668_100700628 3300005347 Unclassified 893
57 Ga0070669_100001125 3300005353 Bacteria 19527
58 Ga0070669_100175566 3300005353 Bacteria 1673
59 Ga0070675_100011335 3300005354 Bacteria 6978
60 Ga0070675_100013934 3300005354 Bacteria 6328
61 Ga0070675_100077577 3300005354 Bacteria 2765
62 Ga0070675_100105982 3300005354 Unclassified 2372
63 Ga0070675_100323159 3300005354 Bacteria 1363
64 Ga0070675_100514346 3300005354 Unclassified 1080
65 Ga0070675_100696524 3300005354 Bacteria 925
66 Ga0070671_100011010 3300005355 Bacteria 7258
67 Ga0070671_100053135 3300005355 Bacteria 3368
68 Ga0070671_100103271 3300005355 Unclassified 2391
69 Ga0070671_100123347 3300005355 Unclassified 2181
70 Ga0070674_100023803 3300005356 Bacteria 3969
71 Ga0070674_100027751 3300005356 Unclassified 3712
72 Ga0070673_100006681 3300005364 Bacteria 7519
73 Ga0070673_100011420 3300005364 Bacteria 6058
74 Ga0070673_100056885 3300005364 Unclassified 3088
75 Ga0070688_100000527 3300005365 Bacteria 19316
76 Ga0070688_100004107 3300005365 Bacteria 7556
77 Ga0070688_100180615 3300005365 Unclassified 1463
78 Ga0070659_100001979 3300005366 Bacteria 14637
79 Ga0070659_100055822 3300005366 Bacteria 3114
80 Ga0070667_100117461 3300005367 Bacteria 2311
81 Ga0070667_100339121 3300005367 Bacteria 1359
82 Ga0070703_10019675 3300005406 Bacteria 1959
83 Ga0070703_10132913 3300005406 Unclassified 916
84 Ga0070709_10006236 3300005434 Bacteria 6489
85 Ga0070709_10226844 3300005434 Unclassified 1335
86 Ga0070709_10254754 3300005434 Unclassified 1266
87 Ga0070714_100029829 3300005435 Bacteria 4537
88 Ga0070714_100040726 3300005435 Bacteria 3917
89 Ga0070714_100135241 3300005435 Bacteria 2207
90 Ga0070714_100444218 3300005435 Unclassified 1231
91 Ga0070714_100554412 3300005435 Bacteria 1100
92 Ga0070714_100717164 3300005435 Bacteria 965
93 Ga0070713_100050105 3300005436 Bacteria 3448
94 Ga0070713_100097504 3300005436 Bacteria 2540
95 Ga0070713_100186315 3300005436 Bacteria 1868
96 Ga0070713_100336530 3300005436 Unclassified 1397
97 Ga0070713_100591204 3300005436 Bacteria 1054
98 Ga0070713_100778071 3300005436 Bacteria 917
99 Ga0070710_10144787 3300005437 Unclassified 1460
100 Ga0070710_10183763 3300005437 Unclassified 1311
101 Ga0070701_10256614 3300005438 Unclassified 1058
102 Ga0070711_100041860 3300005439 Bacteria 3095
103 Ga0070711_100191464 3300005439 Bacteria 1572
104 Ga0070705_100002522 3300005440 Bacteria 9204
105 Ga0070705_100080550 3300005440 Bacteria 1998
106 Ga0070700_100024035 3300005441 Bacteria 3573
107 Ga0070694_100049759 3300005444 Bacteria 2823
108 Ga0070708_100044641 3300005445 Unclassified 3899
109 Ga0070708_100046647 3300005445 Bacteria 3823
110 Ga0070708_100048027 3300005445 Bacteria 3772
111 Ga0070708_100106041 3300005445 Unclassified 2579
112 Ga0070708_100614572 3300005445 Unclassified 1025
113 Ga0070678_100001827 3300005456 Bacteria 11474
114 Ga0070678_100131020 3300005456 Bacteria 1992
115 Ga0070678_100205072 3300005456 Bacteria 1630
116 Ga0070662_100005048 3300005457 Bacteria 8400
117 Ga0070662_100024522 3300005457 Bacteria 4157
118 Ga0070662_100141765 3300005457 Bacteria 1863
119 Ga0070662_100154049 3300005457 Unclassified 1792
120 Ga0070662_100245639 3300005457 Bacteria 1437
121 Ga0070681_10016079 3300005458 Bacteria 7458
122 Ga0068867_100093777 3300005459 Bacteria 2282
123 Ga0070706_100000159 3300005467 Bacteria 86016
124 Ga0070706_100004210 3300005467 Bacteria 13971
125 Ga0070706_100015418 3300005467 Bacteria 7059
126 Ga0070706_100030731 3300005467 Unclassified 4950
127 Ga0070706_100068341 3300005467 Bacteria 3285
128 Ga0070706_100072804 3300005467 Bacteria 3180
129 Ga0070707_100000049 3300005468 Bacteria 102972
130 Ga0070707_100023875 3300005468 Bacteria 5784
131 Ga0070707_100027945 3300005468 Bacteria 5366
132 Ga0070707_100040134 3300005468 Unclassified 4477
133 Ga0070707_100120570 3300005468 Bacteria 2546
134 Ga0070707_100207543 3300005468 Bacteria 1909
135 Ga0070707_100352295 3300005468 Unclassified 1430
136 Ga0070707_100436071 3300005468 Bacteria 1271
137 Ga0070698_100005334 3300005471 Bacteria 14070
138 Ga0070698_100005632 3300005471 Bacteria 13706
139 Ga0070698_100041532 3300005471 Unclassified 4721
140 Ga0070698_100251333 3300005471 Bacteria 1701
141 Ga0070698_100307813 3300005471 Unclassified 1515
142 Ga0070698_100460871 3300005471 Unclassified 1207
143 Ga0070698_100554763 3300005471 Bacteria 1088
144 Ga0070699_100019360 3300005518 Bacteria 5859
145 Ga0070699_100023434 3300005518 Bacteria 5318
146 Ga0070699_100062690 3300005518 Bacteria 3223
147 Ga0070699_100123749 3300005518 Bacteria 2276
148 Ga0070699_100138505 3300005518 Bacteria 2147
149 Ga0070699_100284277 3300005518 Bacteria 1482
150 Ga0070699_100392636 3300005518 Bacteria 1254
151 Ga0070699_100567980 3300005518 Unclassified 1033
152 Ga0070679_100144435 3300005530 Unclassified 2357
153 Ga0070684_100000685 3300005535 Bacteria 23382
154 Ga0070684_100037687 3300005535 Unclassified 4149
155 Ga0070697_100004731 3300005536 Bacteria 10431
156 Ga0070697_100005805 3300005536 Bacteria 9521
157 Ga0070697_100011300 3300005536 Bacteria 6975
158 Ga0070697_100016294 3300005536 Bacteria 5845
159 Ga0070697_100049655 3300005536 Unclassified 3405
160 Ga0070697_100064997 3300005536 Bacteria 2980
161 Ga0070697_100066804 3300005536 Unclassified 2940
162 Ga0070697_100102528 3300005536 Bacteria 2378
163 Ga0070697_100113349 3300005536 Bacteria 2262
164 Ga0070697_100126665 3300005536 Bacteria 2140
165 Ga0070697_100134747 3300005536 Bacteria 2073
166 Ga0070697_100138514 3300005536 Unclassified 2045
167 Ga0070672_100000507 3300005543 Bacteria 22759
168 Ga0070672_100015220 3300005543 Bacteria 5470
169 Ga0070686_100054635 3300005544 Unclassified 2555
170 Ga0070695_100038341 3300005545 Unclassified 3023
171 Ga0070693_100353060 3300005547 Bacteria 1007
172 Ga0070665_100032657 3300005548 Bacteria 5238
173 Ga0070665_100054892 3300005548 Unclassified 3995
174 Ga0070665_100191354 3300005548 Bacteria 2047
175 Ga0070665_100270343 3300005548 Unclassified 1701
176 Ga0070704_100010067 3300005549 Bacteria 5745
177 Ga0070664_100014719 3300005564 Bacteria 6388
178 Ga0070664_100022227 3300005564 Bacteria 5231
179 Ga0070664_100234797 3300005564 Unclassified 1645
180 Ga0068856_100069852 3300005614 Unclassified 3473
181 Ga0068856_100105618 3300005614 Bacteria 2810
182 Ga0068859_100090042 3300005617 Bacteria 3119
183 Ga0068866_10217033 3300005718 Unclassified 1152
184 Ga0068861_100370725 3300005719 Bacteria 1262
185 Ga0068863_100020988 3300005841 Bacteria 6238
186 Ga0068863_100076966 3300005841 Bacteria 3156
187 Ga0068863_100225659 3300005841 Bacteria 1806
188 Ga0068863_100401513 3300005841 Bacteria 1341
189 Ga0068858_100005838 3300005842 Bacteria 12025
190 Ga0068858_100098054 3300005842 Unclassified 2733
191 Ga0068860_100021776 3300005843 Bacteria 6202
192 Ga0068860_100046597 3300005843 Unclassified 4133
193 Ga0068860_100136331 3300005843 Bacteria 2357
194 Ga0068862_100409521 3300005844 Unclassified 1270
195 Ga0081455_10000582 3300005937 Bacteria 47687
196 Ga0081455_10000643 3300005937 Bacteria 45230
197 Ga0081455_10016636 3300005937 Bacteria 7091
198 Ga0081455_10016846 3300005937 Bacteria 7028
199 Ga0081455_10062385 3300005937 Unclassified 3133
200 Ga0081455_10080469 3300005937 Unclassified 2671
201 Ga0081455_10100188 3300005937 Bacteria 2328
202 Ga0081455_10106477 3300005937 Unclassified 2238
203 Ga0081540_1000340 3300005983 Bacteria 47909
204 Ga0081540_1048116 3300005983 Bacteria 2138
205 Ga0081539_10000383 3300005985 Bacteria 95995
206 Ga0081539_10003184 3300005985 Bacteria 20777
207 Ga0081539_10028869 3300005985 Bacteria 3481
208 Ga0081539_10046735 3300005985 Archaea 2478
209 Ga0081539_10052197 3300005985 Unclassified 2298
210 Ga0081539_10120482 3300005985 Bacteria 1304
211 Ga0070717_10008493 3300006028 Bacteria 7671
212 Ga0070717_10010257 3300006028 Bacteria 7060
213 Ga0070717_10092804 3300006028 Bacteria 2551
214 Ga0070717_10217455 3300006028 Bacteria 1678
215 Ga0070717_10515351 3300006028 Bacteria 1082
216 Ga0070716_100014161 3300006173 Bacteria 4082
217 Ga0070716_100014403 3300006173 Unclassified 4049
218 Ga0070716_100222016 3300006173 Unclassified 1270
219 Ga0070716_100295941 3300006173 Unclassified 1123
220 Ga0070712_100012407 3300006175 Bacteria 5416
221 Ga0070712_100087099 3300006175 Bacteria 2278
222 Ga0070712_100091966 3300006175 Bacteria 2224
223 Ga0070712_100269744 3300006175 Bacteria 1367
224 Ga0070712_100273145 3300006175 Unclassified 1359
225 Ga0075362_10000189 3300006177 Bacteria 17083
226 Ga0097621_100006631 3300006237 Bacteria 8227
227 Ga0097621_100047310 3300006237 Unclassified 3485
228 Ga0097621_100385567 3300006237 Unclassified 1252
229 Ga0068871_100005948 3300006358 Bacteria 8587
230 Ga0068871_100017612 3300006358 Bacteria 5410
231 Ga0068871_100018313 3300006358 Bacteria 5320
232 Ga0068871_100288729 3300006358 Bacteria 1437
233 Ga0075428_100521573 3300006844 Unclassified 1271
234 Ga0075433_10381658 3300006852 Unclassified 1244
235 Ga0075436_100302640 3300006914 Unclassified 1146
236 Ga0097620_100090039 3300006931 Bacteria 3119
237 Ga0099795_10123981 3300007788 Unclassified 1036
238 Ga0111539_10182382 3300009094 Bacteria 2451
239 Ga0111539_10316202 3300009094 Bacteria 1817
240 Ga0105245_10023920 3300009098 Bacteria 5362
241 Ga0105245_10086209 3300009098 Unclassified 2880
242 Ga0105245_10099031 3300009098 Unclassified 2694
243 Ga0105247_10144744 3300009101 Unclassified 1561
244 Ga0105247_10433188 3300009101 Unclassified 944
245 Ga0114129_10002461 3300009147 Bacteria 25709
246 Ga0114129_10128853 3300009147 Bacteria 3477
247 Ga0114129_10181753 3300009147 Bacteria 2861
248 Ga0114129_10622050 3300009147 Unclassified 1397
249 Ga0105237_10103808 3300009545 Bacteria 2835
250 Ga0105237_10338619 3300009545 Unclassified 1509
251 Ga0105237_10738640 3300009545 Unclassified 991
252 Ga0105249_10040660 3300009553 Unclassified 4224
253 Ga0105249_10104459 3300009553 Bacteria 2670
254 Ga0105249_10130843 3300009553 Bacteria 2396
255 Ga0099796_10035280 3300010159 Unclassified 1658
256 Ga0105239_10072107 3300010375 Unclassified 3796
257 Ga0105239_10203267 3300010375 Bacteria 2220
258 Ga0105246_10150503 3300011119 Bacteria 1761
259 Ga0105246_10359245 3300011119 Unclassified 1196
260 Ga0157369_10064726 3300013105 Unclassified 3937
261 Ga0157374_10121518 3300013296 Unclassified 2521
262 Ga0157374_10121984 3300013296 Unclassified 2516
263 Ga0157374_10201614 3300013296 Bacteria 1948
264 Ga0157374_10222957 3300013296 Unclassified 1850
265 Ga0157374_10354353 3300013296 Bacteria 1458
266 Ga0157374_10512038 3300013296 Bacteria 1205
267 Ga0157378_10018283 3300013297 Bacteria 6153
268 Ga0157378_10021223 3300013297 Bacteria 5712
269 Ga0157378_10034433 3300013297 Bacteria 4479
270 Ga0157378_10224402 3300013297 Bacteria 1787
271 Ga0157378_10662754 3300013297 Unclassified 1060
272 Ga0157378_10761288 3300013297 Bacteria 992
273 Ga0163162_10002963 3300013306 Bacteria 16201
274 Ga0163162_10061261 3300013306 Bacteria 3800
275 Ga0163162_10962018 3300013306 Unclassified 964
276 Ga0157372_10038275 3300013307 Bacteria 5292
277 Ga0157375_10002525 3300013308 Bacteria 15888
278 Ga0157375_10035794 3300013308 Unclassified 4743
279 Ga0157375_10111424 3300013308 Unclassified 2835
280 Ga0157375_10835978 3300013308 Unclassified 1068
281 Ga0157375_10939056 3300013308 Unclassified 1007
282 Ga0163163_10216820 3300014325 Unclassified 1963
283 Ga0163163_10363593 3300014325 Unclassified 1504
284 Ga0157377_10060667 3300014745 Bacteria 2160
285 Ga0157379_10017190 3300014968 Bacteria 6371
286 Ga0157376_10009097 3300014969 Bacteria 7198
287 Ga0157376_10061890 3300014969 Unclassified 3148
288 Ga0157376_10201371 3300014969 Bacteria 1832
289 Ga0157376_10461498 3300014969 Unclassified 1241
290 Ga0163161_10062398 3300017792 Bacteria 2715
291 Ga0163161_10507135 3300017792 Unclassified 983
292 Ga0213872_10012499 3300021361 Bacteria 3992
293 Ga0213872_10022443 3300021361 Bacteria 2906
294 Ga0213872_10041006 3300021361 Bacteria 2113
295 Ga0213872_10054421 3300021361 Bacteria 1815
296 Ga0213872_10088303 3300021361 Bacteria 1388
297 Ga0213874_10022250 3300021377 Bacteria 1757
298 Ga0213876_10005417 3300021384 Bacteria 7023
299 Ga0213876_10051203 3300021384 Bacteria 2182
300 Ga0213876_10085164 3300021384 Unclassified 1672
301 Ga0213875_10049032 3300021388 Bacteria 1980
302 Ga0207666_1000425 3300025271 Bacteria 5490
303 Ga0207666_1000508 3300025271 Bacteria 4771
304 Ga0207673_1000242 3300025290 Bacteria 5558
305 Ga0207697_10000302 3300025315 Bacteria 27561
306 Ga0207697_10001124 3300025315 Bacteria 14733
307 Ga0207697_10002156 3300025315 Bacteria 10313
308 Ga0207697_10002407 3300025315 Bacteria 9753
309 Ga0207697_10003735 3300025315 Bacteria 7447
310 Ga0207697_10009454 3300025315 Unclassified 4211
311 Ga0207697_10012738 3300025315 Unclassified 3520
312 Ga0207697_10014558 3300025315 Bacteria 3261
313 Ga0207653_10003439 3300025885 Bacteria 4989
314 Ga0207692_10167016 3300025898 Unclassified 1273
315 Ga0207680_10037995 3300025903 Bacteria 2784
316 Ga0207680_10047724 3300025903 Unclassified 2539
317 Ga0207680_10053891 3300025903 Unclassified 2417
318 Ga0207647_10005071 3300025904 Bacteria 9713
319 Ga0207699_10014030 3300025906 Unclassified 4119
320 Ga0207699_10043651 3300025906 Unclassified 2606
321 Ga0207645_10003338 3300025907 Bacteria 12235
322 Ga0207645_10012355 3300025907 Bacteria 5796
323 Ga0207645_10052621 3300025907 Unclassified 2602
324 Ga0207684_10000208 3300025910 Bacteria 91185
325 Ga0207684_10000828 3300025910 Bacteria 35600
326 Ga0207684_10004368 3300025910 Bacteria 13357
327 Ga0207684_10029507 3300025910 Bacteria 4670
328 Ga0207684_10036238 3300025910 Bacteria 4188
329 Ga0207684_10077700 3300025910 Bacteria 2823
330 Ga0207684_10095389 3300025910 Bacteria 2538
331 Ga0207707_10032289 3300025912 Unclassified 4582
332 Ga0207693_10009411 3300025915 Bacteria 7969
333 Ga0207693_10022923 3300025915 Bacteria 4958
334 Ga0207693_10029485 3300025915 Unclassified 4334
335 Ga0207693_10045433 3300025915 Bacteria 3451
336 Ga0207693_10111130 3300025915 Unclassified 2149
337 Ga0207693_10254488 3300025915 Bacteria 1378
338 Ga0207693_10416782 3300025915 Unclassified 1050
339 Ga0207660_10017748 3300025917 Unclassified 4734
340 Ga0207662_10002073 3300025918 Bacteria 9942
341 Ga0207662_10026636 3300025918 Bacteria 3335
342 Ga0207657_10136791 3300025919 Bacteria 2004
343 Ga0207652_10146097 3300025921 Unclassified 2117
344 Ga0207646_10000115 3300025922 Bacteria 110424
345 Ga0207646_10000985 3300025922 Bacteria 36586
346 Ga0207646_10028529 3300025922 Bacteria 5079
347 Ga0207646_10035326 3300025922 Unclassified 4514
348 Ga0207646_10077114 3300025922 Bacteria 2979
349 Ga0207646_10093177 3300025922 Unclassified 2697
350 Ga0207646_10110165 3300025922 Bacteria 2471
351 Ga0207646_10261102 3300025922 Unclassified 1565
352 Ga0207646_10303474 3300025922 Bacteria 1442
353 Ga0207646_10513134 3300025922 Bacteria 1079
354 Ga0207681_10061968 3300025923 Bacteria 2573
355 Ga0207650_10148849 3300025925 Bacteria 1846
356 Ga0207659_10050753 3300025926 Bacteria 2948
357 Ga0207659_10068307 3300025926 Bacteria 2584
358 Ga0207659_10096539 3300025926 Bacteria 2219
359 Ga0207659_10097626 3300025926 Bacteria 2207
360 Ga0207659_10564189 3300025926 Bacteria 969
361 Ga0207687_10041012 3300025927 Bacteria 3176
362 Ga0207687_10319953 3300025927 Unclassified 1255
363 Ga0207700_10045473 3300025928 Bacteria 3240
364 Ga0207700_10127943 3300025928 Bacteria 2069
365 Ga0207700_10170755 3300025928 Bacteria 1814
366 Ga0207700_10269928 3300025928 Bacteria 1460
367 Ga0207700_10455445 3300025928 Bacteria 1128
368 Ga0207664_10043906 3300025929 Bacteria 3498
369 Ga0207664_10125790 3300025929 Bacteria 2152
370 Ga0207664_10649191 3300025929 Unclassified 948
371 Ga0207644_10072780 3300025931 Bacteria 2518
372 Ga0207644_10077687 3300025931 Unclassified 2445
373 Ga0207644_10145999 3300025931 Bacteria 1826
374 Ga0207644_10247341 3300025931 Bacteria 1422
375 Ga0207644_10335887 3300025931 Unclassified 1224
376 Ga0207690_10005356 3300025932 Bacteria 7560
377 Ga0207706_10065686 3300025933 Bacteria 3194
378 Ga0207706_10081182 3300025933 Bacteria 2850
379 Ga0207686_10110646 3300025934 Bacteria 1852
380 Ga0207670_10036781 3300025936 Bacteria 3186
381 Ga0207669_10090591 3300025937 Bacteria 1989
382 Ga0207669_10092672 3300025937 Unclassified 1972
383 Ga0207704_10155202 3300025938 Bacteria 1621
384 Ga0207665_10119227 3300025939 Bacteria 1862
385 Ga0207691_10001154 3300025940 Bacteria 26239
386 Ga0207691_10033420 3300025940 Unclassified 4788
387 Ga0207691_10073215 3300025940 Unclassified 3090
388 Ga0207691_10297240 3300025940 Bacteria 1388
389 Ga0207691_10343784 3300025940 Unclassified 1277
390 Ga0207689_10044615 3300025942 Unclassified 3666
391 Ga0207661_10033828 3300025944 Bacteria 3970
392 Ga0207661_10061617 3300025944 Bacteria 3031
393 Ga0207661_10155801 3300025944 Unclassified 1978
394 Ga0207679_10039525 3300025945 Unclassified 3369
395 Ga0207679_10053578 3300025945 Bacteria 2966
396 Ga0207651_10028610 3300025960 Unclassified 3518
397 Ga0207651_10038972 3300025960 Unclassified 3128
398 Ga0207712_10031882 3300025961 Bacteria 3553
399 Ga0207712_10079685 3300025961 Unclassified 2380
400 Ga0207712_10210593 3300025961 Unclassified 1548
401 Ga0207668_10009025 3300025972 Bacteria 5958
402 Ga0207668_10021596 3300025972 Bacteria 4107
403 Ga0207668_10032029 3300025972 Unclassified 3470
404 Ga0207668_10245287 3300025972 Bacteria 1452
405 Ga0207668_10461809 3300025972 Bacteria 1086
406 Ga0207658_10002192 3300025986 Bacteria 14501
407 Ga0207658_10012539 3300025986 Bacteria 5788
408 Ga0207658_10030781 3300025986 Bacteria 3804
409 Ga0207658_10053972 3300025986 Bacteria 2972
410 Ga0207677_10008391 3300026023 Bacteria 5765
411 Ga0207677_10040798 3300026023 Bacteria 3063
412 Ga0207677_10138425 3300026023 Unclassified 1860
413 Ga0207677_10338790 3300026023 Bacteria 1256
414 Ga0207703_10020236 3300026035 Bacteria 5204
415 Ga0207678_10006966 3300026067 Bacteria 10034
416 Ga0207678_10187740 3300026067 Unclassified 1766
417 Ga0207708_10022748 3300026075 Bacteria 4734
418 Ga0207641_10232529 3300026088 Bacteria 1714
419 Ga0207648_10123881 3300026089 Unclassified 2273
420 Ga0207648_10349310 3300026089 Bacteria 1333
421 Ga0207675_100072593 3300026118 Unclassified 3219
422 Ga0207675_100092470 3300026118 Bacteria 2845
423 Ga0207683_10002853 3300026121 Bacteria 15067
424 Ga0207683_10014855 3300026121 Bacteria 6630
425 Ga0207683_10427012 3300026121 Unclassified 1221
426 Ga0209974_10021173 3300027876 Bacteria 2153
427 Ga0268266_10007337 3300028379 Bacteria 9960
428 Ga0268266_10088337 3300028379 Unclassified 2712
429 Ga0268266_10120569 3300028379 Unclassified 2333
430 Ga0268266_10244118 3300028379 Unclassified 1658
431 Ga0268265_10473135 3300028380 Unclassified 1175
432 Ga0268264_10031411 3300028381 Bacteria 4355
433 Ga0268264_10527688 3300028381 Bacteria 1155
434 Ga0265337_1026205 3300028556 Unclassified 1769
435 Ga0265338_10027936 3300028800 Bacteria 5645
436 Ga0265338_10184845 3300028800 Unclassified 1585
437 Ga0307513_10078143 3300031456 Unclassified 3424
438 Ga0373945_0019889 3300035116 Bacteria 2295
439 Ga0373945_0120484 3300035116 Unclassified 1043
440 Ga0373956_0094903 3300035119 Unclassified 1379
441 Ga0373957_0055953 3300035120 Bacteria 1518
442 Ga0373943_0022405 3300035170 Bacteria 2927
443 Ga0373943_0201436 3300035170 Bacteria 1102
444 Ga0373946_0088835 3300035171 Unclassified 1366
445 Ga0373955_0003778 3300035172 Bacteria 6672
446 Ga0373924_0017962 3300035410 Unclassified 2721
447 Ga0373931_0096274 3300035691 Unclassified 1658
448 Ga0373931_0202607 3300035691 Unclassified 1186
449 Ga0373935_0126265 3300035692 Unclassified 1714
450 Ga0373935_0265848 3300035692 Bacteria 1204
451 Ga0373927_0120698 3300035695 Bacteria 1711
452 Ga0373927_0192801 3300035695 Unclassified 1337
453 Ga0373947_0023815 3300035725 Bacteria 3564
454 Ga0373947_0135003 3300035725 Bacteria 1578
455 Ga0373937_0010101 3300036401 Bacteria 8232
456 Ga0373937_0023461 3300036401 Bacteria 5555
457 Ga0373925_0076636 3300037068 Unclassified 2536
458 Ga0373925_0091150 3300037068 Unclassified 2331
459 Ga0373925_0439172 3300037068 Unclassified 1068
460 Ga0395900_0016194 3300037418 Bacteria 7596
461 Ga0395900_0017759 3300037418 Bacteria 7261
462 Ga0395898_0041393 3300037466 Unclassified 4551
463 Ga0395898_0347694 3300037466 Unclassified 1414
464 Ga0395905_0062618 3300037471 Bacteria 3480
465 Ga0395905_0324109 3300037471 Unclassified 1430
466 Ga0436364_0892439 3300037853 Bacteria 967
467 Ga0436364_1177859 3300037853 Bacteria 2129
468 Ga0436364_1402391 3300037853 Bacteria 3759
469 Ga0395901_0002207 3300038443 Bacteria 19856
470 Ga0395901_0045662 3300038443 Unclassified 4548
471 Ga0395901_0158030 3300038443 Bacteria 2381
472 Ga0395901_0399978 3300038443 Unclassified 1411
473 Ga0395901_0453632 3300038443 Bacteria 1311
474 Ga0436365_0893531 3300039437 Bacteria 5694
475 Ga0436365_0941525 3300039437 Bacteria 29495
476 Ga0436365_1279257 3300039437 Bacteria 36311
477 Ga0436365_1702714 3300039437 Bacteria 17164
478 Ga0436365_1804822 3300039437 Bacteria 4039
479 Ga0436360_0044627 3300039438 Unclassified 924
480 Ga0436360_0109079 3300039438 Bacteria 6475
481 Ga0436360_0209699 3300039438 Bacteria 1897
482 Ga0436360_0539194 3300039438 Unclassified 2942
483 Ga0436360_1344586 3300039438 Unclassified 2889
484 Ga0436361_0103363 3300039447 Bacteria 1930
485 Ga0436361_0111012 3300039447 Bacteria 4416
486 Ga0436361_0271097 3300039447 Bacteria 7333
487 Ga0436361_0277425 3300039447 Bacteria 1546
488 Ga0436361_0583454 3300039447 Bacteria 1247
489 Ga0436361_0797992 3300039447 Bacteria 19448
490 Ga0436361_0873473 3300039447 Unclassified 1337
491 Ga0436361_0997857 3300039447 Bacteria 1516
492 Ga0436361_1202543 3300039447 Unclassified 3692
493 Ga0436363_0203842 3300039450 Unclassified 4373
494 Ga0436363_1006004 3300039450 Bacteria 6751
495 Ga0436362_0096211 3300039453 Bacteria 1139
496 Ga0436362_0266325 3300039453 Unclassified 1050
497 Ga0451849_1324247 3300041505 Unclassified 827
498 Ga0439448_0100170 3300042005 Bacteria 984
499 Ga0439451_039784 3300042009 Bacteria 944
500 Ga0439464_0054568 3300042439 Bacteria 1161
501 Ga0495592_0016171 3300046454 Bacteria 5660
502 Ga0495651_0069517 3300046462 Bacteria 2682
503 Ga0495651_0105369 3300046462 Bacteria 2092
504 Ga0495580_0254901 3300046472 Bacteria 1201
505 Ga0495639_0043897 3300046475 Bacteria 2020
506 Ga0495664_0127843 3300046477 Unclassified 1538
507 Ga0495618_0063753 3300046514 Bacteria 2341
508 Ga0495628_0025329 3300046516 Bacteria 4846
509 Ga0495630_0013029 3300046517 Bacteria 6041
510 Ga0495630_0124641 3300046517 Bacteria 1955
511 Ga0495642_0141760 3300046528 Unclassified 1038
512 Ga0495652_0020853 3300046529 Bacteria 5823
513 Ga0495652_0022832 3300046529 Bacteria 5551
514 Ga0495665_0026500 3300046531 Bacteria 3113
515 Ga0495586_0046173 3300046535 Bacteria 2348
516 Ga0495587_0096391 3300046536 Bacteria 1706
517 Ga0495667_0083823 3300046559 Bacteria 2070
518 Ga0495634_0125498 3300046642 Unclassified 1640
519 Ga0495657_0322988 3300046675 Unclassified 917
520 Ga0495599_0054529 3300046678 Unclassified 2504
521 Ga0495669_0279991 3300046684 Unclassified 802
522 Ga0495613_0035379 3300046689 Bacteria 3707
523 Ga0495581_0044126 3300047315 Bacteria 2578
524 Ga0495674_0197445 3300047319 Bacteria 1670
525 Ga0495675_0016405 3300047444 Bacteria 4685
526 Ga0495675_0022257 3300047444 Bacteria 4040
527 Ga0495684_0216679 3300047471 Bacteria 1405
528 Ga0496100_0030661 3300048903 Bacteria 3337
529 Ga0496101_0089908 3300048904 Unclassified 2283
530 Ga0496101_0207237 3300048904 Bacteria 1518
531 Ga0496101_0335548 3300048904 Unclassified 1187
532 Ga0496102_0098528 3300048905 Unclassified 2713
533 Ga0496102_0116802 3300048905 Bacteria 2490
534 Ga0496102_0216602 3300048905 Bacteria 1805
535 Ga0496102_0591511 3300048905 Unclassified 1032
536 Ga0496103_0044216 3300048906 Unclassified 2744
537 Ga0496104_0030859 3300048907 Bacteria 4984
538 Ga0496104_0044475 3300048907 Bacteria 4172
539 Ga0496104_0110520 3300048907 Unclassified 2635
540 Ga0496104_0350158 3300048907 Bacteria 1390
541 Ga0496104_0783335 3300048907 Unclassified 860
542 Ga0496105_0026072 3300048908 Bacteria 4764
543 Ga0496105_0052954 3300048908 Bacteria 3352
544 Ga0496105_0094231 3300048908 Unclassified 2473
545 Ga0496106_0029695 3300048909 Bacteria 4076
546 Ga0496106_0063335 3300048909 Bacteria 2810
547 Ga0496107_0417266 3300048910 Unclassified 998
548 Ga0496108_0003070 3300048911 Bacteria 13424
549 Ga0496108_0065063 3300048911 Unclassified 3073
550 Ga0496109_0014337 3300048912 Bacteria 6897
551 Ga0496109_0193322 3300048912 Unclassified 1912
552 Ga0496109_0319797 3300048912 Unclassified 1464
553 Ga0496109_0771612 3300048912 Unclassified 899
554 Ga0496110_0059151 3300048913 Bacteria 3377
555 Ga0496110_0183998 3300048913 Unclassified 1897
556 Ga0496111_0025912 3300048914 Bacteria 4138
557 Ga0496111_0347737 3300048914 Unclassified 1097
558 Ga0496112_0016046 3300048915 Bacteria 7004
559 Ga0496112_0035031 3300048915 Unclassified 4886
560 Ga0496112_0224616 3300048915 Unclassified 1833
561 Ga0496113_0009210 3300048916 Bacteria 6476
562 Ga0496113_0570349 3300048916 Unclassified 907
563 Ga0496114_0019270 3300048917 Bacteria 5528
564 Ga0496114_0021555 3300048917 Bacteria 5242
565 Ga0496114_0758092 3300048917 Unclassified 848
566 Ga0496115_0001242 3300048918 Bacteria 18287
567 Ga0496115_0003067 3300048918 Bacteria 11998
568 Ga0496115_0183635 3300048918 Unclassified 1728
569 Ga0496115_0568746 3300048918 Unclassified 904
570 nmdc:mga0k408_35373_c1 3300050493 Bacteria 2865
571 nmdc:mga05p37_1034_c1 3300050507 Bacteria 31710
572 nmdc:mga08y16_531200_c1 3300050511 Unclassified 1192
573 nmdc:mga0n895_485133_c1 3300050512 Unclassified 1246
574 nmdc:mga0a205_119752_c1 3300050515 Bacteria 2531
575 Ga0495601_0117226 3300053077 Bacteria 1727
576 Ga0495601_0125315 3300053077 Unclassified 1671
577 Ga0495619_0036438 3300053085 Bacteria 3204
578 Ga0500555_000380 3300053103 Bacteria 18717
579 Ga0500556_0003924 3300053104 Bacteria 4298
580 Ga0500642_0003660 3300053130 Bacteria 4684
581 Ga0081539_10030578
582 JGI24743J22301_10009040
583 JGI24744J21845_10024455
584 JGI24035J26624_1001336
585 JGI24035J26624_1001905
586 JGI25406J46586_10000016
587 rootL2_10040785
588 JGI25405J52794_10001125
589 JGI25405J52794_10001203
590 JGI25405J52794_10001342
591 Ga0065714_10079066
592 Ga0065704_10012683
593 Ga0065704_10016265
594 Ga0065712_10000912
595 Ga0065712_10009302
596 Ga0065712_10032649
597 Ga0065712_10096819
598 Ga0065712_10113215
599 Ga0065715_10000600
600 Ga0065715_10003434
601 Ga0065715_10039043
602 Ga0065715_10110158
603 Ga0065715_10142203
604 Ga0065715_10164132
605 Ga0065707_10025553
606 Ga0070658_10217045
607 Ga0070676_10034987
608 Ga0070676_10042381
609 Ga0070683_100030957
610 Ga0070683_100046482
611 Ga0070683_100907983
612 Ga0070690_100019451
613 Ga0070690_100033761
614 Ga0070670_100007753
615 Ga0070670_100116839
616 Ga0070666_10002573
617 Ga0070666_10062640
618 Ga0070666_10101079
619 Ga0070666_10164190
620 Ga0070680_100090978
621 Ga0070682_100040964
622 Ga0068868_100045918
623 Ga0068868_100063376
624 Ga0070660_100110171
625 Ga0070689_100003689
626 Ga0070689_100008475
627 Ga0070689_100043981
628 Ga0070689_100593013
629 Ga0070687_100005822
630 Ga0070687_100087234
631 Ga0070661_100073698
632 Ga0070668_100013088
633 Ga0070668_100087581
634 Ga0070668_100099625
635 Ga0070668_100379736
636 Ga0070668_100700628
637 Ga0070669_100001125
638 Ga0070669_100175566
639 Ga0070675_100011335
640 Ga0070675_100013934
641 Ga0070675_100077577
642 Ga0070675_100105982
643 Ga0070675_100323159
644 Ga0070675_100514346
645 Ga0070675_100696524
646 Ga0070671_100011010
647 Ga0070671_100053135
648 Ga0070671_100103271
649 Ga0070671_100123347
650 Ga0070674_100023803
651 Ga0070674_100027751
652 Ga0070673_100006681
653 Ga0070673_100011420
654 Ga0070673_100056885
655 Ga0070688_100000527
656 Ga0070688_100004107
657 Ga0070688_100180615
658 Ga0070659_100001979
659 Ga0070659_100055822
660 Ga0070667_100117461
661 Ga0070667_100339121
662 Ga0070703_10019675
663 Ga0070703_10132913
664 Ga0070709_10006236
665 Ga0070709_10226844
666 Ga0070709_10254754
667 Ga0070714_100029829
668 Ga0070714_100040726
669 Ga0070714_100135241
670 Ga0070714_100444218
671 Ga0070714_100554412
672 Ga0070714_100717164
673 Ga0070713_100050105
674 Ga0070713_100097504
675 Ga0070713_100186315
676 Ga0070713_100336530
677 Ga0070713_100591204
678 Ga0070713_100778071
679 Ga0070710_10144787
680 Ga0070710_10183763
681 Ga0070701_10256614
682 Ga0070711_100041860
683 Ga0070711_100191464
684 Ga0070705_100002522
685 Ga0070705_100080550
686 Ga0070700_100024035
687 Ga0070694_100049759
688 Ga0070708_100044641
689 Ga0070708_100046647
690 Ga0070708_100048027
691 Ga0070708_100106041
692 Ga0070708_100614572
693 Ga0070678_100001827
694 Ga0070678_100131020
695 Ga0070678_100205072
696 Ga0070662_100005048
697 Ga0070662_100024522
698 Ga0070662_100141765
699 Ga0070662_100154049
700 Ga0070662_100245639
701 Ga0070681_10016079
702 Ga0068867_100093777
703 Ga0070706_100000159
704 Ga0070706_100004210
705 Ga0070706_100015418
706 Ga0070706_100030731
707 Ga0070706_100068341
708 Ga0070706_100072804
709 Ga0070707_100000049
710 Ga0070707_100023875
711 Ga0070707_100027945
712 Ga0070707_100040134
713 Ga0070707_100120570
714 Ga0070707_100207543
715 Ga0070707_100352295
716 Ga0070707_100436071
717 Ga0070698_100005334
718 Ga0070698_100005632
719 Ga0070698_100041532
720 Ga0070698_100251333
721 Ga0070698_100307813
722 Ga0070698_100460871
723 Ga0070698_100554763
724 Ga0070699_100019360
725 Ga0070699_100023434
726 Ga0070699_100062690
727 Ga0070699_100123749
728 Ga0070699_100138505
729 Ga0070699_100284277
730 Ga0070699_100392636
731 Ga0070699_100567980
732 Ga0070679_100144435
733 Ga0070684_100000685
734 Ga0070684_100037687
735 Ga0070697_100004731
736 Ga0070697_100005805
737 Ga0070697_100011300
738 Ga0070697_100016294
739 Ga0070697_100049655
740 Ga0070697_100064997
741 Ga0070697_100066804
742 Ga0070697_100102528
743 Ga0070697_100113349
744 Ga0070697_100126665
745 Ga0070697_100134747
746 Ga0070697_100138514
747 Ga0070672_100000507
748 Ga0070672_100015220
749 Ga0070686_100054635
750 Ga0070695_100038341
751 Ga0070693_100353060
752 Ga0070665_100032657
753 Ga0070665_100054892
754 Ga0070665_100191354
755 Ga0070665_100270343
756 Ga0070704_100010067
757 Ga0070664_100014719
758 Ga0070664_100022227
759 Ga0070664_100234797
760 Ga0068856_100069852
761 Ga0068856_100105618
762 Ga0068859_100090042
763 Ga0068866_10217033
764 Ga0068861_100370725
765 Ga0068863_100020988
766 Ga0068863_100076966
767 Ga0068863_100225659
768 Ga0068863_100401513
769 Ga0068858_100005838
770 Ga0068858_100098054
771 Ga0068860_100021776
772 Ga0068860_100046597
773 Ga0068860_100136331
774 Ga0068862_100409521
775 Ga0081455_10000582
776 Ga0081455_10000643
777 Ga0081455_10016636
778 Ga0081455_10016846
779 Ga0081455_10062385
780 Ga0081455_10080469
781 Ga0081455_10100188
782 Ga0081455_10106477
783 Ga0081540_1000340
784 Ga0081540_1048116
785 Ga0081539_10000383
786 Ga0081539_10003184
787 Ga0081539_10028869
788 Ga0081539_10046735
789 Ga0081539_10052197
790 Ga0081539_10120482
791 Ga0070717_10008493
792 Ga0070717_10010257
793 Ga0070717_10092804
794 Ga0070717_10217455
795 Ga0070717_10515351
796 Ga0070716_100014161
797 Ga0070716_100014403
798 Ga0070716_100222016
799 Ga0070716_100295941
800 Ga0070712_100012407
801 Ga0070712_100087099
802 Ga0070712_100091966
803 Ga0070712_100269744
804 Ga0070712_100273145
805 Ga0075362_10000189
806 Ga0097621_100006631
807 Ga0097621_100047310
808 Ga0097621_100385567
809 Ga0068871_100005948
810 Ga0068871_100017612
811 Ga0068871_100018313
812 Ga0068871_100288729
813 Ga0075428_100521573
814 Ga0075433_10381658
815 Ga0075436_100302640
816 Ga0097620_100090039
817 Ga0099795_10123981
818 Ga0111539_10182382
819 Ga0111539_10316202
820 Ga0105245_10023920
821 Ga0105245_10086209
822 Ga0105245_10099031
823 Ga0105247_10144744
824 Ga0105247_10433188
825 Ga0114129_10002461
826 Ga0114129_10128853
827 Ga0114129_10181753
828 Ga0114129_10622050
829 Ga0105237_10103808
830 Ga0105237_10338619
831 Ga0105237_10738640
832 Ga0105249_10040660
833 Ga0105249_10104459
834 Ga0105249_10130843
835 Ga0099796_10035280
836 Ga0105239_10072107
837 Ga0105239_10203267
838 Ga0105246_10150503
839 Ga0105246_10359245
840 Ga0157369_10064726
841 Ga0157374_10121518
842 Ga0157374_10121984
843 Ga0157374_10201614
844 Ga0157374_10222957
845 Ga0157374_10354353
846 Ga0157374_10512038
847 Ga0157378_10018283
848 Ga0157378_10021223
849 Ga0157378_10034433
850 Ga0157378_10224402
851 Ga0157378_10662754
852 Ga0157378_10761288
853 Ga0163162_10002963
854 Ga0163162_10061261
855 Ga0163162_10962018
856 Ga0157372_10038275
857 Ga0157375_10002525
858 Ga0157375_10035794
859 Ga0157375_10111424
860 Ga0157375_10835978
861 Ga0157375_10939056
862 Ga0163163_10216820
863 Ga0163163_10363593
864 Ga0157377_10060667
865 Ga0157379_10017190
866 Ga0157376_10009097
867 Ga0157376_10061890
868 Ga0157376_10201371
869 Ga0157376_10461498
870 Ga0163161_10062398
871 Ga0163161_10507135
872 Ga0213872_10012499
873 Ga0213872_10022443
874 Ga0213872_10041006
875 Ga0213872_10054421
876 Ga0213872_10088303
877 Ga0213874_10022250
878 Ga0213876_10005417
879 Ga0213876_10051203
880 Ga0213876_10085164
881 Ga0213875_10049032
882 Ga0207666_1000425
883 Ga0207666_1000508
884 Ga0207673_1000242
885 Ga0207697_10000302
886 Ga0207697_10001124
887 Ga0207697_10002156
888 Ga0207697_10002407
889 Ga0207697_10003735
890 Ga0207697_10009454
891 Ga0207697_10012738
892 Ga0207697_10014558
893 Ga0207653_10003439
894 Ga0207692_10167016
895 Ga0207680_10037995
896 Ga0207680_10047724
897 Ga0207680_10053891
898 Ga0207647_10005071
899 Ga0207699_10014030
900 Ga0207699_10043651
901 Ga0207645_10003338
902 Ga0207645_10012355
903 Ga0207645_10052621
904 Ga0207684_10000208
905 Ga0207684_10000828
906 Ga0207684_10004368
907 Ga0207684_10029507
908 Ga0207684_10036238
909 Ga0207684_10077700
910 Ga0207684_10095389
911 Ga0207707_10032289
912 Ga0207693_10009411
913 Ga0207693_10022923
914 Ga0207693_10029485
915 Ga0207693_10045433
916 Ga0207693_10111130
917 Ga0207693_10254488
918 Ga0207693_10416782
919 Ga0207660_10017748
920 Ga0207662_10002073
921 Ga0207662_10026636
922 Ga0207657_10136791
923 Ga0207652_10146097
924 Ga0207646_10000115
925 Ga0207646_10000985
926 Ga0207646_10028529
927 Ga0207646_10035326
928 Ga0207646_10077114
929 Ga0207646_10093177
930 Ga0207646_10110165
931 Ga0207646_10261102
932 Ga0207646_10303474
933 Ga0207646_10513134
934 Ga0207681_10061968
935 Ga0207650_10148849
936 Ga0207659_10050753
937 Ga0207659_10068307
938 Ga0207659_10096539
939 Ga0207659_10097626
940 Ga0207659_10564189
941 Ga0207687_10041012
942 Ga0207687_10319953
943 Ga0207700_10045473
944 Ga0207700_10127943
945 Ga0207700_10170755
946 Ga0207700_10269928
947 Ga0207700_10455445
948 Ga0207664_10043906
949 Ga0207664_10125790
950 Ga0207664_10649191
951 Ga0207644_10072780
952 Ga0207644_10077687
953 Ga0207644_10145999
954 Ga0207644_10247341
955 Ga0207644_10335887
956 Ga0207690_10005356
957 Ga0207706_10065686
958 Ga0207706_10081182
959 Ga0207686_10110646
960 Ga0207670_10036781
961 Ga0207669_10090591
962 Ga0207669_10092672
963 Ga0207704_10155202
964 Ga0207665_10119227
965 Ga0207691_10001154
966 Ga0207691_10033420
967 Ga0207691_10073215
968 Ga0207691_10297240
969 Ga0207691_10343784
970 Ga0207689_10044615
971 Ga0207661_10033828
972 Ga0207661_10061617
973 Ga0207661_10155801
974 Ga0207679_10039525
975 Ga0207679_10053578
976 Ga0207651_10028610
977 Ga0207651_10038972
978 Ga0207712_10031882
979 Ga0207712_10079685
980 Ga0207712_10210593
981 Ga0207668_10009025
982 Ga0207668_10021596
983 Ga0207668_10032029
984 Ga0207668_10245287
985 Ga0207668_10461809
986 Ga0207658_10002192
987 Ga0207658_10012539
988 Ga0207658_10030781
989 Ga0207658_10053972
990 Ga0207677_10008391
991 Ga0207677_10040798
992 Ga0207677_10138425
993 Ga0207677_10338790
994 Ga0207703_10020236
995 Ga0207678_10006966
996 Ga0207678_10187740
997 Ga0207708_10022748
998 Ga0207641_10232529
999 Ga0207648_10123881
1000 Ga0207648_10349310
1001 Ga0207675_100072593
1002 Ga0207675_100092470
1003 Ga0207683_10002853
1004 Ga0207683_10014855
1005 Ga0207683_10427012
1006 Ga0209974_10021173
1007 Ga0268266_10007337
1008 Ga0268266_10088337
1009 Ga0268266_10120569
1010 Ga0268266_10244118
1011 Ga0268265_10473135
1012 Ga0268264_10031411
1013 Ga0268264_10527688
1014 Ga0265337_1026205
1015 Ga0265338_10027936
1016 Ga0265338_10184845
1017 Ga0307513_10078143
1018 Ga0373945_0019889
1019 Ga0373945_0120484
1020 Ga0373956_0094903
1021 Ga0373957_0055953
1022 Ga0373943_0022405
1023 Ga0373943_0201436
1024 Ga0373946_0088835
1025 Ga0373955_0003778
1026 Ga0373924_0017962
1027 Ga0373931_0096274
1028 Ga0373931_0202607
1029 Ga0373935_0126265
1030 Ga0373935_0265848
1031 Ga0373927_0120698
1032 Ga0373927_0192801
1033 Ga0373947_0023815
1034 Ga0373947_0135003
1035 Ga0373937_0010101
1036 Ga0373937_0023461
1037 Ga0373925_0076636
1038 Ga0373925_0091150
1039 Ga0373925_0439172
1040 Ga0395900_0016194
1041 Ga0395900_0017759
1042 Ga0395898_0041393
1043 Ga0395898_0347694
1044 Ga0395905_0062618
1045 Ga0395905_0324109
1046 Ga0436364_0892439
1047 Ga0436364_1177859
1048 Ga0436364_1402391
1049 Ga0395901_0002207
1050 Ga0395901_0045662
1051 Ga0395901_0158030
1052 Ga0395901_0399978
1053 Ga0395901_0453632
1054 Ga0436365_0893531
1055 Ga0436365_0941525
1056 Ga0436365_1279257
1057 Ga0436365_1702714
1058 Ga0436365_1804822
1059 Ga0436360_0044627
1060 Ga0436360_0109079
1061 Ga0436360_0209699
1062 Ga0436360_0539194
1063 Ga0436360_1344586
1064 Ga0436361_0103363
1065 Ga0436361_0111012
1066 Ga0436361_0271097
1067 Ga0436361_0277425
1068 Ga0436361_0583454
1069 Ga0436361_0797992
1070 Ga0436361_0873473
1071 Ga0436361_0997857
1072 Ga0436361_1202543
1073 Ga0436363_0203842
1074 Ga0436363_1006004
1075 Ga0436362_0096211
1076 Ga0436362_0266325
1077 Ga0451849_1324247
1078 Ga0439448_0100170
1079 Ga0439451_039784
1080 Ga0439464_0054568
1081 Ga0495592_0016171
1082 Ga0495651_0069517
1083 Ga0495651_0105369
1084 Ga0495580_0254901
1085 Ga0495639_0043897
1086 Ga0495664_0127843
1087 Ga0495618_0063753
1088 Ga0495628_0025329
1089 Ga0495630_0013029
1090 Ga0495630_0124641
1091 Ga0495642_0141760
1092 Ga0495652_0020853
1093 Ga0495652_0022832
1094 Ga0495665_0026500
1095 Ga0495586_0046173
1096 Ga0495587_0096391
1097 Ga0495667_0083823
1098 Ga0495634_0125498
1099 Ga0495657_0322988
1100 Ga0495599_0054529
1101 Ga0495669_0279991
1102 Ga0495613_0035379
1103 Ga0495581_0044126
1104 Ga0495674_0197445
1105 Ga0495675_0016405
1106 Ga0495675_0022257
1107 Ga0495684_0216679
1108 Ga0496100_0030661
1109 Ga0496101_0089908
1110 Ga0496101_0207237
1111 Ga0496101_0335548
1112 Ga0496102_0098528
1113 Ga0496102_0116802
1114 Ga0496102_0216602
1115 Ga0496102_0591511
1116 Ga0496103_0044216
1117 Ga0496104_0030859
1118 Ga0496104_0044475
1119 Ga0496104_0110520
1120 Ga0496104_0350158
1121 Ga0496104_0783335
1122 Ga0496105_0026072
1123 Ga0496105_0052954
1124 Ga0496105_0094231
1125 Ga0496106_0029695
1126 Ga0496106_0063335
1127 Ga0496107_0417266
1128 Ga0496108_0003070
1129 Ga0496108_0065063
1130 Ga0496109_0014337
1131 Ga0496109_0193322
1132 Ga0496109_0319797
1133 Ga0496109_0771612
1134 Ga0496110_0059151
1135 Ga0496110_0183998
1136 Ga0496111_0025912
1137 Ga0496111_0347737
1138 Ga0496112_0016046
1139 Ga0496112_0035031
1140 Ga0496112_0224616
1141 Ga0496113_0009210
1142 Ga0496113_0570349
1143 Ga0496114_0019270
1144 Ga0496114_0021555
1145 Ga0496114_0758092
1146 Ga0496115_0001242
1147 Ga0496115_0003067
1148 Ga0496115_0183635
1149 Ga0496115_0568746
1150 nmdc:mga0k408_35373_c1
1151 nmdc:mga05p37_1034_c1
1152 nmdc:mga08y16_531200_c1
1153 nmdc:mga0n895_485133_c1
1154 nmdc:mga0a205_119752_c1
1155 Ga0495601_0117226
1156 Ga0495601_0125315
1157 Ga0495619_0036438
1158 Ga0500555_000380
1159 Ga0500556_0003924
1160 Ga0500642_0003660

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mfe-assembly1.cif.gz_M crystal structure of mycobacterium tuberculosis proteasome open-gate mutant with h0 movement 0.7941 26 254
3hf9-assembly1.cif.gz_W crystal structure of mycobacterium tuberculosis proteasome open-gate mutant modified by inhibitor gl1 0.7921 26 255
3mfe-assembly1.cif.gz_M crystal structure of mycobacterium tuberculosis proteasome open-gate mutant with h0 movement 0.7867 26 254
3hf9-assembly1.cif.gz_W crystal structure of mycobacterium tuberculosis proteasome open-gate mutant modified by inhibitor gl1 0.7846 26 255
3mfe-assembly1.cif.gz_U crystal structure of mycobacterium tuberculosis proteasome open-gate mutant with h0 movement 0.778 10 256
ID Description Score Start End Superfamily
1ej9A04 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; 0.8012 164 206 1.10.132.10
3hf9W00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7921 26 255 3.60.20.10
3hf9W00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7846 26 255 3.60.20.10
3mkaM00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7508 1 257 3.60.20.10
3mkaM00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7356 1 257 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A2V5QMV2-F1-model_v4 Uncharacterized protein 0.9418 122 259
AF-A0A2V5QMV2-F1-model_v4 Uncharacterized protein 0.9289 122 259
AF-A0A2V5K6M8-F1-model_v4 Uncharacterized protein 0.885 139 257
AF-A0A2V5VCI2-F1-model_v4 Uncharacterized protein 0.8804 64 259
AF-A0A2V6GWG4-F1-model_v4 Uncharacterized protein 0.8787 185 257

Map