F465854

General Info

Members Datasets Scaffolds Average Seq Length
579 329 1158 98

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_1559368|Ga0451802_1559368_211_552
Length 113
Sequence VVLKSDYRPTGVDEVPSISRDEVAHLAKLARLAVTDDELDLFAGQLDVILQSVSAVGDIATADIPPTSHAVPLTNVFREDVVRPSLGQQQALSGAPEAEDGRFRVPRILGEEA

Samples

Sample ID Description Type Environment
1 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
86 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
163 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
164 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
165 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
277 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 2506783011 Frankia datiscae Dg1 Isolate Nodule
281 2508501039 Frankia saprophytica CN3 Isolate Nodule
282 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
283 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
284 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
285 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
286 2558860280 Kutzneria sp. 744 Isolate Unclassified
287 2643221604 Nocardioides sp. Root190 Isolate Unclassified
288 2671180195 Frankia sp. CcI49 Isolate Nodule
289 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
290 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
291 2687453737 Frankia sp. BMG5.36 Isolate Nodule
292 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
293 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
294 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
295 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
296 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
297 2773857922 Frankia sp. CcI49 Isolate Nodule
298 2773857933 Frankia sp. BMG5.30 Isolate Nodule
299 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
300 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
301 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
302 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
303 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
304 2855683550 Micromonospora sp. RP3T Isolate Unclassified
305 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
306 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
307 2858882152 Micromonospora noduli MED15 Isolate Nodule
308 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
309 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
310 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
311 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
312 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
313 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
314 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
315 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
316 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
317 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
318 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
319 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
320 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
321 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
322 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
323 8002784119 Frankia sp. AgB1.9 Isolate Nodule
324 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
325 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
326 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
327 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
328 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
329 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.81
Metatranscriptomes 1.55
Isolates 8.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 2.59
Rhizoplane 4.84
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451802_1559368 3300041460 Bacteria 683
2 JGI25406J46586_10070473 3300003203 Bacteria 1099
3 rootL2_10206982 3300003322 Bacteria 1235
4 JGI25405J52794_10019213 3300003911 Bacteria 1369
5 Ga0070658_10029434 3300005327 Bacteria 4412
6 Ga0070658_11767045 3300005327 Bacteria 535
7 Ga0070683_100018351 3300005329 Bacteria 6194
8 Ga0070683_100228864 3300005329 Bacteria 1767
9 Ga0070683_101000509 3300005329 Bacteria 803
10 Ga0070690_100628524 3300005330 Bacteria 818
11 Ga0070690_100966911 3300005330 Bacteria 669
12 Ga0070670_100404771 3300005331 Bacteria 1205
13 Ga0070670_101362559 3300005331 Bacteria 650
14 Ga0070670_101648010 3300005331 Bacteria 590
15 Ga0070677_10020483 3300005333 Bacteria 2410
16 Ga0068869_100001538 3300005334 Bacteria 13707
17 Ga0070666_10745476 3300005335 Bacteria 720
18 Ga0070680_100060051 3300005336 Bacteria 3112
19 Ga0070680_100122237 3300005336 Bacteria 2174
20 Ga0070680_100633968 3300005336 Bacteria 918
21 Ga0070682_100263744 3300005337 Bacteria 1248
22 Ga0068868_100152512 3300005338 Bacteria 1904
23 Ga0068868_101528772 3300005338 Bacteria 625
24 Ga0070660_100503142 3300005339 Bacteria 1008
25 Ga0070660_101062645 3300005339 Bacteria 685
26 Ga0070689_101784205 3300005340 Bacteria 561
27 Ga0070691_10623396 3300005341 Bacteria 639
28 Ga0070687_100660985 3300005343 Bacteria 725
29 Ga0070661_100036772 3300005344 Bacteria 3559
30 Ga0070692_10019238 3300005345 Bacteria 3294
31 Ga0070668_100000160 3300005347 Bacteria 42522
32 Ga0070668_100007814 3300005347 Bacteria 7942
33 Ga0070668_100045885 3300005347 Bacteria 3353
34 Ga0070669_100291601 3300005353 Bacteria 1310
35 Ga0070675_100001479 3300005354 Bacteria 17330
36 Ga0070671_100898827 3300005355 Bacteria 774
37 Ga0070674_100052350 3300005356 Bacteria 2816
38 Ga0070674_101722304 3300005356 Bacteria 567
39 Ga0070659_100184589 3300005366 Bacteria 1712
40 Ga0070659_100970447 3300005366 Bacteria 745
41 Ga0070667_100646068 3300005367 Bacteria 977
42 Ga0070667_100694117 3300005367 Bacteria 941
43 Ga0070709_11020628 3300005434 Bacteria 659
44 Ga0070714_101398656 3300005435 Bacteria 683
45 Ga0070713_100260588 3300005436 Bacteria 1584
46 Ga0070710_10000403 3300005437 Bacteria 20257
47 Ga0070701_10047576 3300005438 Bacteria 2209
48 Ga0070711_101692423 3300005439 Bacteria 554
49 Ga0070700_100034616 3300005441 Bacteria 3052
50 Ga0070700_101702908 3300005441 Bacteria 541
51 Ga0070708_100105233 3300005445 Bacteria 2588
52 Ga0070708_100632750 3300005445 Bacteria 1008
53 Ga0070663_100561320 3300005455 Bacteria 955
54 Ga0070678_100066528 3300005456 Bacteria 2679
55 Ga0070662_100068676 3300005457 Bacteria 2606
56 Ga0070681_10147768 3300005458 Bacteria 2278
57 Ga0070707_100168549 3300005468 Bacteria 2134
58 Ga0070679_100088939 3300005530 Bacteria 3075
59 Ga0070679_100288728 3300005530 Bacteria 1592
60 Ga0070684_100006094 3300005535 Bacteria 9287
61 Ga0070684_100032232 3300005535 Bacteria 4466
62 Ga0070684_100202876 3300005535 Bacteria 1806
63 Ga0070684_100262001 3300005535 Bacteria 1582
64 Ga0070684_101436204 3300005535 Bacteria 650
65 Ga0070684_102245609 3300005535 Bacteria 515
66 Ga0068853_100501371 3300005539 Bacteria 1146
67 Ga0068853_101126437 3300005539 Bacteria 757
68 Ga0070686_100672867 3300005544 Bacteria 823
69 Ga0070686_100694533 3300005544 Bacteria 811
70 Ga0070686_101393478 3300005544 Bacteria 588
71 Ga0070693_100441494 3300005547 Bacteria 911
72 Ga0070693_101377608 3300005547 Bacteria 548
73 Ga0068855_100543881 3300005563 Bacteria 1258
74 Ga0068855_101396935 3300005563 Bacteria 722
75 Ga0068855_102204517 3300005563 Bacteria 553
76 Ga0070664_100021304 3300005564 Bacteria 5341
77 Ga0070664_100165384 3300005564 Bacteria 1960
78 Ga0070664_100205326 3300005564 Bacteria 1759
79 Ga0070664_101542737 3300005564 Bacteria 629
80 Ga0070664_102126592 3300005564 Bacteria 533
81 Ga0068857_100080420 3300005577 Bacteria 2910
82 Ga0068854_100106959 3300005578 Bacteria 2105
83 Ga0068854_100921347 3300005578 Bacteria 769
84 Ga0068856_100201066 3300005614 Bacteria 2007
85 Ga0068856_101305914 3300005614 Bacteria 741
86 Ga0068856_101384616 3300005614 Bacteria 718
87 Ga0068856_102092638 3300005614 Bacteria 576
88 Ga0068852_100239967 3300005616 Bacteria 1731
89 Ga0068852_101482607 3300005616 Bacteria 701
90 Ga0068859_100269864 3300005617 Bacteria 1793
91 Ga0068859_100611417 3300005617 Bacteria 1183
92 Ga0068859_100833618 3300005617 Bacteria 1009
93 Ga0068859_101636132 3300005617 Bacteria 711
94 Ga0068864_100162803 3300005618 Bacteria 2029
95 Ga0068866_11326766 3300005718 Bacteria 524
96 Ga0068861_100063792 3300005719 Bacteria 2832
97 Ga0068861_100623605 3300005719 Bacteria 993
98 Ga0068861_101128908 3300005719 Bacteria 755
99 Ga0068870_10817482 3300005840 Bacteria 652
100 Ga0068863_100004323 3300005841 Bacteria 14005
101 Ga0068863_100318303 3300005841 Bacteria 1511
102 Ga0068863_102594744 3300005841 Bacteria 516
103 Ga0068858_100000002 3300005842 Bacteria 351633
104 Ga0068858_100004824 3300005842 Bacteria 13211
105 Ga0068858_100040719 3300005842 Bacteria 4309
106 Ga0068858_100713116 3300005842 Bacteria 976
107 Ga0068858_100806753 3300005842 Bacteria 916
108 Ga0068860_100041417 3300005843 Bacteria 4399
109 Ga0068860_100224164 3300005843 Bacteria 1826
110 Ga0068860_100594438 3300005843 Bacteria 1112
111 Ga0068862_100060147 3300005844 Bacteria 3262
112 Ga0068862_100084610 3300005844 Bacteria 2756
113 Ga0081455_10000023 3300005937 Bacteria 159570
114 Ga0081455_10390594 3300005937 Bacteria 969
115 Ga0081538_10168936 3300005981 Bacteria 958
116 Ga0081540_1042249 3300005983 Bacteria 2353
117 Ga0081539_10004243 3300005985 Bacteria 16099
118 Ga0081539_10024724 3300005985 Bacteria 3888
119 Ga0081539_10466448 3300005985 Bacteria 523
120 Ga0070717_11183487 3300006028 Bacteria 696
121 Ga0070717_11857323 3300006028 Bacteria 544
122 Ga0075368_10181615 3300006042 Unclassified 887
123 Ga0075363_100224356 3300006048 Bacteria 1077
124 Ga0075363_100842176 3300006048 Bacteria 559
125 Ga0070715_10926113 3300006163 Bacteria 538
126 Ga0075428_100000237 3300006844 Bacteria 53795
127 Ga0075428_100377478 3300006844 Bacteria 1520
128 Ga0075428_100534484 3300006844 Bacteria 1254
129 Ga0075428_101348999 3300006844 Bacteria 749
130 Ga0075430_100000527 3300006846 Bacteria 28749
131 Ga0075430_101624781 3300006846 Bacteria 531
132 Ga0075431_100002315 3300006847 Bacteria 18297
133 Ga0075431_100101484 3300006847 Bacteria 2969
134 Ga0075431_101039836 3300006847 Bacteria 785
135 Ga0075431_101420644 3300006847 Bacteria 653
136 Ga0075431_101656790 3300006847 Bacteria 597
137 Ga0075433_10450102 3300006852 Bacteria 1135
138 Ga0075429_100000545 3300006880 Bacteria 28749
139 Ga0075429_101245266 3300006880 Bacteria 649
140 Ga0075429_101451823 3300006880 Bacteria 597
141 Ga0075429_101516943 3300006880 Unclassified 583
142 Ga0075429_101777168 3300006880 Bacteria 535
143 Ga0068865_100165016 3300006881 Bacteria 1693
144 Ga0097620_100269873 3300006931 Bacteria 1793
145 Ga0097620_100611472 3300006931 Bacteria 1183
146 Ga0097620_100833614 3300006931 Bacteria 1009
147 Ga0097620_101635967 3300006931 Bacteria 711
148 Ga0105240_12407838 3300009093 Bacteria 545
149 Ga0111539_10017377 3300009094 Bacteria 8903
150 Ga0111539_10614155 3300009094 Bacteria 1266
151 Ga0111539_11182359 3300009094 Bacteria 888
152 Ga0105245_10003995 3300009098 Bacteria 13105
153 Ga0105245_10916613 3300009098 Bacteria 918
154 Ga0114129_10001195 3300009147 Bacteria 34503
155 Ga0114129_10156037 3300009147 Bacteria 3121
156 Ga0114129_10409133 3300009147 Bacteria 1787
157 Ga0114129_10437740 3300009147 Bacteria 1717
158 Ga0114129_10638436 3300009147 Bacteria 1375
159 Ga0114129_13127150 3300009147 Bacteria 540
160 Ga0105243_11096979 3300009148 Bacteria 804
161 Ga0105248_10000038 3300009177 Bacteria 179916
162 Ga0105248_10000950 3300009177 Bacteria 32303
163 Ga0105248_11533191 3300009177 Bacteria 755
164 Ga0105237_10954472 3300009545 Bacteria 864
165 Ga0105237_11161197 3300009545 Bacteria 779
166 Ga0105237_12447743 3300009545 Bacteria 532
167 Ga0105238_10073355 3300009551 Bacteria 3417
168 Ga0105238_11122868 3300009551 Bacteria 809
169 Ga0105238_12070151 3300009551 Bacteria 603
170 Ga0105249_10908291 3300009553 Bacteria 948
171 Ga0105249_11280137 3300009553 Bacteria 805
172 Ga0105029_103358 3300009984 Bacteria 1069
173 Ga0105033_103169 3300009986 Bacteria 1377
174 Ga0105239_10993361 3300010375 Bacteria 965
175 Ga0105239_12266136 3300010375 Bacteria 632
176 Ga0105239_12277513 3300010375 Bacteria 630
177 Ga0157370_10208482 3300013104 Bacteria 1812
178 Ga0157369_10822296 3300013105 Bacteria 954
179 Ga0157374_12059740 3300013296 Bacteria 597
180 Ga0157378_11016624 3300013297 Bacteria 864
181 Ga0163162_11264856 3300013306 Bacteria 838
182 Ga0157372_12266181 3300013307 Bacteria 624
183 Ga0157375_12483763 3300013308 Bacteria 619
184 Ga0163163_10163688 3300014325 Bacteria 2270
185 Ga0163163_10246975 3300014325 Bacteria 1835
186 Ga0163163_10553855 3300014325 Bacteria 1212
187 Ga0163163_10838887 3300014325 Bacteria 982
188 Ga0163163_10984623 3300014325 Bacteria 906
189 Ga0157380_10499487 3300014326 Bacteria 1181
190 Ga0157377_10003412 3300014745 Bacteria 7190
191 Ga0157379_10000007 3300014968 Bacteria 142402
192 Ga0157379_11747695 3300014968 Bacteria 610
193 Ga0157379_12300074 3300014968 Bacteria 537
194 Ga0157376_11018595 3300014969 Bacteria 851
195 Ga0157376_11360035 3300014969 Bacteria 741
196 Ga0197907_10767926 3300020069 Bacteria 590
197 Ga0206356_10899913 3300020070 Bacteria 9839
198 Ga0206351_10995453 3300020077 Bacteria 582
199 Ga0206352_11318627 3300020078 Bacteria 1435
200 Ga0206350_10115848 3300020080 Bacteria 691
201 Ga0206354_10727073 3300020081 Bacteria 508
202 Ga0206354_10965762 3300020081 Bacteria 1638
203 Ga0206353_11603250 3300020082 Bacteria 8908
204 Ga0224712_10000637 3300022467 Bacteria 7164
205 Ga0207692_10000841 3300025898 Bacteria 11015
206 Ga0207710_10196705 3300025900 Bacteria 994
207 Ga0207647_10069750 3300025904 Bacteria 2124
208 Ga0207699_11224944 3300025906 Bacteria 556
209 Ga0207645_10914513 3300025907 Bacteria 596
210 Ga0207705_10058311 3300025909 Bacteria 2786
211 Ga0207705_10436567 3300025909 Bacteria 1014
212 Ga0207707_10035104 3300025912 Bacteria 4385
213 Ga0207671_10680446 3300025914 Bacteria 818
214 Ga0207660_10154044 3300025917 Bacteria 1768
215 Ga0207660_10791725 3300025917 Bacteria 774
216 Ga0207649_10064155 3300025920 Bacteria 2321
217 Ga0207649_10083729 3300025920 Bacteria 2071
218 Ga0207649_11039773 3300025920 Bacteria 645
219 Ga0207652_10094681 3300025921 Bacteria 2630
220 Ga0207652_11342730 3300025921 Bacteria 618
221 Ga0207652_11795655 3300025921 Bacteria 518
222 Ga0207646_10183125 3300025922 Bacteria 1892
223 Ga0207681_10140801 3300025923 Bacteria 1796
224 Ga0207694_10422665 3300025924 Bacteria 1110
225 Ga0207650_10516340 3300025925 Bacteria 999
226 Ga0207650_11510234 3300025925 Bacteria 571
227 Ga0207659_10007248 3300025926 Bacteria 6812
228 Ga0207687_10065614 3300025927 Bacteria 2578
229 Ga0207687_10790037 3300025927 Bacteria 809
230 Ga0207700_10043940 3300025928 Bacteria 3285
231 Ga0207700_10983845 3300025928 Bacteria 755
232 Ga0207664_10205267 3300025929 Bacteria 1703
233 Ga0207644_11642644 3300025931 Bacteria 539
234 Ga0207690_10730911 3300025932 Bacteria 815
235 Ga0207706_10100142 3300025933 Bacteria 2549
236 Ga0207706_10967238 3300025933 Bacteria 717
237 Ga0207709_10861450 3300025935 Bacteria 734
238 Ga0207669_10053653 3300025937 Bacteria 2430
239 Ga0207704_10410496 3300025938 Bacteria 1071
240 Ga0207691_10780290 3300025940 Bacteria 804
241 Ga0207711_10000680 3300025941 Bacteria 33744
242 Ga0207711_10000953 3300025941 Bacteria 27732
243 Ga0207689_10019371 3300025942 Bacteria 5736
244 Ga0207689_10316474 3300025942 Bacteria 1295
245 Ga0207661_10001908 3300025944 Bacteria 14300
246 Ga0207661_10014490 3300025944 Bacteria 5780
247 Ga0207661_10030828 3300025944 Bacteria 4135
248 Ga0207661_10299855 3300025944 Bacteria 1440
249 Ga0207661_10428953 3300025944 Bacteria 1202
250 Ga0207661_10560952 3300025944 Bacteria 1047
251 Ga0207679_10058294 3300025945 Bacteria 2860
252 Ga0207679_10188601 3300025945 Bacteria 1712
253 Ga0207679_10420747 3300025945 Bacteria 1179
254 Ga0207667_10474287 3300025949 Bacteria 1270
255 Ga0207651_12020550 3300025960 Bacteria 518
256 Ga0207712_10601515 3300025961 Bacteria 951
257 Ga0207668_10001171 3300025972 Bacteria 15594
258 Ga0207668_10154393 3300025972 Bacteria 1781
259 Ga0207668_10410243 3300025972 Bacteria 1147
260 Ga0207668_10797721 3300025972 Bacteria 836
261 Ga0207640_10242363 3300025981 Bacteria 1394
262 Ga0207677_10002903 3300026023 Bacteria 9056
263 Ga0207677_10148051 3300026023 Bacteria 1807
264 Ga0207703_10000001 3300026035 Bacteria 822925
265 Ga0207703_10031262 3300026035 Bacteria 4208
266 Ga0207703_10103132 3300026035 Bacteria 2421
267 Ga0207703_10760299 3300026035 Bacteria 924
268 Ga0207703_10968416 3300026035 Bacteria 816
269 Ga0207639_10030865 3300026041 Bacteria 3934
270 Ga0207639_10583216 3300026041 Bacteria 1030
271 Ga0207678_10015116 3300026067 Bacteria 6790
272 Ga0207678_10782513 3300026067 Bacteria 842
273 Ga0207708_10013251 3300026075 Bacteria 6156
274 Ga0207708_11363093 3300026075 Bacteria 622
275 Ga0207702_10158524 3300026078 Bacteria 2065
276 Ga0207702_10286410 3300026078 Bacteria 1559
277 Ga0207702_10967940 3300026078 Bacteria 844
278 Ga0207641_10000587 3300026088 Bacteria 39995
279 Ga0207641_10537852 3300026088 Bacteria 1138
280 Ga0207676_10184662 3300026095 Bacteria 1829
281 Ga0207676_10825550 3300026095 Bacteria 906
282 Ga0207676_11802120 3300026095 Bacteria 611
283 Ga0207674_10011286 3300026116 Bacteria 10041
284 Ga0207674_10101244 3300026116 Bacteria 2862
285 Ga0207675_100090391 3300026118 Bacteria 2879
286 Ga0207675_100595075 3300026118 Bacteria 1108
287 Ga0207675_101323474 3300026118 Bacteria 741
288 Ga0207683_10031335 3300026121 Bacteria 4614
289 Ga0207698_10773117 3300026142 Bacteria 961
290 Ga0207698_11426542 3300026142 Bacteria 707
291 Ga0209983_1003567 3300027665 Bacteria 3303
292 Ga0209974_10212659 3300027876 Bacteria 717
293 Ga0209974_10461805 3300027876 Unclassified 505
294 Ga0207428_10128931 3300027907 Bacteria 1936
295 Ga0268266_11154192 3300028379 Bacteria 749
296 Ga0268265_10023459 3300028380 Bacteria 4349
297 Ga0268265_10246948 3300028380 Bacteria 1578
298 Ga0268265_10489972 3300028380 Bacteria 1156
299 Ga0268265_12108905 3300028380 Bacteria 571
300 Ga0268264_10533797 3300028381 Bacteria 1149
301 Ga0268264_10708725 3300028381 Bacteria 1000
302 Ga0307511_10000622 3300030521 Bacteria 37906
303 Ga0316177_1031606 3300030731 Bacteria 3366
304 Ga0316177_1158667 3300030731 Bacteria 1044
305 Ga0316176_1072548 3300030732 Bacteria 5988
306 Ga0314311_1006147 3300030733 Bacteria 2346
307 Ga0316178_1179349 3300030735 Bacteria 1033
308 Ga0316181_1260717 3300030744 Bacteria 1206
309 Ga0307509_10008659 3300031507 Bacteria 12916
310 Ga0307509_10501567 3300031507 Bacteria 898
311 Ga0307408_101509172 3300031548 Bacteria 636
312 Ga0307508_10001989 3300031616 Bacteria 22344
313 Ga0307508_10023073 3300031616 Bacteria 5653
314 Ga0307508_10121391 3300031616 Bacteria 2216
315 Ga0307516_10263712 3300031730 Bacteria 1412
316 Ga0307405_10036765 3300031731 Bacteria 2937
317 Ga0307405_11029874 3300031731 Bacteria 704
318 Ga0307405_11042684 3300031731 Bacteria 700
319 Ga0307405_11172927 3300031731 Bacteria 663
320 Ga0307413_10078161 3300031824 Bacteria 2110
321 Ga0307413_10372215 3300031824 Bacteria 1110
322 Ga0307413_10563913 3300031824 Bacteria 926
323 Ga0307410_10143398 3300031852 Bacteria 1770
324 Ga0307410_10228707 3300031852 Bacteria 1435
325 Ga0307410_10300009 3300031852 Bacteria 1267
326 Ga0307410_10706349 3300031852 Bacteria 850
327 Ga0307410_10870808 3300031852 Bacteria 770
328 Ga0307406_10008816 3300031901 Bacteria 5636
329 Ga0307406_10619910 3300031901 Bacteria 894
330 Ga0307406_10877699 3300031901 Bacteria 762
331 Ga0307407_10022223 3300031903 Bacteria 3287
332 Ga0307407_10443027 3300031903 Bacteria 941
333 Ga0307407_10480677 3300031903 Bacteria 907
334 Ga0307407_10884792 3300031903 Bacteria 684
335 Ga0307407_11400562 3300031903 Bacteria 551
336 Ga0307412_10615268 3300031911 Bacteria 922
337 Ga0307409_100000846 3300031995 Bacteria 14094
338 Ga0307409_100069653 3300031995 Bacteria 2788
339 Ga0307409_100090581 3300031995 Bacteria 2504
340 Ga0307409_100141628 3300031995 Bacteria 2073
341 Ga0307409_100143416 3300031995 Bacteria 2062
342 Ga0307409_100218322 3300031995 Bacteria 1719
343 Ga0307409_100416798 3300031995 Bacteria 1287
344 Ga0307409_100499038 3300031995 Bacteria 1185
345 Ga0307409_100609173 3300031995 Bacteria 1080
346 Ga0307409_100644030 3300031995 Bacteria 1053
347 Ga0307409_100648446 3300031995 Bacteria 1049
348 Ga0307409_102172699 3300031995 Bacteria 585
349 Ga0307409_102341671 3300031995 Bacteria 563
350 Ga0307416_100000530 3300032002 Bacteria 19509
351 Ga0307416_100009854 3300032002 Bacteria 6280
352 Ga0307416_100326261 3300032002 Bacteria 1540
353 Ga0307416_100474660 3300032002 Bacteria 1309
354 Ga0307416_100533332 3300032002 Bacteria 1244
355 Ga0307416_101396577 3300032002 Bacteria 806
356 Ga0307416_101542407 3300032002 Bacteria 770
357 Ga0307414_10185804 3300032004 Bacteria 1677
358 Ga0307414_10379793 3300032004 Bacteria 1221
359 Ga0307411_10003091 3300032005 Bacteria 7613
360 Ga0307411_10216340 3300032005 Bacteria 1483
361 Ga0307411_10572553 3300032005 Bacteria 967
362 Ga0307411_11834141 3300032005 Bacteria 563
363 Ga0307411_12164884 3300032005 Bacteria 521
364 Ga0307415_100004242 3300032126 Bacteria 7412
365 Ga0307415_100038547 3300032126 Bacteria 3151
366 Ga0307415_100087504 3300032126 Bacteria 2245
367 Ga0307415_100126959 3300032126 Bacteria 1924
368 Ga0307415_101682975 3300032126 Bacteria 611
369 Ga0307415_101873566 3300032126 Bacteria 582
370 Ga0307507_10007702 3300033179 Bacteria 15397
371 Ga0307507_10023509 3300033179 Bacteria 6763
372 Ga0307507_10075062 3300033179 Bacteria 3027
373 Ga0373938_0001902 3300034957 Bacteria 3338
374 Ga0373932_0013201 3300035112 Bacteria 2049
375 Ga0373932_0154635 3300035112 Bacteria 789
376 Ga0373939_0087897 3300035114 Bacteria 1045
377 Ga0373939_0136325 3300035114 Bacteria 881
378 Ga0373942_0000264 3300035207 Bacteria 14026
379 Ga0373962_0001996 3300035242 Bacteria 4867
380 Ga0373931_0618650 3300035691 Bacteria 709
381 Ga0373931_1261562 3300035691 Bacteria 507
382 Ga0373935_0254293 3300035692 Bacteria 1230
383 Ga0373925_0092802 3300037068 Bacteria 2310
384 Ga0395899_0047738 3300037312 Bacteria 3187
385 Ga0395900_0092298 3300037418 Bacteria 3111
386 Ga0395900_0143223 3300037418 Bacteria 2446
387 Ga0395900_1367281 3300037418 Bacteria 621
388 Ga0395898_0094414 3300037466 Bacteria 2874
389 Ga0395905_0122745 3300037471 Bacteria 2442
390 Ga0395905_1109613 3300037471 Bacteria 694
391 Ga0395901_0001511 3300038443 Bacteria 24165
392 Ga0395901_0023849 3300038443 Bacteria 6275
393 Ga0436365_1008152 3300039437 Bacteria 1090
394 Ga0436365_1302022 3300039437 Bacteria 771
395 Ga0436365_1628087 3300039437 Bacteria 689
396 Ga0436363_1457761 3300039450 Bacteria 766
397 Ga0436362_0581146 3300039453 Bacteria 769
398 Ga0439453_0087829 3300041408 Bacteria 679
399 Ga0439465_0158341 3300041413 Bacteria 811
400 Ga0451791_1154513 3300041451 Bacteria 617
401 Ga0451791_1464206 3300041451 Bacteria 559
402 Ga0451795_1268172 3300041456 Bacteria 516
403 Ga0451800_0362386 3300041459 Bacteria 598
404 Ga0451807_2228306 3300041486 Bacteria 564
405 Ga0439442_031708 3300042002 Bacteria 1104
406 Ga0439449_0022164 3300042007 Bacteria 2377
407 Ga0450905_093673 3300042142 Bacteria 533
408 Ga0439464_0074236 3300042439 Bacteria 1009
409 Ga0439460_0310770 3300042461 Unclassified 552
410 Ga0466969_0001039 3300044656 Bacteria 14971
411 Ga0466969_0031917 3300044656 Bacteria 2679
412 Ga0466972_0008463 3300044658 Bacteria 5158
413 Ga0466972_0135839 3300044658 Bacteria 1158
414 Ga0466966_0022681 3300044684 Bacteria 4117
415 Ga0466966_0556738 3300044684 Bacteria 690
416 Ga0466961_0005472 3300044693 Bacteria 8007
417 Ga0466961_0026431 3300044693 Bacteria 3732
418 Ga0466961_0417820 3300044693 Bacteria 813
419 Ga0466963_0153294 3300044694 Bacteria 1601
420 Ga0466963_0226155 3300044694 Bacteria 1311
421 Ga0466964_0141283 3300044706 Bacteria 1107
422 Ga0466971_0163940 3300044719 Bacteria 1041
423 Ga0466971_0239393 3300044719 Bacteria 863
424 Ga0466971_0358237 3300044719 Bacteria 707
425 Ga0466968_0016872 3300044735 Bacteria 2911
426 Ga0466970_0007743 3300044765 Bacteria 5389
427 Ga0466970_0118461 3300044765 Bacteria 1449
428 Ga0466957_0015269 3300044842 Bacteria 4485
429 Ga0466957_0027781 3300044842 Bacteria 3364
430 Ga0466957_0068174 3300044842 Bacteria 2196
431 Ga0466957_1438967 3300044842 Bacteria 502
432 Ga0466960_0002843 3300044901 Bacteria 6566
433 Ga0466960_0120418 3300044901 Bacteria 1374
434 Ga0466959_0001803 3300045049 Bacteria 13396
435 Ga0466959_0062874 3300045049 Bacteria 2697
436 Ga0466958_0002866 3300045836 Bacteria 8783
437 Ga0466958_0488057 3300045836 Bacteria 799
438 Ga0466967_0001047 3300045976 Bacteria 15216
439 Ga0466967_0147920 3300045976 Bacteria 2193
440 Ga0466967_1064736 3300045976 Bacteria 806
441 Ga0466967_1630062 3300045976 Bacteria 643
442 Ga0495629_0524132 3300046459 Archaea 797
443 Ga0495594_0050702 3300046499 Bacteria 2283
444 Ga0495596_0063919 3300046500 Bacteria 1432
445 Ga0495631_0158274 3300046518 Bacteria 972
446 Ga0495632_0031230 3300046519 Bacteria 2756
447 Ga0495665_0218671 3300046531 Bacteria 985
448 Ga0495598_0367352 3300046537 Bacteria 557
449 Ga0495621_0121836 3300046539 Bacteria 1009
450 Ga0495622_0176484 3300046557 Bacteria 959
451 Ga0495622_0348626 3300046557 Bacteria 641
452 Ga0495623_0563816 3300046679 Bacteria 595
453 Ga0495613_0388951 3300046689 Bacteria 953
454 Ga0495676_0362520 3300047321 Bacteria 967
455 Ga0495677_0262507 3300047445 Bacteria 676
456 Ga0495615_0150661 3300048090 Bacteria 692
457 Ga0496100_0836458 3300048903 Bacteria 722
458 Ga0496102_0791234 3300048905 Bacteria 871
459 Ga0496103_0022620 3300048906 Bacteria 3785
460 Ga0496104_0164100 3300048907 Bacteria 2130
461 Ga0496104_0411871 3300048907 Bacteria 1264
462 Ga0496104_1398502 3300048907 Bacteria 603
463 Ga0496104_1645306 3300048907 Bacteria 545
464 Ga0496108_0000111 3300048911 Bacteria 82745
465 Ga0496108_0194176 3300048911 Bacteria 1760
466 Ga0496108_0476041 3300048911 Bacteria 1091
467 Ga0496109_0162575 3300048912 Bacteria 2092
468 Ga0496109_0346412 3300048912 Bacteria 1403
469 Ga0496109_1397949 3300048912 Bacteria 635
470 Ga0496110_0009780 3300048913 Bacteria 7766
471 Ga0496110_0085124 3300048913 Bacteria 2822
472 Ga0496110_0272180 3300048913 Bacteria 1542
473 Ga0496111_0067822 3300048914 Bacteria 2592
474 Ga0496112_0271361 3300048915 Bacteria 1645
475 Ga0496112_0829541 3300048915 Bacteria 849
476 Ga0496114_0070292 3300048917 Bacteria 2940
477 Ga0496115_0122712 3300048918 Bacteria 2138
478 Ga0496115_0297405 3300048918 Bacteria 1323
479 Ga0496117_0028510 3300048920 Bacteria 4323
480 Ga0496118_0013668 3300048921 Bacteria 7660
481 Ga0496121_0008210 3300048924 Bacteria 12378
482 Ga0496125_0341011 3300048928 Bacteria 899
483 Ga0496126_0000529 3300048929 Bacteria 73936
484 Ga0501034_0030082 3300049571 Bacteria 5520
485 Ga0501042_1280907 3300049578 Bacteria 534
486 Ga0501047_0687265 3300049581 Bacteria 841
487 Ga0501067_0356278 3300049583 Unclassified 816
488 Ga0501067_0549576 3300049583 Bacteria 647
489 Ga0501067_0554493 3300049583 Bacteria 644
490 Ga0501068_0651183 3300049584 Bacteria 688
491 Ga0501069_0134121 3300049585 Bacteria 1419
492 Ga0501070_0045268 3300049586 Bacteria 3660
493 Ga0501070_0240113 3300049586 Bacteria 1483
494 Ga0501070_0282567 3300049586 Bacteria 1354
495 Ga0501070_0630381 3300049586 Bacteria 853
496 Ga0501074_0151977 3300049590 Bacteria 1655
497 Ga0501079_0599138 3300049741 Bacteria 867
498 Ga0501080_1222751 3300049742 Bacteria 645
499 Ga0501080_1428030 3300049742 Bacteria 590
500 Ga0501045_0577527 3300049824 Bacteria 833
501 nmdc:mga0yw44_40923_c1 3300050492 Bacteria 2756
502 nmdc:mga0yw44_868183_c1 3300050492 Bacteria 612
503 nmdc:mga06z11_712280_c1 3300050494 Bacteria 611
504 nmdc:mga05p37_106_c1 3300050507 Bacteria 43810
505 nmdc:mga05p37_330052_c1 3300050507 Bacteria 1802
506 nmdc:mga05p37_682696_c1 3300050507 Bacteria 1144
507 nmdc:mga05p37_824536_c1 3300050507 Bacteria 1011
508 nmdc:mga09592_1655768_c1 3300050508 Bacteria 517
509 nmdc:mga09592_189229_c1 3300050508 Bacteria 1781
510 nmdc:mga09592_283_c1 3300050508 Bacteria 37042
511 nmdc:mga09592_753084_c1 3300050508 Bacteria 826
512 nmdc:mga0qj67_6_c2 3300050509 Bacteria 123818
513 nmdc:mga0qj67_727594_c1 3300050509 Bacteria 788
514 nmdc:mga06r32_1064439_c1 3300050510 Bacteria 759
515 nmdc:mga06r32_10_c1 3300050510 Bacteria 113242
516 nmdc:mga06r32_1469629_c1 3300050510 Bacteria 622
517 nmdc:mga06r32_785829_c1 3300050510 Bacteria 913
518 nmdc:mga06r32_87481_c1 3300050510 Bacteria 3040
519 nmdc:mga08y16_1434787_c1 3300050511 Bacteria 652
520 nmdc:mga08y16_15896_c1 3300050511 Bacteria 7910
521 nmdc:mga0n895_1398170_c1 3300050512 Bacteria 668
522 nmdc:mga0a205_707328_c1 3300050515 Bacteria 857
523 Ga0500646_0124022 3300053090 Bacteria 833
524 Ga0500583_0363662 3300053092 Bacteria 699
525 Ga0500650_0355595 3300053098 Bacteria 640
526 Ga0500630_039241 3300053159 Bacteria 2312
527 Ga0501084_0130031 3300054114 Bacteria 2120
528 Ga0466962_0201969 3300061719 Bacteria 971
529 Ga0466962_0469837 3300061719 Bacteria 635
530 2506868335 2506783011 Bacteria 5323186
531 2508677428 2508501039 Bacteria 9978592
532 2515496116 2515154088 Bacteria 5526283
533 2515719886 2515154129 Bacteria 5584369
534 2515758439 2515154137 Bacteria 5711575
535 2516082435 2515154202 Bacteria 5471270
536 2559429505 2558860280 Bacteria 11429938
537 2644033997 2643221604 Bacteria 5014917
538 2671839979 2671180195 Bacteria 9757215
539 2676200124 2675902999 Bacteria 9438463
540 2686535394 2684623035 Bacteria 8032739
541 2689960306 2687453737 Bacteria 11203906
542 2689990733 2687453743 Bacteria 8361025
543 2753070634 2751185734 Bacteria 8863695
544 2753264842 2751185782 Bacteria 11227053
545 2772642521 2772190715 Bacteria 6959372
546 2774844702 2773857921 Bacteria 9435764
547 2774858135 2773857922 Bacteria 9757215
548 2774902720 2773857933 Bacteria 5818019
549 2795794296 2795385472 Bacteria 6627535
550 2831937763 2831935698 Bacteria 5963223
551 2848552760 2848551377 Bacteria 3720646
552 2855671181 2855670206 Bacteria 7120389
553 2855682381 2855676851 Bacteria 7063653
554 2855689560 2855683550 Bacteria 7134265
555 2857295514 2857288857 Bacteria 7189066
556 2858850389 2858848962 Bacteria 6963058
557 2858883962 2858882152 Bacteria 7230291
558 2858889887 2858888857 Bacteria 7060307
559 2858900738 2858895516 Bacteria 7378898
560 2866616527 2866612099 Bacteria 7543886
561 2867508348 2867507094 Bacteria 6506033
562 2868095263 2868088558 Bacteria 7609351
563 2869048538 2869048445 Bacteria 6875584
564 2869062530 2869061728 Bacteria 7112407
565 2869071370 2869068681 Bacteria 7205615
566 2870726807 2870721527 Bacteria 9689237
567 2880493177 2880489317 Bacteria 7096270
568 2880499133 2880495981 Bacteria 7340502
569 2895887077 2895880812 Bacteria 11255272
570 2929221127 2929219909 Bacteria 6984360
571 2929227721 2929226422 Bacteria 7248583
572 2996222665 2996221748 Bacteria 6799777
573 8002787632 8002784119 Bacteria 9788632
574 8003831737 8003830390 Bacteria 6541657
575 8003875376 8003870546 Bacteria 7396674
576 8047715509 8047710418 Bacteria 11023148
577 8054709976 8054704163 Bacteria 7247792
578 8054730741 8054727385 Bacteria 7558670
579 8054736330 8054734606 Bacteria 6947278
580 Ga0451802_1559368
581 JGI25406J46586_10070473
582 rootL2_10206982
583 JGI25405J52794_10019213
584 Ga0070658_10029434
585 Ga0070658_11767045
586 Ga0070683_100018351
587 Ga0070683_100228864
588 Ga0070683_101000509
589 Ga0070690_100628524
590 Ga0070690_100966911
591 Ga0070670_100404771
592 Ga0070670_101362559
593 Ga0070670_101648010
594 Ga0070677_10020483
595 Ga0068869_100001538
596 Ga0070666_10745476
597 Ga0070680_100060051
598 Ga0070680_100122237
599 Ga0070680_100633968
600 Ga0070682_100263744
601 Ga0068868_100152512
602 Ga0068868_101528772
603 Ga0070660_100503142
604 Ga0070660_101062645
605 Ga0070689_101784205
606 Ga0070691_10623396
607 Ga0070687_100660985
608 Ga0070661_100036772
609 Ga0070692_10019238
610 Ga0070668_100000160
611 Ga0070668_100007814
612 Ga0070668_100045885
613 Ga0070669_100291601
614 Ga0070675_100001479
615 Ga0070671_100898827
616 Ga0070674_100052350
617 Ga0070674_101722304
618 Ga0070659_100184589
619 Ga0070659_100970447
620 Ga0070667_100646068
621 Ga0070667_100694117
622 Ga0070709_11020628
623 Ga0070714_101398656
624 Ga0070713_100260588
625 Ga0070710_10000403
626 Ga0070701_10047576
627 Ga0070711_101692423
628 Ga0070700_100034616
629 Ga0070700_101702908
630 Ga0070708_100105233
631 Ga0070708_100632750
632 Ga0070663_100561320
633 Ga0070678_100066528
634 Ga0070662_100068676
635 Ga0070681_10147768
636 Ga0070707_100168549
637 Ga0070679_100088939
638 Ga0070679_100288728
639 Ga0070684_100006094
640 Ga0070684_100032232
641 Ga0070684_100202876
642 Ga0070684_100262001
643 Ga0070684_101436204
644 Ga0070684_102245609
645 Ga0068853_100501371
646 Ga0068853_101126437
647 Ga0070686_100672867
648 Ga0070686_100694533
649 Ga0070686_101393478
650 Ga0070693_100441494
651 Ga0070693_101377608
652 Ga0068855_100543881
653 Ga0068855_101396935
654 Ga0068855_102204517
655 Ga0070664_100021304
656 Ga0070664_100165384
657 Ga0070664_100205326
658 Ga0070664_101542737
659 Ga0070664_102126592
660 Ga0068857_100080420
661 Ga0068854_100106959
662 Ga0068854_100921347
663 Ga0068856_100201066
664 Ga0068856_101305914
665 Ga0068856_101384616
666 Ga0068856_102092638
667 Ga0068852_100239967
668 Ga0068852_101482607
669 Ga0068859_100269864
670 Ga0068859_100611417
671 Ga0068859_100833618
672 Ga0068859_101636132
673 Ga0068864_100162803
674 Ga0068866_11326766
675 Ga0068861_100063792
676 Ga0068861_100623605
677 Ga0068861_101128908
678 Ga0068870_10817482
679 Ga0068863_100004323
680 Ga0068863_100318303
681 Ga0068863_102594744
682 Ga0068858_100000002
683 Ga0068858_100004824
684 Ga0068858_100040719
685 Ga0068858_100713116
686 Ga0068858_100806753
687 Ga0068860_100041417
688 Ga0068860_100224164
689 Ga0068860_100594438
690 Ga0068862_100060147
691 Ga0068862_100084610
692 Ga0081455_10000023
693 Ga0081455_10390594
694 Ga0081538_10168936
695 Ga0081540_1042249
696 Ga0081539_10004243
697 Ga0081539_10024724
698 Ga0081539_10466448
699 Ga0070717_11183487
700 Ga0070717_11857323
701 Ga0075368_10181615
702 Ga0075363_100224356
703 Ga0075363_100842176
704 Ga0070715_10926113
705 Ga0075428_100000237
706 Ga0075428_100377478
707 Ga0075428_100534484
708 Ga0075428_101348999
709 Ga0075430_100000527
710 Ga0075430_101624781
711 Ga0075431_100002315
712 Ga0075431_100101484
713 Ga0075431_101039836
714 Ga0075431_101420644
715 Ga0075431_101656790
716 Ga0075433_10450102
717 Ga0075429_100000545
718 Ga0075429_101245266
719 Ga0075429_101451823
720 Ga0075429_101516943
721 Ga0075429_101777168
722 Ga0068865_100165016
723 Ga0097620_100269873
724 Ga0097620_100611472
725 Ga0097620_100833614
726 Ga0097620_101635967
727 Ga0105240_12407838
728 Ga0111539_10017377
729 Ga0111539_10614155
730 Ga0111539_11182359
731 Ga0105245_10003995
732 Ga0105245_10916613
733 Ga0114129_10001195
734 Ga0114129_10156037
735 Ga0114129_10409133
736 Ga0114129_10437740
737 Ga0114129_10638436
738 Ga0114129_13127150
739 Ga0105243_11096979
740 Ga0105248_10000038
741 Ga0105248_10000950
742 Ga0105248_11533191
743 Ga0105237_10954472
744 Ga0105237_11161197
745 Ga0105237_12447743
746 Ga0105238_10073355
747 Ga0105238_11122868
748 Ga0105238_12070151
749 Ga0105249_10908291
750 Ga0105249_11280137
751 Ga0105029_103358
752 Ga0105033_103169
753 Ga0105239_10993361
754 Ga0105239_12266136
755 Ga0105239_12277513
756 Ga0157370_10208482
757 Ga0157369_10822296
758 Ga0157374_12059740
759 Ga0157378_11016624
760 Ga0163162_11264856
761 Ga0157372_12266181
762 Ga0157375_12483763
763 Ga0163163_10163688
764 Ga0163163_10246975
765 Ga0163163_10553855
766 Ga0163163_10838887
767 Ga0163163_10984623
768 Ga0157380_10499487
769 Ga0157377_10003412
770 Ga0157379_10000007
771 Ga0157379_11747695
772 Ga0157379_12300074
773 Ga0157376_11018595
774 Ga0157376_11360035
775 Ga0197907_10767926
776 Ga0206356_10899913
777 Ga0206351_10995453
778 Ga0206352_11318627
779 Ga0206350_10115848
780 Ga0206354_10727073
781 Ga0206354_10965762
782 Ga0206353_11603250
783 Ga0224712_10000637
784 Ga0207692_10000841
785 Ga0207710_10196705
786 Ga0207647_10069750
787 Ga0207699_11224944
788 Ga0207645_10914513
789 Ga0207705_10058311
790 Ga0207705_10436567
791 Ga0207707_10035104
792 Ga0207671_10680446
793 Ga0207660_10154044
794 Ga0207660_10791725
795 Ga0207649_10064155
796 Ga0207649_10083729
797 Ga0207649_11039773
798 Ga0207652_10094681
799 Ga0207652_11342730
800 Ga0207652_11795655
801 Ga0207646_10183125
802 Ga0207681_10140801
803 Ga0207694_10422665
804 Ga0207650_10516340
805 Ga0207650_11510234
806 Ga0207659_10007248
807 Ga0207687_10065614
808 Ga0207687_10790037
809 Ga0207700_10043940
810 Ga0207700_10983845
811 Ga0207664_10205267
812 Ga0207644_11642644
813 Ga0207690_10730911
814 Ga0207706_10100142
815 Ga0207706_10967238
816 Ga0207709_10861450
817 Ga0207669_10053653
818 Ga0207704_10410496
819 Ga0207691_10780290
820 Ga0207711_10000680
821 Ga0207711_10000953
822 Ga0207689_10019371
823 Ga0207689_10316474
824 Ga0207661_10001908
825 Ga0207661_10014490
826 Ga0207661_10030828
827 Ga0207661_10299855
828 Ga0207661_10428953
829 Ga0207661_10560952
830 Ga0207679_10058294
831 Ga0207679_10188601
832 Ga0207679_10420747
833 Ga0207667_10474287
834 Ga0207651_12020550
835 Ga0207712_10601515
836 Ga0207668_10001171
837 Ga0207668_10154393
838 Ga0207668_10410243
839 Ga0207668_10797721
840 Ga0207640_10242363
841 Ga0207677_10002903
842 Ga0207677_10148051
843 Ga0207703_10000001
844 Ga0207703_10031262
845 Ga0207703_10103132
846 Ga0207703_10760299
847 Ga0207703_10968416
848 Ga0207639_10030865
849 Ga0207639_10583216
850 Ga0207678_10015116
851 Ga0207678_10782513
852 Ga0207708_10013251
853 Ga0207708_11363093
854 Ga0207702_10158524
855 Ga0207702_10286410
856 Ga0207702_10967940
857 Ga0207641_10000587
858 Ga0207641_10537852
859 Ga0207676_10184662
860 Ga0207676_10825550
861 Ga0207676_11802120
862 Ga0207674_10011286
863 Ga0207674_10101244
864 Ga0207675_100090391
865 Ga0207675_100595075
866 Ga0207675_101323474
867 Ga0207683_10031335
868 Ga0207698_10773117
869 Ga0207698_11426542
870 Ga0209983_1003567
871 Ga0209974_10212659
872 Ga0209974_10461805
873 Ga0207428_10128931
874 Ga0268266_11154192
875 Ga0268265_10023459
876 Ga0268265_10246948
877 Ga0268265_10489972
878 Ga0268265_12108905
879 Ga0268264_10533797
880 Ga0268264_10708725
881 Ga0307511_10000622
882 Ga0316177_1031606
883 Ga0316177_1158667
884 Ga0316176_1072548
885 Ga0314311_1006147
886 Ga0316178_1179349
887 Ga0316181_1260717
888 Ga0307509_10008659
889 Ga0307509_10501567
890 Ga0307408_101509172
891 Ga0307508_10001989
892 Ga0307508_10023073
893 Ga0307508_10121391
894 Ga0307516_10263712
895 Ga0307405_10036765
896 Ga0307405_11029874
897 Ga0307405_11042684
898 Ga0307405_11172927
899 Ga0307413_10078161
900 Ga0307413_10372215
901 Ga0307413_10563913
902 Ga0307410_10143398
903 Ga0307410_10228707
904 Ga0307410_10300009
905 Ga0307410_10706349
906 Ga0307410_10870808
907 Ga0307406_10008816
908 Ga0307406_10619910
909 Ga0307406_10877699
910 Ga0307407_10022223
911 Ga0307407_10443027
912 Ga0307407_10480677
913 Ga0307407_10884792
914 Ga0307407_11400562
915 Ga0307412_10615268
916 Ga0307409_100000846
917 Ga0307409_100069653
918 Ga0307409_100090581
919 Ga0307409_100141628
920 Ga0307409_100143416
921 Ga0307409_100218322
922 Ga0307409_100416798
923 Ga0307409_100499038
924 Ga0307409_100609173
925 Ga0307409_100644030
926 Ga0307409_100648446
927 Ga0307409_102172699
928 Ga0307409_102341671
929 Ga0307416_100000530
930 Ga0307416_100009854
931 Ga0307416_100326261
932 Ga0307416_100474660
933 Ga0307416_100533332
934 Ga0307416_101396577
935 Ga0307416_101542407
936 Ga0307414_10185804
937 Ga0307414_10379793
938 Ga0307411_10003091
939 Ga0307411_10216340
940 Ga0307411_10572553
941 Ga0307411_11834141
942 Ga0307411_12164884
943 Ga0307415_100004242
944 Ga0307415_100038547
945 Ga0307415_100087504
946 Ga0307415_100126959
947 Ga0307415_101682975
948 Ga0307415_101873566
949 Ga0307507_10007702
950 Ga0307507_10023509
951 Ga0307507_10075062
952 Ga0373938_0001902
953 Ga0373932_0013201
954 Ga0373932_0154635
955 Ga0373939_0087897
956 Ga0373939_0136325
957 Ga0373942_0000264
958 Ga0373962_0001996
959 Ga0373931_0618650
960 Ga0373931_1261562
961 Ga0373935_0254293
962 Ga0373925_0092802
963 Ga0395899_0047738
964 Ga0395900_0092298
965 Ga0395900_0143223
966 Ga0395900_1367281
967 Ga0395898_0094414
968 Ga0395905_0122745
969 Ga0395905_1109613
970 Ga0395901_0001511
971 Ga0395901_0023849
972 Ga0436365_1008152
973 Ga0436365_1302022
974 Ga0436365_1628087
975 Ga0436363_1457761
976 Ga0436362_0581146
977 Ga0439453_0087829
978 Ga0439465_0158341
979 Ga0451791_1154513
980 Ga0451791_1464206
981 Ga0451795_1268172
982 Ga0451800_0362386
983 Ga0451807_2228306
984 Ga0439442_031708
985 Ga0439449_0022164
986 Ga0450905_093673
987 Ga0439464_0074236
988 Ga0439460_0310770
989 Ga0466969_0001039
990 Ga0466969_0031917
991 Ga0466972_0008463
992 Ga0466972_0135839
993 Ga0466966_0022681
994 Ga0466966_0556738
995 Ga0466961_0005472
996 Ga0466961_0026431
997 Ga0466961_0417820
998 Ga0466963_0153294
999 Ga0466963_0226155
1000 Ga0466964_0141283
1001 Ga0466971_0163940
1002 Ga0466971_0239393
1003 Ga0466971_0358237
1004 Ga0466968_0016872
1005 Ga0466970_0007743
1006 Ga0466970_0118461
1007 Ga0466957_0015269
1008 Ga0466957_0027781
1009 Ga0466957_0068174
1010 Ga0466957_1438967
1011 Ga0466960_0002843
1012 Ga0466960_0120418
1013 Ga0466959_0001803
1014 Ga0466959_0062874
1015 Ga0466958_0002866
1016 Ga0466958_0488057
1017 Ga0466967_0001047
1018 Ga0466967_0147920
1019 Ga0466967_1064736
1020 Ga0466967_1630062
1021 Ga0495629_0524132
1022 Ga0495594_0050702
1023 Ga0495596_0063919
1024 Ga0495631_0158274
1025 Ga0495632_0031230
1026 Ga0495665_0218671
1027 Ga0495598_0367352
1028 Ga0495621_0121836
1029 Ga0495622_0176484
1030 Ga0495622_0348626
1031 Ga0495623_0563816
1032 Ga0495613_0388951
1033 Ga0495676_0362520
1034 Ga0495677_0262507
1035 Ga0495615_0150661
1036 Ga0496100_0836458
1037 Ga0496102_0791234
1038 Ga0496103_0022620
1039 Ga0496104_0164100
1040 Ga0496104_0411871
1041 Ga0496104_1398502
1042 Ga0496104_1645306
1043 Ga0496108_0000111
1044 Ga0496108_0194176
1045 Ga0496108_0476041
1046 Ga0496109_0162575
1047 Ga0496109_0346412
1048 Ga0496109_1397949
1049 Ga0496110_0009780
1050 Ga0496110_0085124
1051 Ga0496110_0272180
1052 Ga0496111_0067822
1053 Ga0496112_0271361
1054 Ga0496112_0829541
1055 Ga0496114_0070292
1056 Ga0496115_0122712
1057 Ga0496115_0297405
1058 Ga0496117_0028510
1059 Ga0496118_0013668
1060 Ga0496121_0008210
1061 Ga0496125_0341011
1062 Ga0496126_0000529
1063 Ga0501034_0030082
1064 Ga0501042_1280907
1065 Ga0501047_0687265
1066 Ga0501067_0356278
1067 Ga0501067_0549576
1068 Ga0501067_0554493
1069 Ga0501068_0651183
1070 Ga0501069_0134121
1071 Ga0501070_0045268
1072 Ga0501070_0240113
1073 Ga0501070_0282567
1074 Ga0501070_0630381
1075 Ga0501074_0151977
1076 Ga0501079_0599138
1077 Ga0501080_1222751
1078 Ga0501080_1428030
1079 Ga0501045_0577527
1080 nmdc:mga0yw44_40923_c1
1081 nmdc:mga0yw44_868183_c1
1082 nmdc:mga06z11_712280_c1
1083 nmdc:mga05p37_106_c1
1084 nmdc:mga05p37_330052_c1
1085 nmdc:mga05p37_682696_c1
1086 nmdc:mga05p37_824536_c1
1087 nmdc:mga09592_1655768_c1
1088 nmdc:mga09592_189229_c1
1089 nmdc:mga09592_283_c1
1090 nmdc:mga09592_753084_c1
1091 nmdc:mga0qj67_6_c2
1092 nmdc:mga0qj67_727594_c1
1093 nmdc:mga06r32_1064439_c1
1094 nmdc:mga06r32_10_c1
1095 nmdc:mga06r32_1469629_c1
1096 nmdc:mga06r32_785829_c1
1097 nmdc:mga06r32_87481_c1
1098 nmdc:mga08y16_1434787_c1
1099 nmdc:mga08y16_15896_c1
1100 nmdc:mga0n895_1398170_c1
1101 nmdc:mga0a205_707328_c1
1102 Ga0500646_0124022
1103 Ga0500583_0363662
1104 Ga0500650_0355595
1105 Ga0500630_039241
1106 Ga0501084_0130031
1107 Ga0466962_0201969
1108 Ga0466962_0469837
1109 2506868335
1110 2508677428
1111 2515496116
1112 2515719886
1113 2515758439
1114 2516082435
1115 2559429505
1116 2644033997
1117 2671839979
1118 2676200124
1119 2686535394
1120 2689960306
1121 2689990733
1122 2753070634
1123 2753264842
1124 2772642521
1125 2774844702
1126 2774858135
1127 2774902720
1128 2795794296
1129 2831937763
1130 2848552760
1131 2855671181
1132 2855682381
1133 2855689560
1134 2857295514
1135 2858850389
1136 2858883962
1137 2858889887
1138 2858900738
1139 2866616527
1140 2867508348
1141 2868095263
1142 2869048538
1143 2869062530
1144 2869071370
1145 2870726807
1146 2880493177
1147 2880499133
1148 2895887077
1149 2929221127
1150 2929227721
1151 2996222665
1152 8002787632
1153 8003831737
1154 8003875376
1155 8047715509
1156 8054709976
1157 8054730741
1158 8054736330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

34

105

0.95

Map