F465906

General Info

Members Datasets Scaffolds Average Seq Length
580 280 1160 132

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10002583|Ga0070691_100025836
Length 138
Sequence MSDKAPGRSGSMRKIHAPAVNVETERFWKAAEAGKLLYGFCLACSEPHYYPRSFCPFCFSERVEWREASGNANVYSYSIMYRTPTDPYTIAYVTLAEGPRLLTNLVDCDLKKIAIDAPAKLVWKPSEGGAPVPFFTLV

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006017 Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.34
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0.17
Rhizoplane 2.24
Rhizosphere 91.21
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10002583 3300005341 Bacteria 8072
2 rootH2_10173009 3300003320 Bacteria 1926
3 JGI25405J52794_10045692 3300003911 Unclassified 932
4 Ga0070670_100478188 3300005331 Bacteria 1106
5 Ga0070666_10158437 3300005335 Bacteria 1582
6 Ga0070680_100014789 3300005336 Bacteria 6103
7 Ga0070660_100468113 3300005339 Bacteria 1047
8 Ga0070689_100109284 3300005340 Bacteria 2198
9 Ga0070689_100776939 3300005340 Bacteria 841
10 Ga0070661_101650252 3300005344 Unclassified 542
11 Ga0070692_10284116 3300005345 Bacteria 1004
12 Ga0070668_100315540 3300005347 Bacteria 1314
13 Ga0070669_100168406 3300005353 Bacteria 1707
14 Ga0070675_100809192 3300005354 Bacteria 857
15 Ga0070674_100603112 3300005356 Bacteria 928
16 Ga0070659_101830746 3300005366 Bacteria 544
17 Ga0070667_100099493 3300005367 Bacteria 2510
18 Ga0070667_102271993 3300005367 Bacteria 511
19 Ga0070709_10000178 3300005434 Bacteria 40284
20 Ga0070709_10007302 3300005434 Bacteria 6055
21 Ga0070709_10011309 3300005434 Bacteria 4970
22 Ga0070714_100054496 3300005435 Bacteria 3416
23 Ga0070714_100062730 3300005435 Bacteria 3194
24 Ga0070714_100104698 3300005435 Bacteria 2497
25 Ga0070714_100281725 3300005435 Bacteria 1545
26 Ga0070713_100000124 3300005436 Bacteria 50425
27 Ga0070713_100004153 3300005436 Bacteria 9658
28 Ga0070713_100130451 3300005436 Bacteria 2216
29 Ga0070713_100665401 3300005436 Bacteria 992
30 Ga0070710_10001866 3300005437 Bacteria 9936
31 Ga0070710_10029440 3300005437 Bacteria 2947
32 Ga0070710_10535861 3300005437 Bacteria 806
33 Ga0070711_100097738 3300005439 Bacteria 2130
34 Ga0070711_100133892 3300005439 Bacteria 1849
35 Ga0070711_100208227 3300005439 Bacteria 1513
36 Ga0070711_100348605 3300005439 Bacteria 1190
37 Ga0070711_100359966 3300005439 Bacteria 1172
38 Ga0070705_100191008 3300005440 Bacteria 1396
39 Ga0070705_100810670 3300005440 Bacteria 746
40 Ga0070694_100474457 3300005444 Bacteria 992
41 Ga0070694_100562025 3300005444 Bacteria 915
42 Ga0070694_100584394 3300005444 Bacteria 898
43 Ga0070708_100089574 3300005445 Bacteria 2799
44 Ga0070708_100266506 3300005445 Bacteria 1611
45 Ga0070662_100839811 3300005457 Bacteria 782
46 Ga0070662_100863832 3300005457 Bacteria 771
47 Ga0068867_100375648 3300005459 Bacteria 1193
48 Ga0068867_101098244 3300005459 Bacteria 726
49 Ga0070706_100053692 3300005467 Bacteria 3719
50 Ga0070706_100851458 3300005467 Bacteria 843
51 Ga0070706_101476436 3300005467 Bacteria 621
52 Ga0070707_100365903 3300005468 Bacteria 1401
53 Ga0070707_100566000 3300005468 Bacteria 1098
54 Ga0070698_100006633 3300005471 Bacteria 12551
55 Ga0070698_100515868 3300005471 Bacteria 1133
56 Ga0070698_101483028 3300005471 Bacteria 629
57 Ga0070698_101579596 3300005471 Bacteria 608
58 Ga0070699_100032023 3300005518 Bacteria 4540
59 Ga0070699_100158741 3300005518 Bacteria 2001
60 Ga0070699_100781452 3300005518 Bacteria 874
61 Ga0070679_100819399 3300005530 Bacteria 874
62 Ga0070684_100320721 3300005535 Bacteria 1423
63 Ga0070697_100078116 3300005536 Bacteria 2723
64 Ga0070697_100195077 3300005536 Bacteria 1719
65 Ga0070697_100289097 3300005536 Bacteria 1408
66 Ga0068853_100002258 3300005539 Bacteria 14402
67 Ga0070695_100016387 3300005545 Bacteria 4484
68 Ga0070695_100043439 3300005545 Bacteria 2858
69 Ga0070695_100657760 3300005545 Unclassified 828
70 Ga0070696_100068951 3300005546 Bacteria 2484
71 Ga0070696_100599842 3300005546 Bacteria 888
72 Ga0070696_100777126 3300005546 Bacteria 787
73 Ga0070693_100584528 3300005547 Bacteria 804
74 Ga0070665_100211428 3300005548 Bacteria 1940
75 Ga0070704_100037007 3300005549 Bacteria 3330
76 Ga0070704_101449432 3300005549 Bacteria 631
77 Ga0070704_101856805 3300005549 Bacteria 558
78 Ga0068855_100132508 3300005563 Bacteria 2845
79 Ga0068855_100614929 3300005563 Unclassified 1170
80 Ga0070664_100210067 3300005564 Bacteria 1739
81 Ga0070664_100814082 3300005564 Bacteria 874
82 Ga0068857_100001203 3300005577 Bacteria 20192
83 Ga0068857_100013618 3300005577 Bacteria 7086
84 Ga0068854_100193495 3300005578 Bacteria 1595
85 Ga0068856_100000460 3300005614 Bacteria 44894
86 Ga0068856_100005976 3300005614 Bacteria 11981
87 Ga0068856_102566484 3300005614 Bacteria 516
88 Ga0070702_100169274 3300005615 Bacteria 1420
89 Ga0068859_100149778 3300005617 Bacteria 2409
90 Ga0068859_101888139 3300005617 Bacteria 660
91 Ga0068866_10446425 3300005718 Bacteria 845
92 Ga0068866_10448659 3300005718 Bacteria 843
93 Ga0068861_101196031 3300005719 Bacteria 735
94 Ga0068861_102353296 3300005719 Unclassified 535
95 Ga0068863_100728495 3300005841 Bacteria 987
96 Ga0068858_100049519 3300005842 Bacteria 3891
97 Ga0068858_100106261 3300005842 Bacteria 2620
98 Ga0068860_100417703 3300005843 Bacteria 1329
99 Ga0068862_100785376 3300005844 Bacteria 929
100 Ga0081455_10008576 3300005937 Bacteria 10610
101 Ga0081455_10171353 3300005937 Bacteria 1653
102 Ga0081455_10563355 3300005937 Bacteria 751
103 Ga0081538_10088212 3300005981 Bacteria 1615
104 Ga0081540_1026284 3300005983 Bacteria 3325
105 Ga0081540_1099465 3300005983 Bacteria 1257
106 Ga0081539_10002714 3300005985 Bacteria 24004
107 Ga0058708_1000484 3300006017 Bacteria 518
108 Ga0070717_10036079 3300006028 Bacteria 4008
109 Ga0070717_10523722 3300006028 Bacteria 1072
110 Ga0075365_10119036 3300006038 Bacteria 1820
111 Ga0075365_10139785 3300006038 Bacteria 1680
112 Ga0075365_10250266 3300006038 Bacteria 1245
113 Ga0075365_10418098 3300006038 Bacteria 946
114 Ga0075364_10040668 3300006051 Bacteria 3016
115 Ga0070715_10127480 3300006163 Bacteria 1221
116 Ga0070716_100114470 3300006173 Bacteria 1677
117 Ga0070716_101077055 3300006173 Bacteria 640
118 Ga0070712_100001107 3300006175 Bacteria 16226
119 Ga0070712_100053176 3300006175 Bacteria 2827
120 Ga0070712_100117034 3300006175 Unclassified 1999
121 Ga0070712_100187326 3300006175 Bacteria 1617
122 Ga0070712_100268351 3300006175 Bacteria 1370
123 Ga0070712_100563041 3300006175 Bacteria 961
124 Ga0075362_10041973 3300006177 Bacteria 2020
125 Ga0075362_10061883 3300006177 Bacteria 1695
126 Ga0075362_10079105 3300006177 Bacteria 1513
127 Ga0075362_10369925 3300006177 Bacteria 720
128 Ga0075369_10010235 3300006186 Bacteria 3666
129 Ga0075369_10048289 3300006186 Bacteria 1836
130 Ga0075370_10178976 3300006353 Bacteria 1247
131 Ga0075428_100004708 3300006844 Bacteria 15100
132 Ga0075428_100013010 3300006844 Bacteria 9250
133 Ga0075428_100032439 3300006844 Bacteria 5769
134 Ga0075428_100057089 3300006844 Bacteria 4274
135 Ga0075428_100101001 3300006844 Bacteria 3145
136 Ga0075428_101649133 3300006844 Bacteria 670
137 Ga0075430_100010288 3300006846 Bacteria 7918
138 Ga0075430_100011593 3300006846 Bacteria 7496
139 Ga0075430_100023606 3300006846 Bacteria 5237
140 Ga0075430_100024377 3300006846 Bacteria 5150
141 Ga0075430_100655556 3300006846 Bacteria 865
142 Ga0075431_100000728 3300006847 Bacteria 28423
143 Ga0075431_100005126 3300006847 Bacteria 12887
144 Ga0075431_100047259 3300006847 Bacteria 4437
145 Ga0075431_100059939 3300006847 Bacteria 3928
146 Ga0075431_100140061 3300006847 Bacteria 2493
147 Ga0075431_100218562 3300006847 Bacteria 1944
148 Ga0075431_100626439 3300006847 Bacteria 1058
149 Ga0075431_100633472 3300006847 Bacteria 1051
150 Ga0075433_10087965 3300006852 Bacteria 2744
151 Ga0075433_10139872 3300006852 Bacteria 2151
152 Ga0075433_10183133 3300006852 Bacteria 1864
153 Ga0075434_100040969 3300006871 Bacteria 4586
154 Ga0075434_100175856 3300006871 Bacteria 2161
155 Ga0075434_100177692 3300006871 Bacteria 2148
156 Ga0075434_100192031 3300006871 Bacteria 2063
157 Ga0075434_100306269 3300006871 Bacteria 1609
158 Ga0075434_100343165 3300006871 Bacteria 1514
159 Ga0075434_101080101 3300006871 Bacteria 816
160 Ga0075429_100000162 3300006880 Bacteria 42401
161 Ga0075429_100005303 3300006880 Bacteria 11094
162 Ga0075429_100048047 3300006880 Bacteria 3711
163 Ga0075429_100247198 3300006880 Bacteria 1562
164 Ga0075429_100292318 3300006880 Bacteria 1427
165 Ga0075429_100422874 3300006880 Bacteria 1167
166 Ga0075429_100516322 3300006880 Bacteria 1047
167 Ga0068865_100181360 3300006881 Bacteria 1622
168 Ga0068865_101421635 3300006881 Bacteria 620
169 Ga0075436_100000327 3300006914 Bacteria 30470
170 Ga0075436_100006815 3300006914 Bacteria 7820
171 Ga0075436_100400376 3300006914 Bacteria 995
172 Ga0097620_100149775 3300006931 Bacteria 2409
173 Ga0097620_101888086 3300006931 Bacteria 660
174 Ga0075435_100027110 3300007076 Bacteria 4478
175 Ga0075435_100240300 3300007076 Bacteria 1540
176 Ga0075435_100488949 3300007076 Bacteria 1063
177 Ga0075435_100761143 3300007076 Bacteria 843
178 Ga0075435_101588211 3300007076 Bacteria 574
179 Ga0099794_10111716 3300007265 Bacteria 1370
180 Ga0099794_10197412 3300007265 Bacteria 1030
181 Ga0105240_10007008 3300009093 Bacteria 16450
182 Ga0105240_10338613 3300009093 Bacteria 1709
183 Ga0111539_10069618 3300009094 Bacteria 4155
184 Ga0111539_10325127 3300009094 Bacteria 1790
185 Ga0111539_11137719 3300009094 Bacteria 907
186 Ga0111539_12756935 3300009094 Bacteria 569
187 Ga0114129_10018601 3300009147 Bacteria 9892
188 Ga0114129_10044297 3300009147 Bacteria 6260
189 Ga0114129_10057268 3300009147 Bacteria 5456
190 Ga0114129_10078679 3300009147 Bacteria 4586
191 Ga0114129_10600842 3300009147 Bacteria 1425
192 Ga0114129_11016594 3300009147 Bacteria 1043
193 Ga0114129_11516882 3300009147 Bacteria 823
194 Ga0105243_10808081 3300009148 Bacteria 925
195 Ga0105241_10077682 3300009174 Bacteria 2592
196 Ga0105241_10223689 3300009174 Bacteria 1583
197 Ga0105241_10257453 3300009174 Bacteria 1482
198 Ga0105242_10374938 3300009176 Bacteria 1321
199 Ga0105242_11878557 3300009176 Bacteria 639
200 Ga0105248_10095460 3300009177 Bacteria 3348
201 Ga0105248_10572705 3300009177 Bacteria 1274
202 Ga0105237_10006558 3300009545 Bacteria 12874
203 Ga0105237_11268263 3300009545 Bacteria 743
204 Ga0105238_10004483 3300009551 Bacteria 13841
205 Ga0105238_11504389 3300009551 Bacteria 702
206 Ga0105238_12404222 3300009551 Unclassified 562
207 Ga0105249_11178447 3300009553 Bacteria 837
208 Ga0105148_118467 3300009978 Bacteria 556
209 Ga0099796_10139449 3300010159 Bacteria 946
210 Ga0099796_10171502 3300010159 Bacteria 866
211 Ga0105239_10120837 3300010375 Bacteria 2909
212 Ga0105239_10654130 3300010375 Bacteria 1200
213 Ga0105246_12388010 3300011119 Bacteria 518
214 Ga0157313_1017259 3300012503 Bacteria 698
215 Ga0157373_10002085 3300013100 Bacteria 15142
216 Ga0157370_10001806 3300013104 Bacteria 26391
217 Ga0157370_10653592 3300013104 Bacteria 961
218 Ga0157369_10016617 3300013105 Bacteria 8273
219 Ga0157378_10149738 3300013297 Bacteria 2173
220 Ga0157378_10415022 3300013297 Bacteria 1329
221 Ga0157378_11233115 3300013297 Bacteria 788
222 Ga0157378_11530091 3300013297 Bacteria 712
223 Ga0163162_10495615 3300013306 Bacteria 1352
224 Ga0163162_11089496 3300013306 Bacteria 905
225 Ga0157372_10004919 3300013307 Bacteria 14200
226 Ga0163163_10283162 3300014325 Bacteria 1709
227 Ga0163163_10287012 3300014325 Bacteria 1698
228 Ga0163163_10882238 3300014325 Bacteria 958
229 Ga0163163_13035026 3300014325 Bacteria 524
230 Ga0157380_10316188 3300014326 Bacteria 1445
231 Ga0157380_12680052 3300014326 Bacteria 565
232 Ga0182008_10270790 3300014497 Bacteria 881
233 Ga0182008_10411071 3300014497 Unclassified 729
234 Ga0157377_11013243 3300014745 Bacteria 630
235 Ga0157379_10002063 3300014968 Bacteria 16687
236 Ga0157379_10029493 3300014968 Bacteria 4878
237 Ga0157379_10053549 3300014968 Bacteria 3604
238 Ga0157379_10632402 3300014968 Bacteria 1001
239 Ga0157376_12541864 3300014969 Bacteria 552
240 Ga0182007_10106805 3300015262 Bacteria 930
241 Ga0184598_126843 3300019182 Bacteria 617
242 Ga0213873_10042074 3300021358 Bacteria 1180
243 Ga0213872_10022935 3300021361 Bacteria 2872
244 Ga0213874_10218503 3300021377 Bacteria 692
245 Ga0213875_10012274 3300021388 Bacteria 4237
246 Ga0207426_1036963 3300025302 Bacteria 1548
247 Ga0207692_10009951 3300025898 Bacteria 3988
248 Ga0207692_10028005 3300025898 Bacteria 2660
249 Ga0207692_10036367 3300025898 Bacteria 2400
250 Ga0207680_10005296 3300025903 Bacteria 6159
251 Ga0207699_10000207 3300025906 Bacteria 35120
252 Ga0207699_10004102 3300025906 Bacteria 6977
253 Ga0207699_10530433 3300025906 Bacteria 852
254 Ga0207645_10397744 3300025907 Bacteria 926
255 Ga0207684_10045840 3300025910 Bacteria 3708
256 Ga0207684_10734038 3300025910 Bacteria 838
257 Ga0207654_10052102 3300025911 Bacteria 2358
258 Ga0207654_10274031 3300025911 Bacteria 1139
259 Ga0207707_10602817 3300025912 Bacteria 929
260 Ga0207695_10018348 3300025913 Bacteria 8094
261 Ga0207695_10317793 3300025913 Bacteria 1447
262 Ga0207671_10032698 3300025914 Bacteria 3870
263 Ga0207671_10728700 3300025914 Bacteria 788
264 Ga0207693_10000957 3300025915 Bacteria 25897
265 Ga0207693_10001241 3300025915 Bacteria 22688
266 Ga0207693_10014949 3300025915 Bacteria 6233
267 Ga0207693_10135646 3300025915 Bacteria 1935
268 Ga0207693_10269701 3300025915 Bacteria 1334
269 Ga0207693_10418943 3300025915 Bacteria 1047
270 Ga0207663_10084207 3300025916 Bacteria 2091
271 Ga0207663_10098067 3300025916 Bacteria 1961
272 Ga0207663_10103460 3300025916 Bacteria 1918
273 Ga0207663_10599343 3300025916 Bacteria 865
274 Ga0207660_10020040 3300025917 Bacteria 4482
275 Ga0207662_10485706 3300025918 Bacteria 849
276 Ga0207649_11254196 3300025920 Unclassified 586
277 Ga0207652_10103820 3300025921 Bacteria 2513
278 Ga0207652_11249498 3300025921 Bacteria 645
279 Ga0207646_10099548 3300025922 Bacteria 2605
280 Ga0207646_10875735 3300025922 Bacteria 797
281 Ga0207681_10313265 3300025923 Bacteria 1245
282 Ga0207694_10005891 3300025924 Bacteria 9395
283 Ga0207700_10000048 3300025928 Bacteria 82228
284 Ga0207700_10344670 3300025928 Bacteria 1296
285 Ga0207700_10599960 3300025928 Bacteria 980
286 Ga0207664_10045762 3300025929 Bacteria 3433
287 Ga0207664_10554219 3300025929 Bacteria 1031
288 Ga0207664_11240822 3300025929 Bacteria 664
289 Ga0207664_11396693 3300025929 Bacteria 621
290 Ga0207706_10393973 3300025933 Bacteria 1201
291 Ga0207670_10336852 3300025936 Bacteria 1191
292 Ga0207704_10129675 3300025938 Bacteria 1743
293 Ga0207665_10038856 3300025939 Bacteria 3171
294 Ga0207665_10080365 3300025939 Bacteria 2242
295 Ga0207665_10175023 3300025939 Bacteria 1552
296 Ga0207679_10664658 3300025945 Bacteria 943
297 Ga0207667_10013361 3300025949 Bacteria 9399
298 Ga0207668_10499744 3300025972 Bacteria 1046
299 Ga0207658_10903008 3300025986 Bacteria 804
300 Ga0207703_10258731 3300026035 Bacteria 1572
301 Ga0207703_11132466 3300026035 Bacteria 752
302 Ga0207639_10265435 3300026041 Bacteria 1503
303 Ga0207708_11058548 3300026075 Bacteria 706
304 Ga0207702_10000148 3300026078 Bacteria 81831
305 Ga0207702_10014202 3300026078 Bacteria 6614
306 Ga0207641_10565139 3300026088 Bacteria 1110
307 Ga0207676_11061042 3300026095 Bacteria 800
308 Ga0207674_10000223 3300026116 Bacteria 70785
309 Ga0207674_10008695 3300026116 Bacteria 11690
310 Ga0207675_100122672 3300026118 Bacteria 2460
311 Ga0207675_102536555 3300026118 Bacteria 523
312 Ga0207698_10125502 3300026142 Bacteria 2182
313 Ga0209995_1045774 3300027471 Bacteria 740
314 Ga0209588_1102326 3300027671 Bacteria 921
315 Ga0209966_1104891 3300027695 Bacteria 641
316 Ga0207428_10020606 3300027907 Bacteria 5598
317 Ga0207428_10326933 3300027907 Bacteria 1131
318 Ga0268265_10117976 3300028380 Bacteria 2181
319 Ga0268265_11398992 3300028380 Bacteria 702
320 Ga0268264_10212418 3300028381 Bacteria 1777
321 Ga0268264_11283032 3300028381 Unclassified 742
322 Ga0265338_10024007 3300028800 Bacteria 6245
323 Ga0265338_10284673 3300028800 Bacteria 1206
324 Ga0265332_10171794 3300031238 Bacteria 905
325 Ga0265332_10259384 3300031238 Bacteria 719
326 Ga0265320_10008309 3300031240 Bacteria 6356
327 Ga0265325_10003807 3300031241 Bacteria 9728
328 Ga0265325_10025385 3300031241 Bacteria 3218
329 Ga0265329_10024115 3300031242 Bacteria 2021
330 Ga0265329_10138932 3300031242 Bacteria 784
331 Ga0265340_10374729 3300031247 Bacteria 628
332 Ga0265340_10412314 3300031247 Bacteria 596
333 Ga0265339_10004089 3300031249 Bacteria 10068
334 Ga0265339_10282713 3300031249 Bacteria 795
335 Ga0265331_10139955 3300031250 Bacteria 1101
336 Ga0265316_10020886 3300031344 Bacteria 5562
337 Ga0307408_100292890 3300031548 Bacteria 1360
338 Ga0307408_100340291 3300031548 Bacteria 1270
339 Ga0307408_100353259 3300031548 Bacteria 1248
340 Ga0307408_101144815 3300031548 Bacteria 723
341 Ga0265313_10002670 3300031595 Bacteria 15151
342 Ga0265313_10227472 3300031595 Bacteria 767
343 Ga0265314_10006392 3300031711 Bacteria 10440
344 Ga0265314_10332665 3300031711 Bacteria 841
345 Ga0307405_10418307 3300031731 Bacteria 1054
346 Ga0307405_11320751 3300031731 Bacteria 628
347 Ga0307410_10041590 3300031852 Bacteria 3032
348 Ga0307412_11628621 3300031911 Bacteria 590
349 Ga0307409_100485366 3300031995 Bacteria 1200
350 Ga0307416_100123840 3300032002 Bacteria 2311
351 Ga0307416_101284485 3300032002 Bacteria 838
352 Ga0307414_10748553 3300032004 Bacteria 888
353 Ga0307411_10068173 3300032005 Bacteria 2397
354 Ga0373926_0080319 3300035083 Bacteria 1206
355 Ga0373928_0025500 3300035084 Bacteria 1275
356 Ga0373940_0240098 3300035088 Bacteria 608
357 Ga0373952_0268177 3300035092 Bacteria 522
358 Ga0373923_0293963 3300035111 Bacteria 768
359 Ga0373923_0464980 3300035111 Unclassified 614
360 Ga0373932_0005587 3300035112 Bacteria 2958
361 Ga0373932_0318943 3300035112 Bacteria 584
362 Ga0373936_0334771 3300035113 Bacteria 687
363 Ga0373939_0152878 3300035114 Bacteria 841
364 Ga0373939_0502204 3300035114 Bacteria 518
365 Ga0373941_0008281 3300035115 Bacteria 2576
366 Ga0373941_0348542 3300035115 Bacteria 602
367 Ga0373941_0413522 3300035115 Bacteria 560
368 Ga0373945_0137566 3300035116 Bacteria 983
369 Ga0373953_0250115 3300035117 Unclassified 770
370 Ga0373956_0040210 3300035119 Bacteria 2074
371 Ga0373960_0109146 3300035121 Bacteria 906
372 Ga0373955_0150046 3300035172 Bacteria 1372
373 Ga0373955_0571024 3300035172 Bacteria 692
374 Ga0373942_0153898 3300035207 Bacteria 740
375 Ga0373961_0131434 3300035241 Bacteria 839
376 Ga0373962_0093694 3300035242 Bacteria 928
377 Ga0373924_0329244 3300035410 Bacteria 680
378 Ga0373931_0003552 3300035691 Bacteria 7032
379 Ga0373931_0030779 3300035691 Bacteria 2765
380 Ga0373931_0041637 3300035691 Bacteria 2413
381 Ga0373935_0086812 3300035692 Bacteria 2042
382 Ga0373935_0443697 3300035692 Bacteria 937
383 Ga0373927_0055914 3300035695 Bacteria 2551
384 Ga0373933_0242667 3300035724 Bacteria 1159
385 Ga0373933_0276826 3300035724 Bacteria 1084
386 Ga0373937_0006715 3300036401 Bacteria 9925
387 Ga0373937_0029163 3300036401 Bacteria 4996
388 Ga0373937_0069855 3300036401 Bacteria 3239
389 Ga0373937_0600811 3300036401 Bacteria 1044
390 Ga0373925_0106334 3300037068 Bacteria 2163
391 Ga0373925_0146984 3300037068 Bacteria 1848
392 Ga0395899_0037640 3300037312 Bacteria 3627
393 Ga0395900_0013259 3300037418 Bacteria 8424
394 Ga0395898_0021330 3300037466 Bacteria 6571
395 Ga0436364_0167291 3300037853 Bacteria 789
396 Ga0436364_0403390 3300037853 Bacteria 2999
397 Ga0395901_0000587 3300038443 Bacteria 42340
398 Ga0395901_0606436 3300038443 Bacteria 1103
399 Ga0436365_1118349 3300039437 Bacteria 752
400 Ga0436365_1931146 3300039437 Bacteria 2156
401 Ga0436360_0254091 3300039438 Bacteria 1876
402 Ga0436360_0856540 3300039438 Bacteria 1556
403 Ga0436360_1028536 3300039438 Bacteria 697
404 Ga0436361_0173721 3300039447 Bacteria 3537
405 Ga0436361_0736977 3300039447 Bacteria 1286
406 Ga0436363_0252336 3300039450 Bacteria 2040
407 Ga0436363_1427430 3300039450 Bacteria 624
408 Ga0436363_1585727 3300039450 Bacteria 822
409 Ga0436362_0408770 3300039453 Bacteria 655
410 Ga0436362_0428954 3300039453 Bacteria 2174
411 Ga0436362_0439030 3300039453 Bacteria 1688
412 Ga0436362_0634383 3300039453 Bacteria 748
413 Ga0436362_0826564 3300039453 Bacteria 901
414 Ga0436362_0958168 3300039453 Bacteria 1407
415 Ga0439461_0100961 3300041410 Bacteria 702
416 Ga0439465_0123050 3300041413 Bacteria 911
417 Ga0439458_0124677 3300042157 Bacteria 680
418 Ga0439444_0058494 3300042437 Bacteria 800
419 Ga0451577_0066128 3300042876 Bacteria 3225
420 Ga0466961_0883585 3300044693 Bacteria 532
421 Ga0466963_0140924 3300044694 Bacteria 1670
422 Ga0451576_1296323 3300045051 Bacteria 759
423 Ga0466967_0416696 3300045976 Bacteria 1308
424 Ga0495580_0044284 3300046472 Bacteria 3166
425 Ga0495630_1184741 3300046517 Unclassified 578
426 Ga0495642_0192907 3300046528 Bacteria 887
427 Ga0495656_0016781 3300046615 Bacteria 2784
428 Ga0495658_1006428 3300046683 Bacteria 532
429 Ga0495669_0033951 3300046684 Bacteria 2248
430 Ga0495676_0780661 3300047321 Bacteria 616
431 Ga0496102_0030942 3300048905 Bacteria 4794
432 Ga0496102_0414568 3300048905 Bacteria 1265
433 Ga0496103_0701051 3300048906 Bacteria 642
434 Ga0496104_1123837 3300048907 Bacteria 689
435 Ga0496106_0531718 3300048909 Bacteria 944
436 Ga0496106_1232227 3300048909 Bacteria 583
437 Ga0496109_0201352 3300048912 Bacteria 1872
438 Ga0496110_0181489 3300048913 Bacteria 1911
439 Ga0496110_1271922 3300048913 Unclassified 645
440 Ga0496110_1726680 3300048913 Bacteria 536
441 Ga0496112_0464073 3300048915 Bacteria 1204
442 Ga0496112_0477336 3300048915 Bacteria 1184
443 Ga0496112_0504725 3300048915 Bacteria 1145
444 Ga0496126_0000542 3300048929 Bacteria 73066
445 Ga0501031_0398202 3300049568 Bacteria 891
446 Ga0501033_0307133 3300049570 Bacteria 1116
447 Ga0501033_0637870 3300049570 Bacteria 728
448 Ga0501034_0067147 3300049571 Bacteria 3600
449 Ga0501034_0622285 3300049571 Bacteria 983
450 Ga0501037_0865877 3300049573 Bacteria 594
451 Ga0501039_0262344 3300049575 Bacteria 1358
452 Ga0501039_0306689 3300049575 Bacteria 1248
453 Ga0501040_0028161 3300049576 Bacteria 3787
454 Ga0501040_0330051 3300049576 Bacteria 1091
455 Ga0501040_0392680 3300049576 Bacteria 996
456 Ga0501040_0824547 3300049576 Bacteria 671
457 Ga0501041_0066317 3300049577 Bacteria 2212
458 Ga0501041_0088777 3300049577 Bacteria 1908
459 Ga0501041_1023574 3300049577 Bacteria 532
460 Ga0501042_0044758 3300049578 Bacteria 3154
461 Ga0501042_0046355 3300049578 Bacteria 3099
462 Ga0501042_0126848 3300049578 Bacteria 1838
463 Ga0501042_0319750 3300049578 Bacteria 1121
464 Ga0501043_0040166 3300049579 Bacteria 3678
465 Ga0501043_0154525 3300049579 Bacteria 1795
466 Ga0501046_0711768 3300049580 Bacteria 707
467 Ga0501048_0539972 3300049582 Bacteria 836
468 Ga0501048_1073268 3300049582 Bacteria 579
469 Ga0501067_0029905 3300049583 Bacteria 3020
470 Ga0501067_0208101 3300049583 Bacteria 1089
471 Ga0501069_0535089 3300049585 Bacteria 700
472 Ga0501070_0760176 3300049586 Bacteria 763
473 Ga0501071_0086744 3300049587 Bacteria 2296
474 Ga0501071_0142993 3300049587 Bacteria 1782
475 Ga0501071_0248662 3300049587 Bacteria 1342
476 Ga0501071_0349190 3300049587 Bacteria 1126
477 Ga0501072_0003436 3300049588 Bacteria 11930
478 Ga0501072_0036303 3300049588 Bacteria 3864
479 Ga0501073_0214551 3300049589 Bacteria 1330
480 Ga0501074_0152821 3300049590 Bacteria 1650
481 Ga0501074_0246361 3300049590 Bacteria 1271
482 Ga0501074_0251746 3300049590 Bacteria 1256
483 Ga0501074_0410716 3300049590 Bacteria 960
484 Ga0501075_0167003 3300049591 Bacteria 1679
485 Ga0501075_0194825 3300049591 Bacteria 1546
486 Ga0501075_0201238 3300049591 Bacteria 1519
487 Ga0501076_0066068 3300049592 Bacteria 2886
488 Ga0501076_0129604 3300049592 Bacteria 2045
489 Ga0501076_0793149 3300049592 Bacteria 781
490 Ga0501076_1254227 3300049592 Unclassified 610
491 Ga0501077_0003538 3300049593 Bacteria 9385
492 Ga0501077_0093271 3300049593 Bacteria 1908
493 Ga0501077_0280342 3300049593 Bacteria 1061
494 Ga0501079_0112204 3300049741 Bacteria 2119
495 Ga0501079_0201320 3300049741 Bacteria 1555
496 Ga0501079_0407614 3300049741 Bacteria 1066
497 Ga0501080_0292858 3300049742 Bacteria 1478
498 Ga0501080_0309554 3300049742 Bacteria 1432
499 Ga0501080_0563094 3300049742 Bacteria 1014
500 Ga0501080_0670929 3300049742 Bacteria 916
501 Ga0501080_0767660 3300049742 Bacteria 847
502 Ga0501080_1181898 3300049742 Bacteria 658
503 Ga0501081_0008663 3300049743 Bacteria 6609
504 Ga0501081_0066135 3300049743 Bacteria 2514
505 Ga0501045_0043189 3300049824 Bacteria 3282
506 Ga0501045_0547993 3300049824 Bacteria 858
507 nmdc:mga03683_138209_c1 3300050489 Bacteria 1094
508 nmdc:mga03683_14615_c2 3300050489 Bacteria 1564
509 nmdc:mga03683_46688_c1 3300050489 Bacteria 1795
510 nmdc:mga00v17_90068_c1 3300050491 Bacteria 1925
511 nmdc:mga0yw44_13436_c1 3300050492 Bacteria 4312
512 nmdc:mga0yw44_443293_c1 3300050492 Bacteria 880
513 nmdc:mga06z11_847936_c1 3300050494 Bacteria 557
514 nmdc:mga07m45_10354_c1 3300050496 Bacteria 4868
515 nmdc:mga05p37_130717_c1 3300050507 Bacteria 3081
516 nmdc:mga05p37_27566_c1 3300050507 Bacteria 6916
517 nmdc:mga05p37_426570_c1 3300050507 Bacteria 1542
518 nmdc:mga05p37_60713_c1 3300050507 Bacteria 4654
519 nmdc:mga09592_15526_c1 3300050508 Bacteria 6225
520 nmdc:mga09592_351190_c1 3300050508 Bacteria 1276
521 nmdc:mga09592_35657_c1 3300050508 Bacteria 4165
522 nmdc:mga09592_3951_c1 3300050508 Bacteria 11943
523 nmdc:mga09592_738186_c1 3300050508 Bacteria 836
524 nmdc:mga0qj67_11447_c1 3300050509 Bacteria 6646
525 nmdc:mga0qj67_2422_c1 3300050509 Bacteria 13284
526 nmdc:mga0qj67_29608_c1 3300050509 Bacteria 4253
527 nmdc:mga0qj67_57744_c1 3300050509 Bacteria 3077
528 nmdc:mga0qj67_76043_c1 3300050509 Bacteria 2685
529 nmdc:mga06r32_102890_c1 3300050510 Bacteria 2804
530 nmdc:mga06r32_1229033_c1 3300050510 Bacteria 695
531 nmdc:mga06r32_1392999_c1 3300050510 Bacteria 643
532 nmdc:mga06r32_1603636_c1 3300050510 Bacteria 589
533 nmdc:mga06r32_28706_c1 3300050510 Bacteria 5209
534 nmdc:mga06r32_5568_c1 3300050510 Bacteria 11344
535 nmdc:mga06r32_56631_c1 3300050510 Bacteria 3764
536 nmdc:mga06r32_583101_c1 3300050510 Bacteria 1090
537 nmdc:mga06r32_596795_c1 3300050510 Bacteria 1075
538 nmdc:mga08y16_1784493_c1 3300050511 Bacteria 569
539 nmdc:mga08y16_407242_c1 3300050511 Bacteria 1391
540 nmdc:mga08y16_57308_c1 3300050511 Bacteria 4072
541 nmdc:mga08y16_69214_c1 3300050511 Bacteria 3679
542 nmdc:mga0n895_11687_c1 3300050512 Bacteria 7845
543 nmdc:mga0n895_143754_c1 3300050512 Bacteria 2415
544 nmdc:mga0n895_1508886_c1 3300050512 Unclassified 638
545 nmdc:mga0n895_276360_c1 3300050512 Bacteria 1703
546 nmdc:mga0n895_41826_c1 3300050512 Bacteria 4456
547 nmdc:mga0n895_5773_c1 3300050512 Bacteria 10391
548 nmdc:mga0rr50_132002_c1 3300050513 Bacteria 2001
549 nmdc:mga0rr50_27342_c1 3300050513 Bacteria 3992
550 nmdc:mga0rr50_60706_c1 3300050513 Bacteria 2845
551 nmdc:mga0rr50_85917_c1 3300050513 Bacteria 2439
552 nmdc:mga0rr50_903291_c1 3300050513 Bacteria 753
553 nmdc:mga08x19_156957_c1 3300050514 Bacteria 1543
554 nmdc:mga08x19_28986_c1 3300050514 Bacteria 3471
555 nmdc:mga08x19_422197_c1 3300050514 Bacteria 937
556 nmdc:mga08x19_80_c1 3300050514 Bacteria 87696
557 nmdc:mga0a205_102702_c1 3300050515 Bacteria 2757
558 nmdc:mga0a205_112240_c2 3300050515 Bacteria 1312
559 nmdc:mga0a205_667096_c1 3300050515 Bacteria 891
560 nmdc:mga0sz30_432890_c1 3300050516 Bacteria 590
561 nmdc:mga0sz30_58_c2 3300050516 Bacteria 30385
562 Ga0500651_0062690 3300053093 Bacteria 2321
563 Ga0500641_0001068 3300053096 Bacteria 9770
564 Ga0500588_0368219 3300053146 Bacteria 547
565 Ga0501084_0045823 3300054114 Bacteria 3660
566 Ga0501084_0089777 3300054114 Bacteria 2579
567 Ga0501084_0161271 3300054114 Bacteria 1892
568 Ga0501084_0167170 3300054114 Bacteria 1856
569 Ga0501084_1183104 3300054114 Bacteria 641
570 Ga0590077_015530 3300059426 Bacteria 1593
571 Ga0590077_102318 3300059426 Unclassified 670
572 Ga0587088_201583 3300059508 Bacteria 509
573 Ga0501082_0036960 3300060353 Bacteria 4207
574 Ga0501082_0141546 3300060353 Bacteria 2088
575 Ga0501082_0247337 3300060353 Bacteria 1552
576 Ga0501082_0630013 3300060353 Bacteria 938
577 Ga0530510_0041994 3300061734 Bacteria 3303
578 Ga0530510_0657059 3300061734 Bacteria 798
579 Ga0530510_0752108 3300061734 Unclassified 743
580 2510320010 2510065059 Bacteria 6847884
581 Ga0070691_10002583
582 rootH2_10173009
583 JGI25405J52794_10045692
584 Ga0070670_100478188
585 Ga0070666_10158437
586 Ga0070680_100014789
587 Ga0070660_100468113
588 Ga0070689_100109284
589 Ga0070689_100776939
590 Ga0070661_101650252
591 Ga0070692_10284116
592 Ga0070668_100315540
593 Ga0070669_100168406
594 Ga0070675_100809192
595 Ga0070674_100603112
596 Ga0070659_101830746
597 Ga0070667_100099493
598 Ga0070667_102271993
599 Ga0070709_10000178
600 Ga0070709_10007302
601 Ga0070709_10011309
602 Ga0070714_100054496
603 Ga0070714_100062730
604 Ga0070714_100104698
605 Ga0070714_100281725
606 Ga0070713_100000124
607 Ga0070713_100004153
608 Ga0070713_100130451
609 Ga0070713_100665401
610 Ga0070710_10001866
611 Ga0070710_10029440
612 Ga0070710_10535861
613 Ga0070711_100097738
614 Ga0070711_100133892
615 Ga0070711_100208227
616 Ga0070711_100348605
617 Ga0070711_100359966
618 Ga0070705_100191008
619 Ga0070705_100810670
620 Ga0070694_100474457
621 Ga0070694_100562025
622 Ga0070694_100584394
623 Ga0070708_100089574
624 Ga0070708_100266506
625 Ga0070662_100839811
626 Ga0070662_100863832
627 Ga0068867_100375648
628 Ga0068867_101098244
629 Ga0070706_100053692
630 Ga0070706_100851458
631 Ga0070706_101476436
632 Ga0070707_100365903
633 Ga0070707_100566000
634 Ga0070698_100006633
635 Ga0070698_100515868
636 Ga0070698_101483028
637 Ga0070698_101579596
638 Ga0070699_100032023
639 Ga0070699_100158741
640 Ga0070699_100781452
641 Ga0070679_100819399
642 Ga0070684_100320721
643 Ga0070697_100078116
644 Ga0070697_100195077
645 Ga0070697_100289097
646 Ga0068853_100002258
647 Ga0070695_100016387
648 Ga0070695_100043439
649 Ga0070695_100657760
650 Ga0070696_100068951
651 Ga0070696_100599842
652 Ga0070696_100777126
653 Ga0070693_100584528
654 Ga0070665_100211428
655 Ga0070704_100037007
656 Ga0070704_101449432
657 Ga0070704_101856805
658 Ga0068855_100132508
659 Ga0068855_100614929
660 Ga0070664_100210067
661 Ga0070664_100814082
662 Ga0068857_100001203
663 Ga0068857_100013618
664 Ga0068854_100193495
665 Ga0068856_100000460
666 Ga0068856_100005976
667 Ga0068856_102566484
668 Ga0070702_100169274
669 Ga0068859_100149778
670 Ga0068859_101888139
671 Ga0068866_10446425
672 Ga0068866_10448659
673 Ga0068861_101196031
674 Ga0068861_102353296
675 Ga0068863_100728495
676 Ga0068858_100049519
677 Ga0068858_100106261
678 Ga0068860_100417703
679 Ga0068862_100785376
680 Ga0081455_10008576
681 Ga0081455_10171353
682 Ga0081455_10563355
683 Ga0081538_10088212
684 Ga0081540_1026284
685 Ga0081540_1099465
686 Ga0081539_10002714
687 Ga0058708_1000484
688 Ga0070717_10036079
689 Ga0070717_10523722
690 Ga0075365_10119036
691 Ga0075365_10139785
692 Ga0075365_10250266
693 Ga0075365_10418098
694 Ga0075364_10040668
695 Ga0070715_10127480
696 Ga0070716_100114470
697 Ga0070716_101077055
698 Ga0070712_100001107
699 Ga0070712_100053176
700 Ga0070712_100117034
701 Ga0070712_100187326
702 Ga0070712_100268351
703 Ga0070712_100563041
704 Ga0075362_10041973
705 Ga0075362_10061883
706 Ga0075362_10079105
707 Ga0075362_10369925
708 Ga0075369_10010235
709 Ga0075369_10048289
710 Ga0075370_10178976
711 Ga0075428_100004708
712 Ga0075428_100013010
713 Ga0075428_100032439
714 Ga0075428_100057089
715 Ga0075428_100101001
716 Ga0075428_101649133
717 Ga0075430_100010288
718 Ga0075430_100011593
719 Ga0075430_100023606
720 Ga0075430_100024377
721 Ga0075430_100655556
722 Ga0075431_100000728
723 Ga0075431_100005126
724 Ga0075431_100047259
725 Ga0075431_100059939
726 Ga0075431_100140061
727 Ga0075431_100218562
728 Ga0075431_100626439
729 Ga0075431_100633472
730 Ga0075433_10087965
731 Ga0075433_10139872
732 Ga0075433_10183133
733 Ga0075434_100040969
734 Ga0075434_100175856
735 Ga0075434_100177692
736 Ga0075434_100192031
737 Ga0075434_100306269
738 Ga0075434_100343165
739 Ga0075434_101080101
740 Ga0075429_100000162
741 Ga0075429_100005303
742 Ga0075429_100048047
743 Ga0075429_100247198
744 Ga0075429_100292318
745 Ga0075429_100422874
746 Ga0075429_100516322
747 Ga0068865_100181360
748 Ga0068865_101421635
749 Ga0075436_100000327
750 Ga0075436_100006815
751 Ga0075436_100400376
752 Ga0097620_100149775
753 Ga0097620_101888086
754 Ga0075435_100027110
755 Ga0075435_100240300
756 Ga0075435_100488949
757 Ga0075435_100761143
758 Ga0075435_101588211
759 Ga0099794_10111716
760 Ga0099794_10197412
761 Ga0105240_10007008
762 Ga0105240_10338613
763 Ga0111539_10069618
764 Ga0111539_10325127
765 Ga0111539_11137719
766 Ga0111539_12756935
767 Ga0114129_10018601
768 Ga0114129_10044297
769 Ga0114129_10057268
770 Ga0114129_10078679
771 Ga0114129_10600842
772 Ga0114129_11016594
773 Ga0114129_11516882
774 Ga0105243_10808081
775 Ga0105241_10077682
776 Ga0105241_10223689
777 Ga0105241_10257453
778 Ga0105242_10374938
779 Ga0105242_11878557
780 Ga0105248_10095460
781 Ga0105248_10572705
782 Ga0105237_10006558
783 Ga0105237_11268263
784 Ga0105238_10004483
785 Ga0105238_11504389
786 Ga0105238_12404222
787 Ga0105249_11178447
788 Ga0105148_118467
789 Ga0099796_10139449
790 Ga0099796_10171502
791 Ga0105239_10120837
792 Ga0105239_10654130
793 Ga0105246_12388010
794 Ga0157313_1017259
795 Ga0157373_10002085
796 Ga0157370_10001806
797 Ga0157370_10653592
798 Ga0157369_10016617
799 Ga0157378_10149738
800 Ga0157378_10415022
801 Ga0157378_11233115
802 Ga0157378_11530091
803 Ga0163162_10495615
804 Ga0163162_11089496
805 Ga0157372_10004919
806 Ga0163163_10283162
807 Ga0163163_10287012
808 Ga0163163_10882238
809 Ga0163163_13035026
810 Ga0157380_10316188
811 Ga0157380_12680052
812 Ga0182008_10270790
813 Ga0182008_10411071
814 Ga0157377_11013243
815 Ga0157379_10002063
816 Ga0157379_10029493
817 Ga0157379_10053549
818 Ga0157379_10632402
819 Ga0157376_12541864
820 Ga0182007_10106805
821 Ga0184598_126843
822 Ga0213873_10042074
823 Ga0213872_10022935
824 Ga0213874_10218503
825 Ga0213875_10012274
826 Ga0207426_1036963
827 Ga0207692_10009951
828 Ga0207692_10028005
829 Ga0207692_10036367
830 Ga0207680_10005296
831 Ga0207699_10000207
832 Ga0207699_10004102
833 Ga0207699_10530433
834 Ga0207645_10397744
835 Ga0207684_10045840
836 Ga0207684_10734038
837 Ga0207654_10052102
838 Ga0207654_10274031
839 Ga0207707_10602817
840 Ga0207695_10018348
841 Ga0207695_10317793
842 Ga0207671_10032698
843 Ga0207671_10728700
844 Ga0207693_10000957
845 Ga0207693_10001241
846 Ga0207693_10014949
847 Ga0207693_10135646
848 Ga0207693_10269701
849 Ga0207693_10418943
850 Ga0207663_10084207
851 Ga0207663_10098067
852 Ga0207663_10103460
853 Ga0207663_10599343
854 Ga0207660_10020040
855 Ga0207662_10485706
856 Ga0207649_11254196
857 Ga0207652_10103820
858 Ga0207652_11249498
859 Ga0207646_10099548
860 Ga0207646_10875735
861 Ga0207681_10313265
862 Ga0207694_10005891
863 Ga0207700_10000048
864 Ga0207700_10344670
865 Ga0207700_10599960
866 Ga0207664_10045762
867 Ga0207664_10554219
868 Ga0207664_11240822
869 Ga0207664_11396693
870 Ga0207706_10393973
871 Ga0207670_10336852
872 Ga0207704_10129675
873 Ga0207665_10038856
874 Ga0207665_10080365
875 Ga0207665_10175023
876 Ga0207679_10664658
877 Ga0207667_10013361
878 Ga0207668_10499744
879 Ga0207658_10903008
880 Ga0207703_10258731
881 Ga0207703_11132466
882 Ga0207639_10265435
883 Ga0207708_11058548
884 Ga0207702_10000148
885 Ga0207702_10014202
886 Ga0207641_10565139
887 Ga0207676_11061042
888 Ga0207674_10000223
889 Ga0207674_10008695
890 Ga0207675_100122672
891 Ga0207675_102536555
892 Ga0207698_10125502
893 Ga0209995_1045774
894 Ga0209588_1102326
895 Ga0209966_1104891
896 Ga0207428_10020606
897 Ga0207428_10326933
898 Ga0268265_10117976
899 Ga0268265_11398992
900 Ga0268264_10212418
901 Ga0268264_11283032
902 Ga0265338_10024007
903 Ga0265338_10284673
904 Ga0265332_10171794
905 Ga0265332_10259384
906 Ga0265320_10008309
907 Ga0265325_10003807
908 Ga0265325_10025385
909 Ga0265329_10024115
910 Ga0265329_10138932
911 Ga0265340_10374729
912 Ga0265340_10412314
913 Ga0265339_10004089
914 Ga0265339_10282713
915 Ga0265331_10139955
916 Ga0265316_10020886
917 Ga0307408_100292890
918 Ga0307408_100340291
919 Ga0307408_100353259
920 Ga0307408_101144815
921 Ga0265313_10002670
922 Ga0265313_10227472
923 Ga0265314_10006392
924 Ga0265314_10332665
925 Ga0307405_10418307
926 Ga0307405_11320751
927 Ga0307410_10041590
928 Ga0307412_11628621
929 Ga0307409_100485366
930 Ga0307416_100123840
931 Ga0307416_101284485
932 Ga0307414_10748553
933 Ga0307411_10068173
934 Ga0373926_0080319
935 Ga0373928_0025500
936 Ga0373940_0240098
937 Ga0373952_0268177
938 Ga0373923_0293963
939 Ga0373923_0464980
940 Ga0373932_0005587
941 Ga0373932_0318943
942 Ga0373936_0334771
943 Ga0373939_0152878
944 Ga0373939_0502204
945 Ga0373941_0008281
946 Ga0373941_0348542
947 Ga0373941_0413522
948 Ga0373945_0137566
949 Ga0373953_0250115
950 Ga0373956_0040210
951 Ga0373960_0109146
952 Ga0373955_0150046
953 Ga0373955_0571024
954 Ga0373942_0153898
955 Ga0373961_0131434
956 Ga0373962_0093694
957 Ga0373924_0329244
958 Ga0373931_0003552
959 Ga0373931_0030779
960 Ga0373931_0041637
961 Ga0373935_0086812
962 Ga0373935_0443697
963 Ga0373927_0055914
964 Ga0373933_0242667
965 Ga0373933_0276826
966 Ga0373937_0006715
967 Ga0373937_0029163
968 Ga0373937_0069855
969 Ga0373937_0600811
970 Ga0373925_0106334
971 Ga0373925_0146984
972 Ga0395899_0037640
973 Ga0395900_0013259
974 Ga0395898_0021330
975 Ga0436364_0167291
976 Ga0436364_0403390
977 Ga0395901_0000587
978 Ga0395901_0606436
979 Ga0436365_1118349
980 Ga0436365_1931146
981 Ga0436360_0254091
982 Ga0436360_0856540
983 Ga0436360_1028536
984 Ga0436361_0173721
985 Ga0436361_0736977
986 Ga0436363_0252336
987 Ga0436363_1427430
988 Ga0436363_1585727
989 Ga0436362_0408770
990 Ga0436362_0428954
991 Ga0436362_0439030
992 Ga0436362_0634383
993 Ga0436362_0826564
994 Ga0436362_0958168
995 Ga0439461_0100961
996 Ga0439465_0123050
997 Ga0439458_0124677
998 Ga0439444_0058494
999 Ga0451577_0066128
1000 Ga0466961_0883585
1001 Ga0466963_0140924
1002 Ga0451576_1296323
1003 Ga0466967_0416696
1004 Ga0495580_0044284
1005 Ga0495630_1184741
1006 Ga0495642_0192907
1007 Ga0495656_0016781
1008 Ga0495658_1006428
1009 Ga0495669_0033951
1010 Ga0495676_0780661
1011 Ga0496102_0030942
1012 Ga0496102_0414568
1013 Ga0496103_0701051
1014 Ga0496104_1123837
1015 Ga0496106_0531718
1016 Ga0496106_1232227
1017 Ga0496109_0201352
1018 Ga0496110_0181489
1019 Ga0496110_1271922
1020 Ga0496110_1726680
1021 Ga0496112_0464073
1022 Ga0496112_0477336
1023 Ga0496112_0504725
1024 Ga0496126_0000542
1025 Ga0501031_0398202
1026 Ga0501033_0307133
1027 Ga0501033_0637870
1028 Ga0501034_0067147
1029 Ga0501034_0622285
1030 Ga0501037_0865877
1031 Ga0501039_0262344
1032 Ga0501039_0306689
1033 Ga0501040_0028161
1034 Ga0501040_0330051
1035 Ga0501040_0392680
1036 Ga0501040_0824547
1037 Ga0501041_0066317
1038 Ga0501041_0088777
1039 Ga0501041_1023574
1040 Ga0501042_0044758
1041 Ga0501042_0046355
1042 Ga0501042_0126848
1043 Ga0501042_0319750
1044 Ga0501043_0040166
1045 Ga0501043_0154525
1046 Ga0501046_0711768
1047 Ga0501048_0539972
1048 Ga0501048_1073268
1049 Ga0501067_0029905
1050 Ga0501067_0208101
1051 Ga0501069_0535089
1052 Ga0501070_0760176
1053 Ga0501071_0086744
1054 Ga0501071_0142993
1055 Ga0501071_0248662
1056 Ga0501071_0349190
1057 Ga0501072_0003436
1058 Ga0501072_0036303
1059 Ga0501073_0214551
1060 Ga0501074_0152821
1061 Ga0501074_0246361
1062 Ga0501074_0251746
1063 Ga0501074_0410716
1064 Ga0501075_0167003
1065 Ga0501075_0194825
1066 Ga0501075_0201238
1067 Ga0501076_0066068
1068 Ga0501076_0129604
1069 Ga0501076_0793149
1070 Ga0501076_1254227
1071 Ga0501077_0003538
1072 Ga0501077_0093271
1073 Ga0501077_0280342
1074 Ga0501079_0112204
1075 Ga0501079_0201320
1076 Ga0501079_0407614
1077 Ga0501080_0292858
1078 Ga0501080_0309554
1079 Ga0501080_0563094
1080 Ga0501080_0670929
1081 Ga0501080_0767660
1082 Ga0501080_1181898
1083 Ga0501081_0008663
1084 Ga0501081_0066135
1085 Ga0501045_0043189
1086 Ga0501045_0547993
1087 nmdc:mga03683_138209_c1
1088 nmdc:mga03683_14615_c2
1089 nmdc:mga03683_46688_c1
1090 nmdc:mga00v17_90068_c1
1091 nmdc:mga0yw44_13436_c1
1092 nmdc:mga0yw44_443293_c1
1093 nmdc:mga06z11_847936_c1
1094 nmdc:mga07m45_10354_c1
1095 nmdc:mga05p37_130717_c1
1096 nmdc:mga05p37_27566_c1
1097 nmdc:mga05p37_426570_c1
1098 nmdc:mga05p37_60713_c1
1099 nmdc:mga09592_15526_c1
1100 nmdc:mga09592_351190_c1
1101 nmdc:mga09592_35657_c1
1102 nmdc:mga09592_3951_c1
1103 nmdc:mga09592_738186_c1
1104 nmdc:mga0qj67_11447_c1
1105 nmdc:mga0qj67_2422_c1
1106 nmdc:mga0qj67_29608_c1
1107 nmdc:mga0qj67_57744_c1
1108 nmdc:mga0qj67_76043_c1
1109 nmdc:mga06r32_102890_c1
1110 nmdc:mga06r32_1229033_c1
1111 nmdc:mga06r32_1392999_c1
1112 nmdc:mga06r32_1603636_c1
1113 nmdc:mga06r32_28706_c1
1114 nmdc:mga06r32_5568_c1
1115 nmdc:mga06r32_56631_c1
1116 nmdc:mga06r32_583101_c1
1117 nmdc:mga06r32_596795_c1
1118 nmdc:mga08y16_1784493_c1
1119 nmdc:mga08y16_407242_c1
1120 nmdc:mga08y16_57308_c1
1121 nmdc:mga08y16_69214_c1
1122 nmdc:mga0n895_11687_c1
1123 nmdc:mga0n895_143754_c1
1124 nmdc:mga0n895_1508886_c1
1125 nmdc:mga0n895_276360_c1
1126 nmdc:mga0n895_41826_c1
1127 nmdc:mga0n895_5773_c1
1128 nmdc:mga0rr50_132002_c1
1129 nmdc:mga0rr50_27342_c1
1130 nmdc:mga0rr50_60706_c1
1131 nmdc:mga0rr50_85917_c1
1132 nmdc:mga0rr50_903291_c1
1133 nmdc:mga08x19_156957_c1
1134 nmdc:mga08x19_28986_c1
1135 nmdc:mga08x19_422197_c1
1136 nmdc:mga08x19_80_c1
1137 nmdc:mga0a205_102702_c1
1138 nmdc:mga0a205_112240_c2
1139 nmdc:mga0a205_667096_c1
1140 nmdc:mga0sz30_432890_c1
1141 nmdc:mga0sz30_58_c2
1142 Ga0500651_0062690
1143 Ga0500641_0001068
1144 Ga0500588_0368219
1145 Ga0501084_0045823
1146 Ga0501084_0089777
1147 Ga0501084_0161271
1148 Ga0501084_0167170
1149 Ga0501084_1183104
1150 Ga0590077_015530
1151 Ga0590077_102318
1152 Ga0587088_201583
1153 Ga0501082_0036960
1154 Ga0501082_0141546
1155 Ga0501082_0247337
1156 Ga0501082_0630013
1157 Ga0530510_0041994
1158 Ga0530510_0657059
1159 Ga0530510_0752108
1160 2510320010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

65

124

0.98

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

28

64

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.9166 25 138
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8859 38 65
4ddx-assembly2.cif.gz_B thermotoga maritima reverse gyrase, primitive monoclinic form 0.8608 38 65
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.858 25 138
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.8533 18 137
ID Description Score Start End Superfamily
af_F4JA83_7_85_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8257 71 105 2.40.50.140
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8087 72 105 2.30.30.30
3a5zF01 Mainly Beta;Roll;SH3 type barrels.; 0.8019 72 104 2.30.30.30
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7838 72 105 2.30.30.30
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.7826 20 67 6.10.30.10
ID Description Score Start End GO Terms
AF-A0A2A4Z8U5-F1-model_v4 DNA-binding protein 0.96 12 138 GO:0003677
AF-A0A4Q3T9D0-F1-model_v4 Zn-ribbon domain-containing OB-fold protein 0.9577 30 138
AF-A0A7Y4GZ11-F1-model_v4 DNA-binding protein 0.957 21 138
AF-A0A4Y6S2D8-F1-model_v4 Zn-ribbon domain-containing OB-fold protein 0.9558 11 138
AF-A0A6L7GD82-F1-model_v4 DNA-binding protein 0.9492 10 138

Map