F465926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 580 | 238 | 1160 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10030578|Ga0081539_100305784 |
| Length | 274 |
| Sequence | VGRAHRPYPYVVRLLMIEEPYRWVEAIANRREYIEGQLAPGSPIAALGYGEGILFVTLGQTRQKLFEVYDRIAMGAIGHPGDIERLRMAAIELASTEGFTRSAADVSLRRLAHYSLSPVMKSAFEQVYGPPYLARMLFAEVGALPEDDLFLRIEYDGEIASNGATYARARQDFAVLSGTHQSVELMEAFLKNEHKPNASFETAVNSALDAWSVGHMLLQASEAKELPARDAIAQHRQEQLAIAAIEAAVLDRDSGSPIRYRSIADKELRSIITQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 187 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 188 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 189 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 238 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.86 |
| Nodule | 0 |
| Rhizoplane | 7.24 |
| Rhizosphere | 88.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081539_10030578 | 3300005985 | Unclassified | 3339 |
| 2 | JGI24743J22301_10009040 | 3300001991 | Unclassified | 1759 |
| 3 | JGI24744J21845_10024455 | 3300002077 | Unclassified | 1181 |
| 4 | JGI24035J26624_1001336 | 3300002126 | Unclassified | 2337 |
| 5 | JGI24035J26624_1001905 | 3300002126 | Bacteria | 1949 |
| 6 | JGI25406J46586_10000016 | 3300003203 | Bacteria | 91056 |
| 7 | rootL2_10040785 | 3300003322 | Bacteria | 31784 |
| 8 | JGI25405J52794_10001125 | 3300003911 | Bacteria | 4287 |
| 9 | JGI25405J52794_10001203 | 3300003911 | Bacteria | 4193 |
| 10 | JGI25405J52794_10001342 | 3300003911 | Bacteria | 4028 |
| 11 | Ga0065714_10079066 | 3300005288 | Unclassified | 2546 |
| 12 | Ga0065704_10012683 | 3300005289 | Bacteria | 2152 |
| 13 | Ga0065704_10016265 | 3300005289 | Unclassified | 3128 |
| 14 | Ga0065712_10000912 | 3300005290 | Bacteria | 7479 |
| 15 | Ga0065712_10009302 | 3300005290 | Unclassified | 4100 |
| 16 | Ga0065712_10032649 | 3300005290 | Unclassified | 1471 |
| 17 | Ga0065712_10096819 | 3300005290 | Unclassified | 2159 |
| 18 | Ga0065712_10113215 | 3300005290 | Bacteria | 1787 |
| 19 | Ga0065715_10000600 | 3300005293 | Bacteria | 17837 |
| 20 | Ga0065715_10003434 | 3300005293 | Unclassified | 4390 |
| 21 | Ga0065715_10039043 | 3300005293 | Bacteria | 1655 |
| 22 | Ga0065715_10110158 | 3300005293 | Unclassified | 2631 |
| 23 | Ga0065715_10142203 | 3300005293 | Bacteria | 1837 |
| 24 | Ga0065715_10164132 | 3300005293 | Unclassified | 1557 |
| 25 | Ga0065707_10025553 | 3300005295 | Bacteria | 1661 |
| 26 | Ga0070658_10217045 | 3300005327 | Unclassified | 1617 |
| 27 | Ga0070676_10034987 | 3300005328 | Unclassified | 2886 |
| 28 | Ga0070676_10042381 | 3300005328 | Bacteria | 2643 |
| 29 | Ga0070683_100030957 | 3300005329 | Unclassified | 4862 |
| 30 | Ga0070683_100046482 | 3300005329 | Bacteria | 4011 |
| 31 | Ga0070683_100907983 | 3300005329 | Unclassified | 845 |
| 32 | Ga0070690_100019451 | 3300005330 | Bacteria | 4121 |
| 33 | Ga0070690_100033761 | 3300005330 | Unclassified | 3204 |
| 34 | Ga0070670_100007753 | 3300005331 | Bacteria | 9132 |
| 35 | Ga0070670_100116839 | 3300005331 | Unclassified | 2300 |
| 36 | Ga0070666_10002573 | 3300005335 | Bacteria | 10963 |
| 37 | Ga0070666_10062640 | 3300005335 | Unclassified | 2520 |
| 38 | Ga0070666_10101079 | 3300005335 | Bacteria | 1987 |
| 39 | Ga0070666_10164190 | 3300005335 | Unclassified | 1553 |
| 40 | Ga0070680_100090978 | 3300005336 | Unclassified | 2526 |
| 41 | Ga0070682_100040964 | 3300005337 | Unclassified | 2853 |
| 42 | Ga0068868_100045918 | 3300005338 | Bacteria | 3419 |
| 43 | Ga0068868_100063376 | 3300005338 | Unclassified | 2932 |
| 44 | Ga0070660_100110171 | 3300005339 | Bacteria | 2189 |
| 45 | Ga0070689_100003689 | 3300005340 | Bacteria | 10227 |
| 46 | Ga0070689_100008475 | 3300005340 | Bacteria | 7243 |
| 47 | Ga0070689_100043981 | 3300005340 | Bacteria | 3435 |
| 48 | Ga0070689_100593013 | 3300005340 | Unclassified | 959 |
| 49 | Ga0070687_100005822 | 3300005343 | Bacteria | 5012 |
| 50 | Ga0070687_100087234 | 3300005343 | Bacteria | 1717 |
| 51 | Ga0070661_100073698 | 3300005344 | Unclassified | 2513 |
| 52 | Ga0070668_100013088 | 3300005347 | Bacteria | 6181 |
| 53 | Ga0070668_100087581 | 3300005347 | Bacteria | 2450 |
| 54 | Ga0070668_100099625 | 3300005347 | Unclassified | 2301 |
| 55 | Ga0070668_100379736 | 3300005347 | Bacteria | 1202 |
| 56 | Ga0070668_100700628 | 3300005347 | Unclassified | 893 |
| 57 | Ga0070669_100001125 | 3300005353 | Bacteria | 19527 |
| 58 | Ga0070669_100175566 | 3300005353 | Bacteria | 1673 |
| 59 | Ga0070675_100011335 | 3300005354 | Bacteria | 6978 |
| 60 | Ga0070675_100013934 | 3300005354 | Bacteria | 6328 |
| 61 | Ga0070675_100077577 | 3300005354 | Bacteria | 2765 |
| 62 | Ga0070675_100105982 | 3300005354 | Unclassified | 2372 |
| 63 | Ga0070675_100323159 | 3300005354 | Bacteria | 1363 |
| 64 | Ga0070675_100514346 | 3300005354 | Unclassified | 1080 |
| 65 | Ga0070675_100696524 | 3300005354 | Bacteria | 925 |
| 66 | Ga0070671_100011010 | 3300005355 | Bacteria | 7258 |
| 67 | Ga0070671_100053135 | 3300005355 | Bacteria | 3368 |
| 68 | Ga0070671_100103271 | 3300005355 | Unclassified | 2391 |
| 69 | Ga0070671_100123347 | 3300005355 | Unclassified | 2181 |
| 70 | Ga0070674_100023803 | 3300005356 | Bacteria | 3969 |
| 71 | Ga0070674_100027751 | 3300005356 | Unclassified | 3712 |
| 72 | Ga0070673_100006681 | 3300005364 | Bacteria | 7519 |
| 73 | Ga0070673_100011420 | 3300005364 | Bacteria | 6058 |
| 74 | Ga0070673_100056885 | 3300005364 | Unclassified | 3088 |
| 75 | Ga0070688_100000527 | 3300005365 | Bacteria | 19316 |
| 76 | Ga0070688_100004107 | 3300005365 | Bacteria | 7556 |
| 77 | Ga0070688_100180615 | 3300005365 | Unclassified | 1463 |
| 78 | Ga0070659_100001979 | 3300005366 | Bacteria | 14637 |
| 79 | Ga0070659_100055822 | 3300005366 | Bacteria | 3114 |
| 80 | Ga0070667_100117461 | 3300005367 | Bacteria | 2311 |
| 81 | Ga0070667_100339121 | 3300005367 | Bacteria | 1359 |
| 82 | Ga0070703_10019675 | 3300005406 | Bacteria | 1959 |
| 83 | Ga0070703_10132913 | 3300005406 | Unclassified | 916 |
| 84 | Ga0070709_10006236 | 3300005434 | Bacteria | 6489 |
| 85 | Ga0070709_10226844 | 3300005434 | Unclassified | 1335 |
| 86 | Ga0070709_10254754 | 3300005434 | Unclassified | 1266 |
| 87 | Ga0070714_100029829 | 3300005435 | Bacteria | 4537 |
| 88 | Ga0070714_100040726 | 3300005435 | Bacteria | 3917 |
| 89 | Ga0070714_100135241 | 3300005435 | Bacteria | 2207 |
| 90 | Ga0070714_100444218 | 3300005435 | Unclassified | 1231 |
| 91 | Ga0070714_100554412 | 3300005435 | Bacteria | 1100 |
| 92 | Ga0070714_100717164 | 3300005435 | Bacteria | 965 |
| 93 | Ga0070713_100050105 | 3300005436 | Bacteria | 3448 |
| 94 | Ga0070713_100097504 | 3300005436 | Bacteria | 2540 |
| 95 | Ga0070713_100186315 | 3300005436 | Bacteria | 1868 |
| 96 | Ga0070713_100336530 | 3300005436 | Unclassified | 1397 |
| 97 | Ga0070713_100591204 | 3300005436 | Bacteria | 1054 |
| 98 | Ga0070713_100778071 | 3300005436 | Bacteria | 917 |
| 99 | Ga0070710_10144787 | 3300005437 | Unclassified | 1460 |
| 100 | Ga0070710_10183763 | 3300005437 | Unclassified | 1311 |
| 101 | Ga0070701_10256614 | 3300005438 | Unclassified | 1058 |
| 102 | Ga0070711_100041860 | 3300005439 | Bacteria | 3095 |
| 103 | Ga0070711_100191464 | 3300005439 | Bacteria | 1572 |
| 104 | Ga0070705_100002522 | 3300005440 | Bacteria | 9204 |
| 105 | Ga0070705_100080550 | 3300005440 | Bacteria | 1998 |
| 106 | Ga0070700_100024035 | 3300005441 | Bacteria | 3573 |
| 107 | Ga0070694_100049759 | 3300005444 | Bacteria | 2823 |
| 108 | Ga0070708_100044641 | 3300005445 | Unclassified | 3899 |
| 109 | Ga0070708_100046647 | 3300005445 | Bacteria | 3823 |
| 110 | Ga0070708_100048027 | 3300005445 | Bacteria | 3772 |
| 111 | Ga0070708_100106041 | 3300005445 | Unclassified | 2579 |
| 112 | Ga0070708_100614572 | 3300005445 | Unclassified | 1025 |
| 113 | Ga0070678_100001827 | 3300005456 | Bacteria | 11474 |
| 114 | Ga0070678_100131020 | 3300005456 | Bacteria | 1992 |
| 115 | Ga0070678_100205072 | 3300005456 | Bacteria | 1630 |
| 116 | Ga0070662_100005048 | 3300005457 | Bacteria | 8400 |
| 117 | Ga0070662_100024522 | 3300005457 | Bacteria | 4157 |
| 118 | Ga0070662_100141765 | 3300005457 | Bacteria | 1863 |
| 119 | Ga0070662_100154049 | 3300005457 | Unclassified | 1792 |
| 120 | Ga0070662_100245639 | 3300005457 | Bacteria | 1437 |
| 121 | Ga0070681_10016079 | 3300005458 | Bacteria | 7458 |
| 122 | Ga0068867_100093777 | 3300005459 | Bacteria | 2282 |
| 123 | Ga0070706_100000159 | 3300005467 | Bacteria | 86016 |
| 124 | Ga0070706_100004210 | 3300005467 | Bacteria | 13971 |
| 125 | Ga0070706_100015418 | 3300005467 | Bacteria | 7059 |
| 126 | Ga0070706_100030731 | 3300005467 | Unclassified | 4950 |
| 127 | Ga0070706_100068341 | 3300005467 | Bacteria | 3285 |
| 128 | Ga0070706_100072804 | 3300005467 | Bacteria | 3180 |
| 129 | Ga0070707_100000049 | 3300005468 | Bacteria | 102972 |
| 130 | Ga0070707_100023875 | 3300005468 | Bacteria | 5784 |
| 131 | Ga0070707_100027945 | 3300005468 | Bacteria | 5366 |
| 132 | Ga0070707_100040134 | 3300005468 | Unclassified | 4477 |
| 133 | Ga0070707_100120570 | 3300005468 | Bacteria | 2546 |
| 134 | Ga0070707_100207543 | 3300005468 | Bacteria | 1909 |
| 135 | Ga0070707_100352295 | 3300005468 | Unclassified | 1430 |
| 136 | Ga0070707_100436071 | 3300005468 | Bacteria | 1271 |
| 137 | Ga0070698_100005334 | 3300005471 | Bacteria | 14070 |
| 138 | Ga0070698_100005632 | 3300005471 | Bacteria | 13706 |
| 139 | Ga0070698_100041532 | 3300005471 | Unclassified | 4721 |
| 140 | Ga0070698_100251333 | 3300005471 | Bacteria | 1701 |
| 141 | Ga0070698_100307813 | 3300005471 | Unclassified | 1515 |
| 142 | Ga0070698_100460871 | 3300005471 | Unclassified | 1207 |
| 143 | Ga0070698_100554763 | 3300005471 | Bacteria | 1088 |
| 144 | Ga0070699_100019360 | 3300005518 | Bacteria | 5859 |
| 145 | Ga0070699_100023434 | 3300005518 | Bacteria | 5318 |
| 146 | Ga0070699_100062690 | 3300005518 | Bacteria | 3223 |
| 147 | Ga0070699_100123749 | 3300005518 | Bacteria | 2276 |
| 148 | Ga0070699_100138505 | 3300005518 | Bacteria | 2147 |
| 149 | Ga0070699_100284277 | 3300005518 | Bacteria | 1482 |
| 150 | Ga0070699_100392636 | 3300005518 | Bacteria | 1254 |
| 151 | Ga0070699_100567980 | 3300005518 | Unclassified | 1033 |
| 152 | Ga0070679_100144435 | 3300005530 | Unclassified | 2357 |
| 153 | Ga0070684_100000685 | 3300005535 | Bacteria | 23382 |
| 154 | Ga0070684_100037687 | 3300005535 | Unclassified | 4149 |
| 155 | Ga0070697_100004731 | 3300005536 | Bacteria | 10431 |
| 156 | Ga0070697_100005805 | 3300005536 | Bacteria | 9521 |
| 157 | Ga0070697_100011300 | 3300005536 | Bacteria | 6975 |
| 158 | Ga0070697_100016294 | 3300005536 | Bacteria | 5845 |
| 159 | Ga0070697_100049655 | 3300005536 | Unclassified | 3405 |
| 160 | Ga0070697_100064997 | 3300005536 | Bacteria | 2980 |
| 161 | Ga0070697_100066804 | 3300005536 | Unclassified | 2940 |
| 162 | Ga0070697_100102528 | 3300005536 | Bacteria | 2378 |
| 163 | Ga0070697_100113349 | 3300005536 | Bacteria | 2262 |
| 164 | Ga0070697_100126665 | 3300005536 | Bacteria | 2140 |
| 165 | Ga0070697_100134747 | 3300005536 | Bacteria | 2073 |
| 166 | Ga0070697_100138514 | 3300005536 | Unclassified | 2045 |
| 167 | Ga0070672_100000507 | 3300005543 | Bacteria | 22759 |
| 168 | Ga0070672_100015220 | 3300005543 | Bacteria | 5470 |
| 169 | Ga0070686_100054635 | 3300005544 | Unclassified | 2555 |
| 170 | Ga0070695_100038341 | 3300005545 | Unclassified | 3023 |
| 171 | Ga0070693_100353060 | 3300005547 | Bacteria | 1007 |
| 172 | Ga0070665_100032657 | 3300005548 | Bacteria | 5238 |
| 173 | Ga0070665_100054892 | 3300005548 | Unclassified | 3995 |
| 174 | Ga0070665_100191354 | 3300005548 | Bacteria | 2047 |
| 175 | Ga0070665_100270343 | 3300005548 | Unclassified | 1701 |
| 176 | Ga0070704_100010067 | 3300005549 | Bacteria | 5745 |
| 177 | Ga0070664_100014719 | 3300005564 | Bacteria | 6388 |
| 178 | Ga0070664_100022227 | 3300005564 | Bacteria | 5231 |
| 179 | Ga0070664_100234797 | 3300005564 | Unclassified | 1645 |
| 180 | Ga0068856_100069852 | 3300005614 | Unclassified | 3473 |
| 181 | Ga0068856_100105618 | 3300005614 | Bacteria | 2810 |
| 182 | Ga0068859_100090042 | 3300005617 | Bacteria | 3119 |
| 183 | Ga0068866_10217033 | 3300005718 | Unclassified | 1152 |
| 184 | Ga0068861_100370725 | 3300005719 | Bacteria | 1262 |
| 185 | Ga0068863_100020988 | 3300005841 | Bacteria | 6238 |
| 186 | Ga0068863_100076966 | 3300005841 | Bacteria | 3156 |
| 187 | Ga0068863_100225659 | 3300005841 | Bacteria | 1806 |
| 188 | Ga0068863_100401513 | 3300005841 | Bacteria | 1341 |
| 189 | Ga0068858_100005838 | 3300005842 | Bacteria | 12025 |
| 190 | Ga0068858_100098054 | 3300005842 | Unclassified | 2733 |
| 191 | Ga0068860_100021776 | 3300005843 | Bacteria | 6202 |
| 192 | Ga0068860_100046597 | 3300005843 | Unclassified | 4133 |
| 193 | Ga0068860_100136331 | 3300005843 | Bacteria | 2357 |
| 194 | Ga0068862_100409521 | 3300005844 | Unclassified | 1270 |
| 195 | Ga0081455_10000582 | 3300005937 | Bacteria | 47687 |
| 196 | Ga0081455_10000643 | 3300005937 | Bacteria | 45230 |
| 197 | Ga0081455_10016636 | 3300005937 | Bacteria | 7091 |
| 198 | Ga0081455_10016846 | 3300005937 | Bacteria | 7028 |
| 199 | Ga0081455_10062385 | 3300005937 | Unclassified | 3133 |
| 200 | Ga0081455_10080469 | 3300005937 | Unclassified | 2671 |
| 201 | Ga0081455_10100188 | 3300005937 | Bacteria | 2328 |
| 202 | Ga0081455_10106477 | 3300005937 | Unclassified | 2238 |
| 203 | Ga0081540_1000340 | 3300005983 | Bacteria | 47909 |
| 204 | Ga0081540_1048116 | 3300005983 | Bacteria | 2138 |
| 205 | Ga0081539_10000383 | 3300005985 | Bacteria | 95995 |
| 206 | Ga0081539_10003184 | 3300005985 | Bacteria | 20777 |
| 207 | Ga0081539_10028869 | 3300005985 | Bacteria | 3481 |
| 208 | Ga0081539_10046735 | 3300005985 | Archaea | 2478 |
| 209 | Ga0081539_10052197 | 3300005985 | Unclassified | 2298 |
| 210 | Ga0081539_10120482 | 3300005985 | Bacteria | 1304 |
| 211 | Ga0070717_10008493 | 3300006028 | Bacteria | 7671 |
| 212 | Ga0070717_10010257 | 3300006028 | Bacteria | 7060 |
| 213 | Ga0070717_10092804 | 3300006028 | Bacteria | 2551 |
| 214 | Ga0070717_10217455 | 3300006028 | Bacteria | 1678 |
| 215 | Ga0070717_10515351 | 3300006028 | Bacteria | 1082 |
| 216 | Ga0070716_100014161 | 3300006173 | Bacteria | 4082 |
| 217 | Ga0070716_100014403 | 3300006173 | Unclassified | 4049 |
| 218 | Ga0070716_100222016 | 3300006173 | Unclassified | 1270 |
| 219 | Ga0070716_100295941 | 3300006173 | Unclassified | 1123 |
| 220 | Ga0070712_100012407 | 3300006175 | Bacteria | 5416 |
| 221 | Ga0070712_100087099 | 3300006175 | Bacteria | 2278 |
| 222 | Ga0070712_100091966 | 3300006175 | Bacteria | 2224 |
| 223 | Ga0070712_100269744 | 3300006175 | Bacteria | 1367 |
| 224 | Ga0070712_100273145 | 3300006175 | Unclassified | 1359 |
| 225 | Ga0075362_10000189 | 3300006177 | Bacteria | 17083 |
| 226 | Ga0097621_100006631 | 3300006237 | Bacteria | 8227 |
| 227 | Ga0097621_100047310 | 3300006237 | Unclassified | 3485 |
| 228 | Ga0097621_100385567 | 3300006237 | Unclassified | 1252 |
| 229 | Ga0068871_100005948 | 3300006358 | Bacteria | 8587 |
| 230 | Ga0068871_100017612 | 3300006358 | Bacteria | 5410 |
| 231 | Ga0068871_100018313 | 3300006358 | Bacteria | 5320 |
| 232 | Ga0068871_100288729 | 3300006358 | Bacteria | 1437 |
| 233 | Ga0075428_100521573 | 3300006844 | Unclassified | 1271 |
| 234 | Ga0075433_10381658 | 3300006852 | Unclassified | 1244 |
| 235 | Ga0075436_100302640 | 3300006914 | Unclassified | 1146 |
| 236 | Ga0097620_100090039 | 3300006931 | Bacteria | 3119 |
| 237 | Ga0099795_10123981 | 3300007788 | Unclassified | 1036 |
| 238 | Ga0111539_10182382 | 3300009094 | Bacteria | 2451 |
| 239 | Ga0111539_10316202 | 3300009094 | Bacteria | 1817 |
| 240 | Ga0105245_10023920 | 3300009098 | Bacteria | 5362 |
| 241 | Ga0105245_10086209 | 3300009098 | Unclassified | 2880 |
| 242 | Ga0105245_10099031 | 3300009098 | Unclassified | 2694 |
| 243 | Ga0105247_10144744 | 3300009101 | Unclassified | 1561 |
| 244 | Ga0105247_10433188 | 3300009101 | Unclassified | 944 |
| 245 | Ga0114129_10002461 | 3300009147 | Bacteria | 25709 |
| 246 | Ga0114129_10128853 | 3300009147 | Bacteria | 3477 |
| 247 | Ga0114129_10181753 | 3300009147 | Bacteria | 2861 |
| 248 | Ga0114129_10622050 | 3300009147 | Unclassified | 1397 |
| 249 | Ga0105237_10103808 | 3300009545 | Bacteria | 2835 |
| 250 | Ga0105237_10338619 | 3300009545 | Unclassified | 1509 |
| 251 | Ga0105237_10738640 | 3300009545 | Unclassified | 991 |
| 252 | Ga0105249_10040660 | 3300009553 | Unclassified | 4224 |
| 253 | Ga0105249_10104459 | 3300009553 | Bacteria | 2670 |
| 254 | Ga0105249_10130843 | 3300009553 | Bacteria | 2396 |
| 255 | Ga0099796_10035280 | 3300010159 | Unclassified | 1658 |
| 256 | Ga0105239_10072107 | 3300010375 | Unclassified | 3796 |
| 257 | Ga0105239_10203267 | 3300010375 | Bacteria | 2220 |
| 258 | Ga0105246_10150503 | 3300011119 | Bacteria | 1761 |
| 259 | Ga0105246_10359245 | 3300011119 | Unclassified | 1196 |
| 260 | Ga0157369_10064726 | 3300013105 | Unclassified | 3937 |
| 261 | Ga0157374_10121518 | 3300013296 | Unclassified | 2521 |
| 262 | Ga0157374_10121984 | 3300013296 | Unclassified | 2516 |
| 263 | Ga0157374_10201614 | 3300013296 | Bacteria | 1948 |
| 264 | Ga0157374_10222957 | 3300013296 | Unclassified | 1850 |
| 265 | Ga0157374_10354353 | 3300013296 | Bacteria | 1458 |
| 266 | Ga0157374_10512038 | 3300013296 | Bacteria | 1205 |
| 267 | Ga0157378_10018283 | 3300013297 | Bacteria | 6153 |
| 268 | Ga0157378_10021223 | 3300013297 | Bacteria | 5712 |
| 269 | Ga0157378_10034433 | 3300013297 | Bacteria | 4479 |
| 270 | Ga0157378_10224402 | 3300013297 | Bacteria | 1787 |
| 271 | Ga0157378_10662754 | 3300013297 | Unclassified | 1060 |
| 272 | Ga0157378_10761288 | 3300013297 | Bacteria | 992 |
| 273 | Ga0163162_10002963 | 3300013306 | Bacteria | 16201 |
| 274 | Ga0163162_10061261 | 3300013306 | Bacteria | 3800 |
| 275 | Ga0163162_10962018 | 3300013306 | Unclassified | 964 |
| 276 | Ga0157372_10038275 | 3300013307 | Bacteria | 5292 |
| 277 | Ga0157375_10002525 | 3300013308 | Bacteria | 15888 |
| 278 | Ga0157375_10035794 | 3300013308 | Unclassified | 4743 |
| 279 | Ga0157375_10111424 | 3300013308 | Unclassified | 2835 |
| 280 | Ga0157375_10835978 | 3300013308 | Unclassified | 1068 |
| 281 | Ga0157375_10939056 | 3300013308 | Unclassified | 1007 |
| 282 | Ga0163163_10216820 | 3300014325 | Unclassified | 1963 |
| 283 | Ga0163163_10363593 | 3300014325 | Unclassified | 1504 |
| 284 | Ga0157377_10060667 | 3300014745 | Bacteria | 2160 |
| 285 | Ga0157379_10017190 | 3300014968 | Bacteria | 6371 |
| 286 | Ga0157376_10009097 | 3300014969 | Bacteria | 7198 |
| 287 | Ga0157376_10061890 | 3300014969 | Unclassified | 3148 |
| 288 | Ga0157376_10201371 | 3300014969 | Bacteria | 1832 |
| 289 | Ga0157376_10461498 | 3300014969 | Unclassified | 1241 |
| 290 | Ga0163161_10062398 | 3300017792 | Bacteria | 2715 |
| 291 | Ga0163161_10507135 | 3300017792 | Unclassified | 983 |
| 292 | Ga0213872_10012499 | 3300021361 | Bacteria | 3992 |
| 293 | Ga0213872_10022443 | 3300021361 | Bacteria | 2906 |
| 294 | Ga0213872_10041006 | 3300021361 | Bacteria | 2113 |
| 295 | Ga0213872_10054421 | 3300021361 | Bacteria | 1815 |
| 296 | Ga0213872_10088303 | 3300021361 | Bacteria | 1388 |
| 297 | Ga0213874_10022250 | 3300021377 | Bacteria | 1757 |
| 298 | Ga0213876_10005417 | 3300021384 | Bacteria | 7023 |
| 299 | Ga0213876_10051203 | 3300021384 | Bacteria | 2182 |
| 300 | Ga0213876_10085164 | 3300021384 | Unclassified | 1672 |
| 301 | Ga0213875_10049032 | 3300021388 | Bacteria | 1980 |
| 302 | Ga0207666_1000425 | 3300025271 | Bacteria | 5490 |
| 303 | Ga0207666_1000508 | 3300025271 | Bacteria | 4771 |
| 304 | Ga0207673_1000242 | 3300025290 | Bacteria | 5558 |
| 305 | Ga0207697_10000302 | 3300025315 | Bacteria | 27561 |
| 306 | Ga0207697_10001124 | 3300025315 | Bacteria | 14733 |
| 307 | Ga0207697_10002156 | 3300025315 | Bacteria | 10313 |
| 308 | Ga0207697_10002407 | 3300025315 | Bacteria | 9753 |
| 309 | Ga0207697_10003735 | 3300025315 | Bacteria | 7447 |
| 310 | Ga0207697_10009454 | 3300025315 | Unclassified | 4211 |
| 311 | Ga0207697_10012738 | 3300025315 | Unclassified | 3520 |
| 312 | Ga0207697_10014558 | 3300025315 | Bacteria | 3261 |
| 313 | Ga0207653_10003439 | 3300025885 | Bacteria | 4989 |
| 314 | Ga0207692_10167016 | 3300025898 | Unclassified | 1273 |
| 315 | Ga0207680_10037995 | 3300025903 | Bacteria | 2784 |
| 316 | Ga0207680_10047724 | 3300025903 | Unclassified | 2539 |
| 317 | Ga0207680_10053891 | 3300025903 | Unclassified | 2417 |
| 318 | Ga0207647_10005071 | 3300025904 | Bacteria | 9713 |
| 319 | Ga0207699_10014030 | 3300025906 | Unclassified | 4119 |
| 320 | Ga0207699_10043651 | 3300025906 | Unclassified | 2606 |
| 321 | Ga0207645_10003338 | 3300025907 | Bacteria | 12235 |
| 322 | Ga0207645_10012355 | 3300025907 | Bacteria | 5796 |
| 323 | Ga0207645_10052621 | 3300025907 | Unclassified | 2602 |
| 324 | Ga0207684_10000208 | 3300025910 | Bacteria | 91185 |
| 325 | Ga0207684_10000828 | 3300025910 | Bacteria | 35600 |
| 326 | Ga0207684_10004368 | 3300025910 | Bacteria | 13357 |
| 327 | Ga0207684_10029507 | 3300025910 | Bacteria | 4670 |
| 328 | Ga0207684_10036238 | 3300025910 | Bacteria | 4188 |
| 329 | Ga0207684_10077700 | 3300025910 | Bacteria | 2823 |
| 330 | Ga0207684_10095389 | 3300025910 | Bacteria | 2538 |
| 331 | Ga0207707_10032289 | 3300025912 | Unclassified | 4582 |
| 332 | Ga0207693_10009411 | 3300025915 | Bacteria | 7969 |
| 333 | Ga0207693_10022923 | 3300025915 | Bacteria | 4958 |
| 334 | Ga0207693_10029485 | 3300025915 | Unclassified | 4334 |
| 335 | Ga0207693_10045433 | 3300025915 | Bacteria | 3451 |
| 336 | Ga0207693_10111130 | 3300025915 | Unclassified | 2149 |
| 337 | Ga0207693_10254488 | 3300025915 | Bacteria | 1378 |
| 338 | Ga0207693_10416782 | 3300025915 | Unclassified | 1050 |
| 339 | Ga0207660_10017748 | 3300025917 | Unclassified | 4734 |
| 340 | Ga0207662_10002073 | 3300025918 | Bacteria | 9942 |
| 341 | Ga0207662_10026636 | 3300025918 | Bacteria | 3335 |
| 342 | Ga0207657_10136791 | 3300025919 | Bacteria | 2004 |
| 343 | Ga0207652_10146097 | 3300025921 | Unclassified | 2117 |
| 344 | Ga0207646_10000115 | 3300025922 | Bacteria | 110424 |
| 345 | Ga0207646_10000985 | 3300025922 | Bacteria | 36586 |
| 346 | Ga0207646_10028529 | 3300025922 | Bacteria | 5079 |
| 347 | Ga0207646_10035326 | 3300025922 | Unclassified | 4514 |
| 348 | Ga0207646_10077114 | 3300025922 | Bacteria | 2979 |
| 349 | Ga0207646_10093177 | 3300025922 | Unclassified | 2697 |
| 350 | Ga0207646_10110165 | 3300025922 | Bacteria | 2471 |
| 351 | Ga0207646_10261102 | 3300025922 | Unclassified | 1565 |
| 352 | Ga0207646_10303474 | 3300025922 | Bacteria | 1442 |
| 353 | Ga0207646_10513134 | 3300025922 | Bacteria | 1079 |
| 354 | Ga0207681_10061968 | 3300025923 | Bacteria | 2573 |
| 355 | Ga0207650_10148849 | 3300025925 | Bacteria | 1846 |
| 356 | Ga0207659_10050753 | 3300025926 | Bacteria | 2948 |
| 357 | Ga0207659_10068307 | 3300025926 | Bacteria | 2584 |
| 358 | Ga0207659_10096539 | 3300025926 | Bacteria | 2219 |
| 359 | Ga0207659_10097626 | 3300025926 | Bacteria | 2207 |
| 360 | Ga0207659_10564189 | 3300025926 | Bacteria | 969 |
| 361 | Ga0207687_10041012 | 3300025927 | Bacteria | 3176 |
| 362 | Ga0207687_10319953 | 3300025927 | Unclassified | 1255 |
| 363 | Ga0207700_10045473 | 3300025928 | Bacteria | 3240 |
| 364 | Ga0207700_10127943 | 3300025928 | Bacteria | 2069 |
| 365 | Ga0207700_10170755 | 3300025928 | Bacteria | 1814 |
| 366 | Ga0207700_10269928 | 3300025928 | Bacteria | 1460 |
| 367 | Ga0207700_10455445 | 3300025928 | Bacteria | 1128 |
| 368 | Ga0207664_10043906 | 3300025929 | Bacteria | 3498 |
| 369 | Ga0207664_10125790 | 3300025929 | Bacteria | 2152 |
| 370 | Ga0207664_10649191 | 3300025929 | Unclassified | 948 |
| 371 | Ga0207644_10072780 | 3300025931 | Bacteria | 2518 |
| 372 | Ga0207644_10077687 | 3300025931 | Unclassified | 2445 |
| 373 | Ga0207644_10145999 | 3300025931 | Bacteria | 1826 |
| 374 | Ga0207644_10247341 | 3300025931 | Bacteria | 1422 |
| 375 | Ga0207644_10335887 | 3300025931 | Unclassified | 1224 |
| 376 | Ga0207690_10005356 | 3300025932 | Bacteria | 7560 |
| 377 | Ga0207706_10065686 | 3300025933 | Bacteria | 3194 |
| 378 | Ga0207706_10081182 | 3300025933 | Bacteria | 2850 |
| 379 | Ga0207686_10110646 | 3300025934 | Bacteria | 1852 |
| 380 | Ga0207670_10036781 | 3300025936 | Bacteria | 3186 |
| 381 | Ga0207669_10090591 | 3300025937 | Bacteria | 1989 |
| 382 | Ga0207669_10092672 | 3300025937 | Unclassified | 1972 |
| 383 | Ga0207704_10155202 | 3300025938 | Bacteria | 1621 |
| 384 | Ga0207665_10119227 | 3300025939 | Bacteria | 1862 |
| 385 | Ga0207691_10001154 | 3300025940 | Bacteria | 26239 |
| 386 | Ga0207691_10033420 | 3300025940 | Unclassified | 4788 |
| 387 | Ga0207691_10073215 | 3300025940 | Unclassified | 3090 |
| 388 | Ga0207691_10297240 | 3300025940 | Bacteria | 1388 |
| 389 | Ga0207691_10343784 | 3300025940 | Unclassified | 1277 |
| 390 | Ga0207689_10044615 | 3300025942 | Unclassified | 3666 |
| 391 | Ga0207661_10033828 | 3300025944 | Bacteria | 3970 |
| 392 | Ga0207661_10061617 | 3300025944 | Bacteria | 3031 |
| 393 | Ga0207661_10155801 | 3300025944 | Unclassified | 1978 |
| 394 | Ga0207679_10039525 | 3300025945 | Unclassified | 3369 |
| 395 | Ga0207679_10053578 | 3300025945 | Bacteria | 2966 |
| 396 | Ga0207651_10028610 | 3300025960 | Unclassified | 3518 |
| 397 | Ga0207651_10038972 | 3300025960 | Unclassified | 3128 |
| 398 | Ga0207712_10031882 | 3300025961 | Bacteria | 3553 |
| 399 | Ga0207712_10079685 | 3300025961 | Unclassified | 2380 |
| 400 | Ga0207712_10210593 | 3300025961 | Unclassified | 1548 |
| 401 | Ga0207668_10009025 | 3300025972 | Bacteria | 5958 |
| 402 | Ga0207668_10021596 | 3300025972 | Bacteria | 4107 |
| 403 | Ga0207668_10032029 | 3300025972 | Unclassified | 3470 |
| 404 | Ga0207668_10245287 | 3300025972 | Bacteria | 1452 |
| 405 | Ga0207668_10461809 | 3300025972 | Bacteria | 1086 |
| 406 | Ga0207658_10002192 | 3300025986 | Bacteria | 14501 |
| 407 | Ga0207658_10012539 | 3300025986 | Bacteria | 5788 |
| 408 | Ga0207658_10030781 | 3300025986 | Bacteria | 3804 |
| 409 | Ga0207658_10053972 | 3300025986 | Bacteria | 2972 |
| 410 | Ga0207677_10008391 | 3300026023 | Bacteria | 5765 |
| 411 | Ga0207677_10040798 | 3300026023 | Bacteria | 3063 |
| 412 | Ga0207677_10138425 | 3300026023 | Unclassified | 1860 |
| 413 | Ga0207677_10338790 | 3300026023 | Bacteria | 1256 |
| 414 | Ga0207703_10020236 | 3300026035 | Bacteria | 5204 |
| 415 | Ga0207678_10006966 | 3300026067 | Bacteria | 10034 |
| 416 | Ga0207678_10187740 | 3300026067 | Unclassified | 1766 |
| 417 | Ga0207708_10022748 | 3300026075 | Bacteria | 4734 |
| 418 | Ga0207641_10232529 | 3300026088 | Bacteria | 1714 |
| 419 | Ga0207648_10123881 | 3300026089 | Unclassified | 2273 |
| 420 | Ga0207648_10349310 | 3300026089 | Bacteria | 1333 |
| 421 | Ga0207675_100072593 | 3300026118 | Unclassified | 3219 |
| 422 | Ga0207675_100092470 | 3300026118 | Bacteria | 2845 |
| 423 | Ga0207683_10002853 | 3300026121 | Bacteria | 15067 |
| 424 | Ga0207683_10014855 | 3300026121 | Bacteria | 6630 |
| 425 | Ga0207683_10427012 | 3300026121 | Unclassified | 1221 |
| 426 | Ga0209974_10021173 | 3300027876 | Bacteria | 2153 |
| 427 | Ga0268266_10007337 | 3300028379 | Bacteria | 9960 |
| 428 | Ga0268266_10088337 | 3300028379 | Unclassified | 2712 |
| 429 | Ga0268266_10120569 | 3300028379 | Unclassified | 2333 |
| 430 | Ga0268266_10244118 | 3300028379 | Unclassified | 1658 |
| 431 | Ga0268265_10473135 | 3300028380 | Unclassified | 1175 |
| 432 | Ga0268264_10031411 | 3300028381 | Bacteria | 4355 |
| 433 | Ga0268264_10527688 | 3300028381 | Bacteria | 1155 |
| 434 | Ga0265337_1026205 | 3300028556 | Unclassified | 1769 |
| 435 | Ga0265338_10027936 | 3300028800 | Bacteria | 5645 |
| 436 | Ga0265338_10184845 | 3300028800 | Unclassified | 1585 |
| 437 | Ga0307513_10078143 | 3300031456 | Unclassified | 3424 |
| 438 | Ga0373945_0019889 | 3300035116 | Bacteria | 2295 |
| 439 | Ga0373945_0120484 | 3300035116 | Unclassified | 1043 |
| 440 | Ga0373956_0094903 | 3300035119 | Unclassified | 1379 |
| 441 | Ga0373957_0055953 | 3300035120 | Bacteria | 1518 |
| 442 | Ga0373943_0022405 | 3300035170 | Bacteria | 2927 |
| 443 | Ga0373943_0201436 | 3300035170 | Bacteria | 1102 |
| 444 | Ga0373946_0088835 | 3300035171 | Unclassified | 1366 |
| 445 | Ga0373955_0003778 | 3300035172 | Bacteria | 6672 |
| 446 | Ga0373924_0017962 | 3300035410 | Unclassified | 2721 |
| 447 | Ga0373931_0096274 | 3300035691 | Unclassified | 1658 |
| 448 | Ga0373931_0202607 | 3300035691 | Unclassified | 1186 |
| 449 | Ga0373935_0126265 | 3300035692 | Unclassified | 1714 |
| 450 | Ga0373935_0265848 | 3300035692 | Bacteria | 1204 |
| 451 | Ga0373927_0120698 | 3300035695 | Bacteria | 1711 |
| 452 | Ga0373927_0192801 | 3300035695 | Unclassified | 1337 |
| 453 | Ga0373947_0023815 | 3300035725 | Bacteria | 3564 |
| 454 | Ga0373947_0135003 | 3300035725 | Bacteria | 1578 |
| 455 | Ga0373937_0010101 | 3300036401 | Bacteria | 8232 |
| 456 | Ga0373937_0023461 | 3300036401 | Bacteria | 5555 |
| 457 | Ga0373925_0076636 | 3300037068 | Unclassified | 2536 |
| 458 | Ga0373925_0091150 | 3300037068 | Unclassified | 2331 |
| 459 | Ga0373925_0439172 | 3300037068 | Unclassified | 1068 |
| 460 | Ga0395900_0016194 | 3300037418 | Bacteria | 7596 |
| 461 | Ga0395900_0017759 | 3300037418 | Bacteria | 7261 |
| 462 | Ga0395898_0041393 | 3300037466 | Unclassified | 4551 |
| 463 | Ga0395898_0347694 | 3300037466 | Unclassified | 1414 |
| 464 | Ga0395905_0062618 | 3300037471 | Bacteria | 3480 |
| 465 | Ga0395905_0324109 | 3300037471 | Unclassified | 1430 |
| 466 | Ga0436364_0892439 | 3300037853 | Bacteria | 967 |
| 467 | Ga0436364_1177859 | 3300037853 | Bacteria | 2129 |
| 468 | Ga0436364_1402391 | 3300037853 | Bacteria | 3759 |
| 469 | Ga0395901_0002207 | 3300038443 | Bacteria | 19856 |
| 470 | Ga0395901_0045662 | 3300038443 | Unclassified | 4548 |
| 471 | Ga0395901_0158030 | 3300038443 | Bacteria | 2381 |
| 472 | Ga0395901_0399978 | 3300038443 | Unclassified | 1411 |
| 473 | Ga0395901_0453632 | 3300038443 | Bacteria | 1311 |
| 474 | Ga0436365_0893531 | 3300039437 | Bacteria | 5694 |
| 475 | Ga0436365_0941525 | 3300039437 | Bacteria | 29495 |
| 476 | Ga0436365_1279257 | 3300039437 | Bacteria | 36311 |
| 477 | Ga0436365_1702714 | 3300039437 | Bacteria | 17164 |
| 478 | Ga0436365_1804822 | 3300039437 | Bacteria | 4039 |
| 479 | Ga0436360_0044627 | 3300039438 | Unclassified | 924 |
| 480 | Ga0436360_0109079 | 3300039438 | Bacteria | 6475 |
| 481 | Ga0436360_0209699 | 3300039438 | Bacteria | 1897 |
| 482 | Ga0436360_0539194 | 3300039438 | Unclassified | 2942 |
| 483 | Ga0436360_1344586 | 3300039438 | Unclassified | 2889 |
| 484 | Ga0436361_0103363 | 3300039447 | Bacteria | 1930 |
| 485 | Ga0436361_0111012 | 3300039447 | Bacteria | 4416 |
| 486 | Ga0436361_0271097 | 3300039447 | Bacteria | 7333 |
| 487 | Ga0436361_0277425 | 3300039447 | Bacteria | 1546 |
| 488 | Ga0436361_0583454 | 3300039447 | Bacteria | 1247 |
| 489 | Ga0436361_0797992 | 3300039447 | Bacteria | 19448 |
| 490 | Ga0436361_0873473 | 3300039447 | Unclassified | 1337 |
| 491 | Ga0436361_0997857 | 3300039447 | Bacteria | 1516 |
| 492 | Ga0436361_1202543 | 3300039447 | Unclassified | 3692 |
| 493 | Ga0436363_0203842 | 3300039450 | Unclassified | 4373 |
| 494 | Ga0436363_1006004 | 3300039450 | Bacteria | 6751 |
| 495 | Ga0436362_0096211 | 3300039453 | Bacteria | 1139 |
| 496 | Ga0436362_0266325 | 3300039453 | Unclassified | 1050 |
| 497 | Ga0451849_1324247 | 3300041505 | Unclassified | 827 |
| 498 | Ga0439448_0100170 | 3300042005 | Bacteria | 984 |
| 499 | Ga0439451_039784 | 3300042009 | Bacteria | 944 |
| 500 | Ga0439464_0054568 | 3300042439 | Bacteria | 1161 |
| 501 | Ga0495592_0016171 | 3300046454 | Bacteria | 5660 |
| 502 | Ga0495651_0069517 | 3300046462 | Bacteria | 2682 |
| 503 | Ga0495651_0105369 | 3300046462 | Bacteria | 2092 |
| 504 | Ga0495580_0254901 | 3300046472 | Bacteria | 1201 |
| 505 | Ga0495639_0043897 | 3300046475 | Bacteria | 2020 |
| 506 | Ga0495664_0127843 | 3300046477 | Unclassified | 1538 |
| 507 | Ga0495618_0063753 | 3300046514 | Bacteria | 2341 |
| 508 | Ga0495628_0025329 | 3300046516 | Bacteria | 4846 |
| 509 | Ga0495630_0013029 | 3300046517 | Bacteria | 6041 |
| 510 | Ga0495630_0124641 | 3300046517 | Bacteria | 1955 |
| 511 | Ga0495642_0141760 | 3300046528 | Unclassified | 1038 |
| 512 | Ga0495652_0020853 | 3300046529 | Bacteria | 5823 |
| 513 | Ga0495652_0022832 | 3300046529 | Bacteria | 5551 |
| 514 | Ga0495665_0026500 | 3300046531 | Bacteria | 3113 |
| 515 | Ga0495586_0046173 | 3300046535 | Bacteria | 2348 |
| 516 | Ga0495587_0096391 | 3300046536 | Bacteria | 1706 |
| 517 | Ga0495667_0083823 | 3300046559 | Bacteria | 2070 |
| 518 | Ga0495634_0125498 | 3300046642 | Unclassified | 1640 |
| 519 | Ga0495657_0322988 | 3300046675 | Unclassified | 917 |
| 520 | Ga0495599_0054529 | 3300046678 | Unclassified | 2504 |
| 521 | Ga0495669_0279991 | 3300046684 | Unclassified | 802 |
| 522 | Ga0495613_0035379 | 3300046689 | Bacteria | 3707 |
| 523 | Ga0495581_0044126 | 3300047315 | Bacteria | 2578 |
| 524 | Ga0495674_0197445 | 3300047319 | Bacteria | 1670 |
| 525 | Ga0495675_0016405 | 3300047444 | Bacteria | 4685 |
| 526 | Ga0495675_0022257 | 3300047444 | Bacteria | 4040 |
| 527 | Ga0495684_0216679 | 3300047471 | Bacteria | 1405 |
| 528 | Ga0496100_0030661 | 3300048903 | Bacteria | 3337 |
| 529 | Ga0496101_0089908 | 3300048904 | Unclassified | 2283 |
| 530 | Ga0496101_0207237 | 3300048904 | Bacteria | 1518 |
| 531 | Ga0496101_0335548 | 3300048904 | Unclassified | 1187 |
| 532 | Ga0496102_0098528 | 3300048905 | Unclassified | 2713 |
| 533 | Ga0496102_0116802 | 3300048905 | Bacteria | 2490 |
| 534 | Ga0496102_0216602 | 3300048905 | Bacteria | 1805 |
| 535 | Ga0496102_0591511 | 3300048905 | Unclassified | 1032 |
| 536 | Ga0496103_0044216 | 3300048906 | Unclassified | 2744 |
| 537 | Ga0496104_0030859 | 3300048907 | Bacteria | 4984 |
| 538 | Ga0496104_0044475 | 3300048907 | Bacteria | 4172 |
| 539 | Ga0496104_0110520 | 3300048907 | Unclassified | 2635 |
| 540 | Ga0496104_0350158 | 3300048907 | Bacteria | 1390 |
| 541 | Ga0496104_0783335 | 3300048907 | Unclassified | 860 |
| 542 | Ga0496105_0026072 | 3300048908 | Bacteria | 4764 |
| 543 | Ga0496105_0052954 | 3300048908 | Bacteria | 3352 |
| 544 | Ga0496105_0094231 | 3300048908 | Unclassified | 2473 |
| 545 | Ga0496106_0029695 | 3300048909 | Bacteria | 4076 |
| 546 | Ga0496106_0063335 | 3300048909 | Bacteria | 2810 |
| 547 | Ga0496107_0417266 | 3300048910 | Unclassified | 998 |
| 548 | Ga0496108_0003070 | 3300048911 | Bacteria | 13424 |
| 549 | Ga0496108_0065063 | 3300048911 | Unclassified | 3073 |
| 550 | Ga0496109_0014337 | 3300048912 | Bacteria | 6897 |
| 551 | Ga0496109_0193322 | 3300048912 | Unclassified | 1912 |
| 552 | Ga0496109_0319797 | 3300048912 | Unclassified | 1464 |
| 553 | Ga0496109_0771612 | 3300048912 | Unclassified | 899 |
| 554 | Ga0496110_0059151 | 3300048913 | Bacteria | 3377 |
| 555 | Ga0496110_0183998 | 3300048913 | Unclassified | 1897 |
| 556 | Ga0496111_0025912 | 3300048914 | Bacteria | 4138 |
| 557 | Ga0496111_0347737 | 3300048914 | Unclassified | 1097 |
| 558 | Ga0496112_0016046 | 3300048915 | Bacteria | 7004 |
| 559 | Ga0496112_0035031 | 3300048915 | Unclassified | 4886 |
| 560 | Ga0496112_0224616 | 3300048915 | Unclassified | 1833 |
| 561 | Ga0496113_0009210 | 3300048916 | Bacteria | 6476 |
| 562 | Ga0496113_0570349 | 3300048916 | Unclassified | 907 |
| 563 | Ga0496114_0019270 | 3300048917 | Bacteria | 5528 |
| 564 | Ga0496114_0021555 | 3300048917 | Bacteria | 5242 |
| 565 | Ga0496114_0758092 | 3300048917 | Unclassified | 848 |
| 566 | Ga0496115_0001242 | 3300048918 | Bacteria | 18287 |
| 567 | Ga0496115_0003067 | 3300048918 | Bacteria | 11998 |
| 568 | Ga0496115_0183635 | 3300048918 | Unclassified | 1728 |
| 569 | Ga0496115_0568746 | 3300048918 | Unclassified | 904 |
| 570 | nmdc:mga0k408_35373_c1 | 3300050493 | Bacteria | 2865 |
| 571 | nmdc:mga05p37_1034_c1 | 3300050507 | Bacteria | 31710 |
| 572 | nmdc:mga08y16_531200_c1 | 3300050511 | Unclassified | 1192 |
| 573 | nmdc:mga0n895_485133_c1 | 3300050512 | Unclassified | 1246 |
| 574 | nmdc:mga0a205_119752_c1 | 3300050515 | Bacteria | 2531 |
| 575 | Ga0495601_0117226 | 3300053077 | Bacteria | 1727 |
| 576 | Ga0495601_0125315 | 3300053077 | Unclassified | 1671 |
| 577 | Ga0495619_0036438 | 3300053085 | Bacteria | 3204 |
| 578 | Ga0500555_000380 | 3300053103 | Bacteria | 18717 |
| 579 | Ga0500556_0003924 | 3300053104 | Bacteria | 4298 |
| 580 | Ga0500642_0003660 | 3300053130 | Bacteria | 4684 |
| 581 | Ga0081539_10030578 | |||
| 582 | JGI24743J22301_10009040 | |||
| 583 | JGI24744J21845_10024455 | |||
| 584 | JGI24035J26624_1001336 | |||
| 585 | JGI24035J26624_1001905 | |||
| 586 | JGI25406J46586_10000016 | |||
| 587 | rootL2_10040785 | |||
| 588 | JGI25405J52794_10001125 | |||
| 589 | JGI25405J52794_10001203 | |||
| 590 | JGI25405J52794_10001342 | |||
| 591 | Ga0065714_10079066 | |||
| 592 | Ga0065704_10012683 | |||
| 593 | Ga0065704_10016265 | |||
| 594 | Ga0065712_10000912 | |||
| 595 | Ga0065712_10009302 | |||
| 596 | Ga0065712_10032649 | |||
| 597 | Ga0065712_10096819 | |||
| 598 | Ga0065712_10113215 | |||
| 599 | Ga0065715_10000600 | |||
| 600 | Ga0065715_10003434 | |||
| 601 | Ga0065715_10039043 | |||
| 602 | Ga0065715_10110158 | |||
| 603 | Ga0065715_10142203 | |||
| 604 | Ga0065715_10164132 | |||
| 605 | Ga0065707_10025553 | |||
| 606 | Ga0070658_10217045 | |||
| 607 | Ga0070676_10034987 | |||
| 608 | Ga0070676_10042381 | |||
| 609 | Ga0070683_100030957 | |||
| 610 | Ga0070683_100046482 | |||
| 611 | Ga0070683_100907983 | |||
| 612 | Ga0070690_100019451 | |||
| 613 | Ga0070690_100033761 | |||
| 614 | Ga0070670_100007753 | |||
| 615 | Ga0070670_100116839 | |||
| 616 | Ga0070666_10002573 | |||
| 617 | Ga0070666_10062640 | |||
| 618 | Ga0070666_10101079 | |||
| 619 | Ga0070666_10164190 | |||
| 620 | Ga0070680_100090978 | |||
| 621 | Ga0070682_100040964 | |||
| 622 | Ga0068868_100045918 | |||
| 623 | Ga0068868_100063376 | |||
| 624 | Ga0070660_100110171 | |||
| 625 | Ga0070689_100003689 | |||
| 626 | Ga0070689_100008475 | |||
| 627 | Ga0070689_100043981 | |||
| 628 | Ga0070689_100593013 | |||
| 629 | Ga0070687_100005822 | |||
| 630 | Ga0070687_100087234 | |||
| 631 | Ga0070661_100073698 | |||
| 632 | Ga0070668_100013088 | |||
| 633 | Ga0070668_100087581 | |||
| 634 | Ga0070668_100099625 | |||
| 635 | Ga0070668_100379736 | |||
| 636 | Ga0070668_100700628 | |||
| 637 | Ga0070669_100001125 | |||
| 638 | Ga0070669_100175566 | |||
| 639 | Ga0070675_100011335 | |||
| 640 | Ga0070675_100013934 | |||
| 641 | Ga0070675_100077577 | |||
| 642 | Ga0070675_100105982 | |||
| 643 | Ga0070675_100323159 | |||
| 644 | Ga0070675_100514346 | |||
| 645 | Ga0070675_100696524 | |||
| 646 | Ga0070671_100011010 | |||
| 647 | Ga0070671_100053135 | |||
| 648 | Ga0070671_100103271 | |||
| 649 | Ga0070671_100123347 | |||
| 650 | Ga0070674_100023803 | |||
| 651 | Ga0070674_100027751 | |||
| 652 | Ga0070673_100006681 | |||
| 653 | Ga0070673_100011420 | |||
| 654 | Ga0070673_100056885 | |||
| 655 | Ga0070688_100000527 | |||
| 656 | Ga0070688_100004107 | |||
| 657 | Ga0070688_100180615 | |||
| 658 | Ga0070659_100001979 | |||
| 659 | Ga0070659_100055822 | |||
| 660 | Ga0070667_100117461 | |||
| 661 | Ga0070667_100339121 | |||
| 662 | Ga0070703_10019675 | |||
| 663 | Ga0070703_10132913 | |||
| 664 | Ga0070709_10006236 | |||
| 665 | Ga0070709_10226844 | |||
| 666 | Ga0070709_10254754 | |||
| 667 | Ga0070714_100029829 | |||
| 668 | Ga0070714_100040726 | |||
| 669 | Ga0070714_100135241 | |||
| 670 | Ga0070714_100444218 | |||
| 671 | Ga0070714_100554412 | |||
| 672 | Ga0070714_100717164 | |||
| 673 | Ga0070713_100050105 | |||
| 674 | Ga0070713_100097504 | |||
| 675 | Ga0070713_100186315 | |||
| 676 | Ga0070713_100336530 | |||
| 677 | Ga0070713_100591204 | |||
| 678 | Ga0070713_100778071 | |||
| 679 | Ga0070710_10144787 | |||
| 680 | Ga0070710_10183763 | |||
| 681 | Ga0070701_10256614 | |||
| 682 | Ga0070711_100041860 | |||
| 683 | Ga0070711_100191464 | |||
| 684 | Ga0070705_100002522 | |||
| 685 | Ga0070705_100080550 | |||
| 686 | Ga0070700_100024035 | |||
| 687 | Ga0070694_100049759 | |||
| 688 | Ga0070708_100044641 | |||
| 689 | Ga0070708_100046647 | |||
| 690 | Ga0070708_100048027 | |||
| 691 | Ga0070708_100106041 | |||
| 692 | Ga0070708_100614572 | |||
| 693 | Ga0070678_100001827 | |||
| 694 | Ga0070678_100131020 | |||
| 695 | Ga0070678_100205072 | |||
| 696 | Ga0070662_100005048 | |||
| 697 | Ga0070662_100024522 | |||
| 698 | Ga0070662_100141765 | |||
| 699 | Ga0070662_100154049 | |||
| 700 | Ga0070662_100245639 | |||
| 701 | Ga0070681_10016079 | |||
| 702 | Ga0068867_100093777 | |||
| 703 | Ga0070706_100000159 | |||
| 704 | Ga0070706_100004210 | |||
| 705 | Ga0070706_100015418 | |||
| 706 | Ga0070706_100030731 | |||
| 707 | Ga0070706_100068341 | |||
| 708 | Ga0070706_100072804 | |||
| 709 | Ga0070707_100000049 | |||
| 710 | Ga0070707_100023875 | |||
| 711 | Ga0070707_100027945 | |||
| 712 | Ga0070707_100040134 | |||
| 713 | Ga0070707_100120570 | |||
| 714 | Ga0070707_100207543 | |||
| 715 | Ga0070707_100352295 | |||
| 716 | Ga0070707_100436071 | |||
| 717 | Ga0070698_100005334 | |||
| 718 | Ga0070698_100005632 | |||
| 719 | Ga0070698_100041532 | |||
| 720 | Ga0070698_100251333 | |||
| 721 | Ga0070698_100307813 | |||
| 722 | Ga0070698_100460871 | |||
| 723 | Ga0070698_100554763 | |||
| 724 | Ga0070699_100019360 | |||
| 725 | Ga0070699_100023434 | |||
| 726 | Ga0070699_100062690 | |||
| 727 | Ga0070699_100123749 | |||
| 728 | Ga0070699_100138505 | |||
| 729 | Ga0070699_100284277 | |||
| 730 | Ga0070699_100392636 | |||
| 731 | Ga0070699_100567980 | |||
| 732 | Ga0070679_100144435 | |||
| 733 | Ga0070684_100000685 | |||
| 734 | Ga0070684_100037687 | |||
| 735 | Ga0070697_100004731 | |||
| 736 | Ga0070697_100005805 | |||
| 737 | Ga0070697_100011300 | |||
| 738 | Ga0070697_100016294 | |||
| 739 | Ga0070697_100049655 | |||
| 740 | Ga0070697_100064997 | |||
| 741 | Ga0070697_100066804 | |||
| 742 | Ga0070697_100102528 | |||
| 743 | Ga0070697_100113349 | |||
| 744 | Ga0070697_100126665 | |||
| 745 | Ga0070697_100134747 | |||
| 746 | Ga0070697_100138514 | |||
| 747 | Ga0070672_100000507 | |||
| 748 | Ga0070672_100015220 | |||
| 749 | Ga0070686_100054635 | |||
| 750 | Ga0070695_100038341 | |||
| 751 | Ga0070693_100353060 | |||
| 752 | Ga0070665_100032657 | |||
| 753 | Ga0070665_100054892 | |||
| 754 | Ga0070665_100191354 | |||
| 755 | Ga0070665_100270343 | |||
| 756 | Ga0070704_100010067 | |||
| 757 | Ga0070664_100014719 | |||
| 758 | Ga0070664_100022227 | |||
| 759 | Ga0070664_100234797 | |||
| 760 | Ga0068856_100069852 | |||
| 761 | Ga0068856_100105618 | |||
| 762 | Ga0068859_100090042 | |||
| 763 | Ga0068866_10217033 | |||
| 764 | Ga0068861_100370725 | |||
| 765 | Ga0068863_100020988 | |||
| 766 | Ga0068863_100076966 | |||
| 767 | Ga0068863_100225659 | |||
| 768 | Ga0068863_100401513 | |||
| 769 | Ga0068858_100005838 | |||
| 770 | Ga0068858_100098054 | |||
| 771 | Ga0068860_100021776 | |||
| 772 | Ga0068860_100046597 | |||
| 773 | Ga0068860_100136331 | |||
| 774 | Ga0068862_100409521 | |||
| 775 | Ga0081455_10000582 | |||
| 776 | Ga0081455_10000643 | |||
| 777 | Ga0081455_10016636 | |||
| 778 | Ga0081455_10016846 | |||
| 779 | Ga0081455_10062385 | |||
| 780 | Ga0081455_10080469 | |||
| 781 | Ga0081455_10100188 | |||
| 782 | Ga0081455_10106477 | |||
| 783 | Ga0081540_1000340 | |||
| 784 | Ga0081540_1048116 | |||
| 785 | Ga0081539_10000383 | |||
| 786 | Ga0081539_10003184 | |||
| 787 | Ga0081539_10028869 | |||
| 788 | Ga0081539_10046735 | |||
| 789 | Ga0081539_10052197 | |||
| 790 | Ga0081539_10120482 | |||
| 791 | Ga0070717_10008493 | |||
| 792 | Ga0070717_10010257 | |||
| 793 | Ga0070717_10092804 | |||
| 794 | Ga0070717_10217455 | |||
| 795 | Ga0070717_10515351 | |||
| 796 | Ga0070716_100014161 | |||
| 797 | Ga0070716_100014403 | |||
| 798 | Ga0070716_100222016 | |||
| 799 | Ga0070716_100295941 | |||
| 800 | Ga0070712_100012407 | |||
| 801 | Ga0070712_100087099 | |||
| 802 | Ga0070712_100091966 | |||
| 803 | Ga0070712_100269744 | |||
| 804 | Ga0070712_100273145 | |||
| 805 | Ga0075362_10000189 | |||
| 806 | Ga0097621_100006631 | |||
| 807 | Ga0097621_100047310 | |||
| 808 | Ga0097621_100385567 | |||
| 809 | Ga0068871_100005948 | |||
| 810 | Ga0068871_100017612 | |||
| 811 | Ga0068871_100018313 | |||
| 812 | Ga0068871_100288729 | |||
| 813 | Ga0075428_100521573 | |||
| 814 | Ga0075433_10381658 | |||
| 815 | Ga0075436_100302640 | |||
| 816 | Ga0097620_100090039 | |||
| 817 | Ga0099795_10123981 | |||
| 818 | Ga0111539_10182382 | |||
| 819 | Ga0111539_10316202 | |||
| 820 | Ga0105245_10023920 | |||
| 821 | Ga0105245_10086209 | |||
| 822 | Ga0105245_10099031 | |||
| 823 | Ga0105247_10144744 | |||
| 824 | Ga0105247_10433188 | |||
| 825 | Ga0114129_10002461 | |||
| 826 | Ga0114129_10128853 | |||
| 827 | Ga0114129_10181753 | |||
| 828 | Ga0114129_10622050 | |||
| 829 | Ga0105237_10103808 | |||
| 830 | Ga0105237_10338619 | |||
| 831 | Ga0105237_10738640 | |||
| 832 | Ga0105249_10040660 | |||
| 833 | Ga0105249_10104459 | |||
| 834 | Ga0105249_10130843 | |||
| 835 | Ga0099796_10035280 | |||
| 836 | Ga0105239_10072107 | |||
| 837 | Ga0105239_10203267 | |||
| 838 | Ga0105246_10150503 | |||
| 839 | Ga0105246_10359245 | |||
| 840 | Ga0157369_10064726 | |||
| 841 | Ga0157374_10121518 | |||
| 842 | Ga0157374_10121984 | |||
| 843 | Ga0157374_10201614 | |||
| 844 | Ga0157374_10222957 | |||
| 845 | Ga0157374_10354353 | |||
| 846 | Ga0157374_10512038 | |||
| 847 | Ga0157378_10018283 | |||
| 848 | Ga0157378_10021223 | |||
| 849 | Ga0157378_10034433 | |||
| 850 | Ga0157378_10224402 | |||
| 851 | Ga0157378_10662754 | |||
| 852 | Ga0157378_10761288 | |||
| 853 | Ga0163162_10002963 | |||
| 854 | Ga0163162_10061261 | |||
| 855 | Ga0163162_10962018 | |||
| 856 | Ga0157372_10038275 | |||
| 857 | Ga0157375_10002525 | |||
| 858 | Ga0157375_10035794 | |||
| 859 | Ga0157375_10111424 | |||
| 860 | Ga0157375_10835978 | |||
| 861 | Ga0157375_10939056 | |||
| 862 | Ga0163163_10216820 | |||
| 863 | Ga0163163_10363593 | |||
| 864 | Ga0157377_10060667 | |||
| 865 | Ga0157379_10017190 | |||
| 866 | Ga0157376_10009097 | |||
| 867 | Ga0157376_10061890 | |||
| 868 | Ga0157376_10201371 | |||
| 869 | Ga0157376_10461498 | |||
| 870 | Ga0163161_10062398 | |||
| 871 | Ga0163161_10507135 | |||
| 872 | Ga0213872_10012499 | |||
| 873 | Ga0213872_10022443 | |||
| 874 | Ga0213872_10041006 | |||
| 875 | Ga0213872_10054421 | |||
| 876 | Ga0213872_10088303 | |||
| 877 | Ga0213874_10022250 | |||
| 878 | Ga0213876_10005417 | |||
| 879 | Ga0213876_10051203 | |||
| 880 | Ga0213876_10085164 | |||
| 881 | Ga0213875_10049032 | |||
| 882 | Ga0207666_1000425 | |||
| 883 | Ga0207666_1000508 | |||
| 884 | Ga0207673_1000242 | |||
| 885 | Ga0207697_10000302 | |||
| 886 | Ga0207697_10001124 | |||
| 887 | Ga0207697_10002156 | |||
| 888 | Ga0207697_10002407 | |||
| 889 | Ga0207697_10003735 | |||
| 890 | Ga0207697_10009454 | |||
| 891 | Ga0207697_10012738 | |||
| 892 | Ga0207697_10014558 | |||
| 893 | Ga0207653_10003439 | |||
| 894 | Ga0207692_10167016 | |||
| 895 | Ga0207680_10037995 | |||
| 896 | Ga0207680_10047724 | |||
| 897 | Ga0207680_10053891 | |||
| 898 | Ga0207647_10005071 | |||
| 899 | Ga0207699_10014030 | |||
| 900 | Ga0207699_10043651 | |||
| 901 | Ga0207645_10003338 | |||
| 902 | Ga0207645_10012355 | |||
| 903 | Ga0207645_10052621 | |||
| 904 | Ga0207684_10000208 | |||
| 905 | Ga0207684_10000828 | |||
| 906 | Ga0207684_10004368 | |||
| 907 | Ga0207684_10029507 | |||
| 908 | Ga0207684_10036238 | |||
| 909 | Ga0207684_10077700 | |||
| 910 | Ga0207684_10095389 | |||
| 911 | Ga0207707_10032289 | |||
| 912 | Ga0207693_10009411 | |||
| 913 | Ga0207693_10022923 | |||
| 914 | Ga0207693_10029485 | |||
| 915 | Ga0207693_10045433 | |||
| 916 | Ga0207693_10111130 | |||
| 917 | Ga0207693_10254488 | |||
| 918 | Ga0207693_10416782 | |||
| 919 | Ga0207660_10017748 | |||
| 920 | Ga0207662_10002073 | |||
| 921 | Ga0207662_10026636 | |||
| 922 | Ga0207657_10136791 | |||
| 923 | Ga0207652_10146097 | |||
| 924 | Ga0207646_10000115 | |||
| 925 | Ga0207646_10000985 | |||
| 926 | Ga0207646_10028529 | |||
| 927 | Ga0207646_10035326 | |||
| 928 | Ga0207646_10077114 | |||
| 929 | Ga0207646_10093177 | |||
| 930 | Ga0207646_10110165 | |||
| 931 | Ga0207646_10261102 | |||
| 932 | Ga0207646_10303474 | |||
| 933 | Ga0207646_10513134 | |||
| 934 | Ga0207681_10061968 | |||
| 935 | Ga0207650_10148849 | |||
| 936 | Ga0207659_10050753 | |||
| 937 | Ga0207659_10068307 | |||
| 938 | Ga0207659_10096539 | |||
| 939 | Ga0207659_10097626 | |||
| 940 | Ga0207659_10564189 | |||
| 941 | Ga0207687_10041012 | |||
| 942 | Ga0207687_10319953 | |||
| 943 | Ga0207700_10045473 | |||
| 944 | Ga0207700_10127943 | |||
| 945 | Ga0207700_10170755 | |||
| 946 | Ga0207700_10269928 | |||
| 947 | Ga0207700_10455445 | |||
| 948 | Ga0207664_10043906 | |||
| 949 | Ga0207664_10125790 | |||
| 950 | Ga0207664_10649191 | |||
| 951 | Ga0207644_10072780 | |||
| 952 | Ga0207644_10077687 | |||
| 953 | Ga0207644_10145999 | |||
| 954 | Ga0207644_10247341 | |||
| 955 | Ga0207644_10335887 | |||
| 956 | Ga0207690_10005356 | |||
| 957 | Ga0207706_10065686 | |||
| 958 | Ga0207706_10081182 | |||
| 959 | Ga0207686_10110646 | |||
| 960 | Ga0207670_10036781 | |||
| 961 | Ga0207669_10090591 | |||
| 962 | Ga0207669_10092672 | |||
| 963 | Ga0207704_10155202 | |||
| 964 | Ga0207665_10119227 | |||
| 965 | Ga0207691_10001154 | |||
| 966 | Ga0207691_10033420 | |||
| 967 | Ga0207691_10073215 | |||
| 968 | Ga0207691_10297240 | |||
| 969 | Ga0207691_10343784 | |||
| 970 | Ga0207689_10044615 | |||
| 971 | Ga0207661_10033828 | |||
| 972 | Ga0207661_10061617 | |||
| 973 | Ga0207661_10155801 | |||
| 974 | Ga0207679_10039525 | |||
| 975 | Ga0207679_10053578 | |||
| 976 | Ga0207651_10028610 | |||
| 977 | Ga0207651_10038972 | |||
| 978 | Ga0207712_10031882 | |||
| 979 | Ga0207712_10079685 | |||
| 980 | Ga0207712_10210593 | |||
| 981 | Ga0207668_10009025 | |||
| 982 | Ga0207668_10021596 | |||
| 983 | Ga0207668_10032029 | |||
| 984 | Ga0207668_10245287 | |||
| 985 | Ga0207668_10461809 | |||
| 986 | Ga0207658_10002192 | |||
| 987 | Ga0207658_10012539 | |||
| 988 | Ga0207658_10030781 | |||
| 989 | Ga0207658_10053972 | |||
| 990 | Ga0207677_10008391 | |||
| 991 | Ga0207677_10040798 | |||
| 992 | Ga0207677_10138425 | |||
| 993 | Ga0207677_10338790 | |||
| 994 | Ga0207703_10020236 | |||
| 995 | Ga0207678_10006966 | |||
| 996 | Ga0207678_10187740 | |||
| 997 | Ga0207708_10022748 | |||
| 998 | Ga0207641_10232529 | |||
| 999 | Ga0207648_10123881 | |||
| 1000 | Ga0207648_10349310 | |||
| 1001 | Ga0207675_100072593 | |||
| 1002 | Ga0207675_100092470 | |||
| 1003 | Ga0207683_10002853 | |||
| 1004 | Ga0207683_10014855 | |||
| 1005 | Ga0207683_10427012 | |||
| 1006 | Ga0209974_10021173 | |||
| 1007 | Ga0268266_10007337 | |||
| 1008 | Ga0268266_10088337 | |||
| 1009 | Ga0268266_10120569 | |||
| 1010 | Ga0268266_10244118 | |||
| 1011 | Ga0268265_10473135 | |||
| 1012 | Ga0268264_10031411 | |||
| 1013 | Ga0268264_10527688 | |||
| 1014 | Ga0265337_1026205 | |||
| 1015 | Ga0265338_10027936 | |||
| 1016 | Ga0265338_10184845 | |||
| 1017 | Ga0307513_10078143 | |||
| 1018 | Ga0373945_0019889 | |||
| 1019 | Ga0373945_0120484 | |||
| 1020 | Ga0373956_0094903 | |||
| 1021 | Ga0373957_0055953 | |||
| 1022 | Ga0373943_0022405 | |||
| 1023 | Ga0373943_0201436 | |||
| 1024 | Ga0373946_0088835 | |||
| 1025 | Ga0373955_0003778 | |||
| 1026 | Ga0373924_0017962 | |||
| 1027 | Ga0373931_0096274 | |||
| 1028 | Ga0373931_0202607 | |||
| 1029 | Ga0373935_0126265 | |||
| 1030 | Ga0373935_0265848 | |||
| 1031 | Ga0373927_0120698 | |||
| 1032 | Ga0373927_0192801 | |||
| 1033 | Ga0373947_0023815 | |||
| 1034 | Ga0373947_0135003 | |||
| 1035 | Ga0373937_0010101 | |||
| 1036 | Ga0373937_0023461 | |||
| 1037 | Ga0373925_0076636 | |||
| 1038 | Ga0373925_0091150 | |||
| 1039 | Ga0373925_0439172 | |||
| 1040 | Ga0395900_0016194 | |||
| 1041 | Ga0395900_0017759 | |||
| 1042 | Ga0395898_0041393 | |||
| 1043 | Ga0395898_0347694 | |||
| 1044 | Ga0395905_0062618 | |||
| 1045 | Ga0395905_0324109 | |||
| 1046 | Ga0436364_0892439 | |||
| 1047 | Ga0436364_1177859 | |||
| 1048 | Ga0436364_1402391 | |||
| 1049 | Ga0395901_0002207 | |||
| 1050 | Ga0395901_0045662 | |||
| 1051 | Ga0395901_0158030 | |||
| 1052 | Ga0395901_0399978 | |||
| 1053 | Ga0395901_0453632 | |||
| 1054 | Ga0436365_0893531 | |||
| 1055 | Ga0436365_0941525 | |||
| 1056 | Ga0436365_1279257 | |||
| 1057 | Ga0436365_1702714 | |||
| 1058 | Ga0436365_1804822 | |||
| 1059 | Ga0436360_0044627 | |||
| 1060 | Ga0436360_0109079 | |||
| 1061 | Ga0436360_0209699 | |||
| 1062 | Ga0436360_0539194 | |||
| 1063 | Ga0436360_1344586 | |||
| 1064 | Ga0436361_0103363 | |||
| 1065 | Ga0436361_0111012 | |||
| 1066 | Ga0436361_0271097 | |||
| 1067 | Ga0436361_0277425 | |||
| 1068 | Ga0436361_0583454 | |||
| 1069 | Ga0436361_0797992 | |||
| 1070 | Ga0436361_0873473 | |||
| 1071 | Ga0436361_0997857 | |||
| 1072 | Ga0436361_1202543 | |||
| 1073 | Ga0436363_0203842 | |||
| 1074 | Ga0436363_1006004 | |||
| 1075 | Ga0436362_0096211 | |||
| 1076 | Ga0436362_0266325 | |||
| 1077 | Ga0451849_1324247 | |||
| 1078 | Ga0439448_0100170 | |||
| 1079 | Ga0439451_039784 | |||
| 1080 | Ga0439464_0054568 | |||
| 1081 | Ga0495592_0016171 | |||
| 1082 | Ga0495651_0069517 | |||
| 1083 | Ga0495651_0105369 | |||
| 1084 | Ga0495580_0254901 | |||
| 1085 | Ga0495639_0043897 | |||
| 1086 | Ga0495664_0127843 | |||
| 1087 | Ga0495618_0063753 | |||
| 1088 | Ga0495628_0025329 | |||
| 1089 | Ga0495630_0013029 | |||
| 1090 | Ga0495630_0124641 | |||
| 1091 | Ga0495642_0141760 | |||
| 1092 | Ga0495652_0020853 | |||
| 1093 | Ga0495652_0022832 | |||
| 1094 | Ga0495665_0026500 | |||
| 1095 | Ga0495586_0046173 | |||
| 1096 | Ga0495587_0096391 | |||
| 1097 | Ga0495667_0083823 | |||
| 1098 | Ga0495634_0125498 | |||
| 1099 | Ga0495657_0322988 | |||
| 1100 | Ga0495599_0054529 | |||
| 1101 | Ga0495669_0279991 | |||
| 1102 | Ga0495613_0035379 | |||
| 1103 | Ga0495581_0044126 | |||
| 1104 | Ga0495674_0197445 | |||
| 1105 | Ga0495675_0016405 | |||
| 1106 | Ga0495675_0022257 | |||
| 1107 | Ga0495684_0216679 | |||
| 1108 | Ga0496100_0030661 | |||
| 1109 | Ga0496101_0089908 | |||
| 1110 | Ga0496101_0207237 | |||
| 1111 | Ga0496101_0335548 | |||
| 1112 | Ga0496102_0098528 | |||
| 1113 | Ga0496102_0116802 | |||
| 1114 | Ga0496102_0216602 | |||
| 1115 | Ga0496102_0591511 | |||
| 1116 | Ga0496103_0044216 | |||
| 1117 | Ga0496104_0030859 | |||
| 1118 | Ga0496104_0044475 | |||
| 1119 | Ga0496104_0110520 | |||
| 1120 | Ga0496104_0350158 | |||
| 1121 | Ga0496104_0783335 | |||
| 1122 | Ga0496105_0026072 | |||
| 1123 | Ga0496105_0052954 | |||
| 1124 | Ga0496105_0094231 | |||
| 1125 | Ga0496106_0029695 | |||
| 1126 | Ga0496106_0063335 | |||
| 1127 | Ga0496107_0417266 | |||
| 1128 | Ga0496108_0003070 | |||
| 1129 | Ga0496108_0065063 | |||
| 1130 | Ga0496109_0014337 | |||
| 1131 | Ga0496109_0193322 | |||
| 1132 | Ga0496109_0319797 | |||
| 1133 | Ga0496109_0771612 | |||
| 1134 | Ga0496110_0059151 | |||
| 1135 | Ga0496110_0183998 | |||
| 1136 | Ga0496111_0025912 | |||
| 1137 | Ga0496111_0347737 | |||
| 1138 | Ga0496112_0016046 | |||
| 1139 | Ga0496112_0035031 | |||
| 1140 | Ga0496112_0224616 | |||
| 1141 | Ga0496113_0009210 | |||
| 1142 | Ga0496113_0570349 | |||
| 1143 | Ga0496114_0019270 | |||
| 1144 | Ga0496114_0021555 | |||
| 1145 | Ga0496114_0758092 | |||
| 1146 | Ga0496115_0001242 | |||
| 1147 | Ga0496115_0003067 | |||
| 1148 | Ga0496115_0183635 | |||
| 1149 | Ga0496115_0568746 | |||
| 1150 | nmdc:mga0k408_35373_c1 | |||
| 1151 | nmdc:mga05p37_1034_c1 | |||
| 1152 | nmdc:mga08y16_531200_c1 | |||
| 1153 | nmdc:mga0n895_485133_c1 | |||
| 1154 | nmdc:mga0a205_119752_c1 | |||
| 1155 | Ga0495601_0117226 | |||
| 1156 | Ga0495601_0125315 | |||
| 1157 | Ga0495619_0036438 | |||
| 1158 | Ga0500555_000380 | |||
| 1159 | Ga0500556_0003924 | |||
| 1160 | Ga0500642_0003660 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mfe-assembly1.cif.gz_M | crystal structure of mycobacterium tuberculosis proteasome open-gate mutant with h0 movement | 0.7941 | 26 | 254 |
| 3hf9-assembly1.cif.gz_W | crystal structure of mycobacterium tuberculosis proteasome open-gate mutant modified by inhibitor gl1 | 0.7921 | 26 | 255 |
| 3mfe-assembly1.cif.gz_M | crystal structure of mycobacterium tuberculosis proteasome open-gate mutant with h0 movement | 0.7867 | 26 | 254 |
| 3hf9-assembly1.cif.gz_W | crystal structure of mycobacterium tuberculosis proteasome open-gate mutant modified by inhibitor gl1 | 0.7846 | 26 | 255 |
| 3mfe-assembly1.cif.gz_U | crystal structure of mycobacterium tuberculosis proteasome open-gate mutant with h0 movement | 0.778 | 10 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ej9A04 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; | 0.8012 | 164 | 206 | 1.10.132.10 |
| 3hf9W00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7921 | 26 | 255 | 3.60.20.10 |
| 3hf9W00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7846 | 26 | 255 | 3.60.20.10 |
| 3mkaM00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7508 | 1 | 257 | 3.60.20.10 |
| 3mkaM00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7356 | 1 | 257 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5QMV2-F1-model_v4 | Uncharacterized protein | 0.9418 | 122 | 259 |
|
| AF-A0A2V5QMV2-F1-model_v4 | Uncharacterized protein | 0.9289 | 122 | 259 |
|
| AF-A0A2V5K6M8-F1-model_v4 | Uncharacterized protein | 0.885 | 139 | 257 |
|
| AF-A0A2V5VCI2-F1-model_v4 | Uncharacterized protein | 0.8804 | 64 | 259 |
|
| AF-A0A2V6GWG4-F1-model_v4 | Uncharacterized protein | 0.8787 | 185 | 257 |
|