F465836

General Info

Members Datasets Scaffolds Average Seq Length
579 331 578 153

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10200572|Ga0207671_102005722
Length 178
Sequence MKGNLMKRFHVHVSVSNLDESIRFYSRLFGGEPTLLKPDYAKWMLDDPRVNFAISTHHQPTGVNHLGFQVDSDEELRGMQARLQAADARMIQEDEQPCCYARSDKYWVTDPSGIAWETFHTLASIPVYGEDTSVFHHGASTTPVRAETAGTKTVCCVPAPKSSPRSEREQCCSSNESA

Samples

Sample ID Description Type Environment
1 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
2 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
178 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
234 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.86
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0.35
Rhizoplane 3.28
Rhizosphere 90.67
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000321 3300003214 Bacteria 57780
2 rootH1_10084223 3300003316 Bacteria 3873
3 rootH1_10084223 3300003323 Bacteria 12648
4 rootH2_10095172 3300003320 Bacteria 1485
5 rootH2_10095173 3300003320 Unclassified 2030
6 rootH1_10203424 3300003323 Bacteria 1486
7 Ga0065704_10411670 3300005289 Unclassified 741
8 Ga0065712_10220827 3300005290 Bacteria 1042
9 Ga0065712_10293611 3300005290 Bacteria 873
10 Ga0065715_10158843 3300005293 Bacteria 1642
11 Ga0065707_10102058 3300005295 Bacteria 2829
12 Ga0070658_10807118 3300005327 Unclassified 815
13 Ga0070683_100233978 3300005329 Unclassified 1747
14 Ga0070670_100134703 3300005331 Bacteria 2134
15 Ga0070677_10102948 3300005333 Unclassified 1262
16 Ga0068869_100093400 3300005334 Bacteria 2267
17 Ga0068869_100283582 3300005334 Bacteria 1333
18 Ga0068869_100578384 3300005334 Bacteria 947
19 Ga0070666_10001013 3300005335 Bacteria 17214
20 Ga0070666_10107936 3300005335 Bacteria 1924
21 Ga0070666_10188234 3300005335 Unclassified 1450
22 Ga0070666_10216222 3300005335 Bacteria 1351
23 Ga0070680_100631990 3300005336 Bacteria 920
24 Ga0070682_100463639 3300005337 Bacteria 973
25 Ga0068868_100000522 3300005338 Bacteria 25761
26 Ga0068868_100002574 3300005338 Bacteria 12586
27 Ga0068868_100811065 3300005338 Bacteria 845
28 Ga0070660_100869319 3300005339 Bacteria 759
29 Ga0070689_100008295 3300005340 Bacteria 7312
30 Ga0070689_100291326 3300005340 Bacteria 1357
31 Ga0070689_101091633 3300005340 Bacteria 713
32 Ga0070691_10168404 3300005341 Unclassified 1134
33 Ga0070687_100179499 3300005343 Bacteria 1267
34 Ga0070687_100620978 3300005343 Unclassified 745
35 Ga0070675_100276312 3300005354 Bacteria 1475
36 Ga0070675_100741985 3300005354 Bacteria 896
37 Ga0070671_100018587 3300005355 Bacteria 5647
38 Ga0070671_100025744 3300005355 Bacteria 4830
39 Ga0070671_100084164 3300005355 Bacteria 2660
40 Ga0070674_100289991 3300005356 Bacteria 1300
41 Ga0070673_100000835 3300005364 Bacteria 17272
42 Ga0070673_100136022 3300005364 Bacteria 2068
43 Ga0070688_100010345 3300005365 Bacteria 5141
44 Ga0070659_100321058 3300005366 Unclassified 1294
45 Ga0070667_100015927 3300005367 Bacteria 6220
46 Ga0070667_100058065 3300005367 Bacteria 3271
47 Ga0070667_100076875 3300005367 Bacteria 2850
48 Ga0070667_100436987 3300005367 Bacteria 1195
49 Ga0070667_100558571 3300005367 Bacteria 1052
50 Ga0070709_10038705 3300005434 Bacteria 2922
51 Ga0070709_10498805 3300005434 Bacteria 924
52 Ga0070714_100141889 3300005435 Bacteria 2157
53 Ga0070713_100000712 3300005436 Bacteria 21343
54 Ga0070710_10001809 3300005437 Bacteria 10106
55 Ga0070701_10265870 3300005438 Bacteria 1041
56 Ga0070711_100001177 3300005439 Bacteria 14082
57 Ga0070711_100097721 3300005439 Bacteria 2130
58 Ga0070711_100462536 3300005439 Bacteria 1040
59 Ga0070705_100680545 3300005440 Bacteria 806
60 Ga0070700_100200174 3300005441 Unclassified 1402
61 Ga0070694_100638346 3300005444 Bacteria 861
62 Ga0070708_100024240 3300005445 Bacteria 5172
63 Ga0070708_100376308 3300005445 Bacteria 1339
64 Ga0070663_100439519 3300005455 Bacteria 1073
65 Ga0070678_100008526 3300005456 Bacteria 6141
66 Ga0070678_100117482 3300005456 Bacteria 2091
67 Ga0070678_100467500 3300005456 Bacteria 1107
68 Ga0070662_100046499 3300005457 Bacteria 3118
69 Ga0070662_100549598 3300005457 Bacteria 967
70 Ga0068867_100075762 3300005459 Bacteria 2524
71 Ga0068867_100293782 3300005459 Bacteria 1337
72 Ga0068867_101200904 3300005459 Bacteria 697
73 Ga0070685_10004441 3300005466 Bacteria 7091
74 Ga0070706_101689018 3300005467 Bacteria 577
75 Ga0070698_100193172 3300005471 Bacteria 1973
76 Ga0070699_100026303 3300005518 Bacteria 5019
77 Ga0070699_100261773 3300005518 Bacteria 1547
78 Ga0070699_100713911 3300005518 Unclassified 916
79 Ga0070697_100785246 3300005536 Bacteria 842
80 Ga0068853_100564481 3300005539 Bacteria 1079
81 Ga0070672_100330204 3300005543 Unclassified 1297
82 Ga0070686_100004948 3300005544 Bacteria 7347
83 Ga0070686_100043225 3300005544 Bacteria 2827
84 Ga0070686_100381848 3300005544 Unclassified 1067
85 Ga0070696_100377482 3300005546 Bacteria 1104
86 Ga0070693_100220847 3300005547 Bacteria 1241
87 Ga0070665_100011365 3300005548 Bacteria 9003
88 Ga0070665_100063118 3300005548 Bacteria 3715
89 Ga0070665_100077716 3300005548 Bacteria 3325
90 Ga0070665_100093922 3300005548 Bacteria 3004
91 Ga0070665_100182357 3300005548 Bacteria 2100
92 Ga0070665_100556780 3300005548 Bacteria 1159
93 Ga0070704_100095347 3300005549 Bacteria 2228
94 Ga0070704_101189553 3300005549 Unclassified 695
95 Ga0068855_100233950 3300005563 Bacteria 2056
96 Ga0068855_100726896 3300005563 Bacteria 1060
97 Ga0068855_101253547 3300005563 Unclassified 769
98 Ga0070664_100669118 3300005564 Unclassified 965
99 Ga0068857_100422641 3300005577 Bacteria 1243
100 Ga0068854_100008340 3300005578 Bacteria 6657
101 Ga0068854_100802741 3300005578 Unclassified 820
102 Ga0068856_100225332 3300005614 Bacteria 1890
103 Ga0070702_100035303 3300005615 Bacteria 2762
104 Ga0070702_100071359 3300005615 Bacteria 2052
105 Ga0070702_100610438 3300005615 Bacteria 819
106 Ga0068852_100102527 3300005616 Bacteria 2586
107 Ga0068852_100338123 3300005616 Bacteria 1467
108 Ga0068859_100011219 3300005617 Bacteria 9011
109 Ga0068859_100017980 3300005617 Bacteria 7105
110 Ga0068859_100133085 3300005617 Bacteria 2559
111 Ga0068859_100484645 3300005617 Bacteria 1332
112 Ga0068864_100001938 3300005618 Bacteria 17002
113 Ga0068864_100019247 3300005618 Bacteria 5707
114 Ga0068864_100932774 3300005618 Bacteria 858
115 Ga0068864_101076678 3300005618 Bacteria 799
116 Ga0068864_101463325 3300005618 Bacteria 686
117 Ga0068866_10022200 3300005718 Bacteria 2935
118 Ga0068866_10193501 3300005718 Bacteria 1210
119 Ga0068861_100412051 3300005719 Bacteria 1202
120 Ga0068861_100797061 3300005719 Bacteria 886
121 Ga0068861_101191516 3300005719 Bacteria 736
122 Ga0068851_10001783 3300005834 Bacteria 9415
123 Ga0068870_10038565 3300005840 Bacteria 2468
124 Ga0068863_100008728 3300005841 Bacteria 9901
125 Ga0068863_100094267 3300005841 Bacteria 2841
126 Ga0068858_100004196 3300005842 Bacteria 14186
127 Ga0068858_100038712 3300005842 Bacteria 4423
128 Ga0068858_100074710 3300005842 Bacteria 3148
129 Ga0068860_100018163 3300005843 Bacteria 6846
130 Ga0068860_100058699 3300005843 Bacteria 3658
131 Ga0068860_100065128 3300005843 Bacteria 3461
132 Ga0068860_100750432 3300005843 Bacteria 987
133 Ga0068860_100763134 3300005843 Bacteria 979
134 Ga0068860_100981775 3300005843 Bacteria 862
135 Ga0068862_100030215 3300005844 Bacteria 4566
136 Ga0081540_1000303 3300005983 Bacteria 50969
137 Ga0070717_11088910 3300006028 Bacteria 728
138 Ga0075365_10091594 3300006038 Bacteria 2072
139 Ga0075363_100136311 3300006048 Bacteria 1380
140 Ga0075432_10011774 3300006058 Bacteria 2973
141 Ga0070715_10023161 3300006163 Bacteria 2430
142 Ga0070716_100032681 3300006173 Bacteria 2840
143 Ga0070712_100001213 3300006175 Bacteria 15601
144 Ga0097621_100018496 3300006237 Bacteria 5325
145 Ga0097621_100041452 3300006237 Bacteria 3706
146 Ga0068871_100030240 3300006358 Bacteria 4262
147 Ga0068871_100062560 3300006358 Bacteria 3042
148 Ga0075430_100167683 3300006846 Bacteria 1827
149 Ga0075430_100259480 3300006846 Bacteria 1439
150 Ga0075431_100562855 3300006847 Unclassified 1126
151 Ga0075433_10206708 3300006852 Bacteria 1745
152 Ga0075434_100064745 3300006871 Bacteria 3640
153 Ga0075434_100130663 3300006871 Bacteria 2530
154 Ga0075434_100398513 3300006871 Bacteria 1397
155 Ga0075429_100176960 3300006880 Bacteria 1869
156 Ga0068865_100047077 3300006881 Bacteria 2961
157 Ga0068865_100167173 3300006881 Bacteria 1683
158 Ga0075436_100259250 3300006914 Bacteria 1239
159 Ga0097620_100011219 3300006931 Bacteria 9011
160 Ga0097620_100017980 3300006931 Bacteria 7105
161 Ga0097620_100133092 3300006931 Bacteria 2559
162 Ga0097620_100484681 3300006931 Bacteria 1332
163 Ga0079104_1015595 3300006946 Bacteria 2247
164 Ga0075435_100042739 3300007076 Bacteria 3626
165 Ga0075435_100157455 3300007076 Bacteria 1912
166 Ga0099794_10140982 3300007265 Bacteria 1221
167 Ga0099795_10428369 3300007788 Bacteria 606
168 Ga0105250_10021756 3300009092 Bacteria 2587
169 Ga0105240_10026698 3300009093 Bacteria 7575
170 Ga0105240_10032843 3300009093 Bacteria 6713
171 Ga0105240_10084608 3300009093 Bacteria 3889
172 Ga0105240_10123602 3300009093 Bacteria 3113
173 Ga0105240_11474083 3300009093 Unclassified 714
174 Ga0105245_10002420 3300009098 Bacteria 16890
175 Ga0105245_10015461 3300009098 Bacteria 6653
176 Ga0105245_10615861 3300009098 Bacteria 1113
177 Ga0105245_10803596 3300009098 Bacteria 979
178 Ga0105247_10001303 3300009101 Bacteria 18336
179 Ga0105247_10009670 3300009101 Bacteria 5847
180 Ga0114129_10067285 3300009147 Bacteria 4997
181 Ga0105243_10213111 3300009148 Bacteria 1702
182 Ga0105243_10299809 3300009148 Bacteria 1456
183 Ga0105241_10031856 3300009174 Bacteria 3949
184 Ga0105241_10058376 3300009174 Bacteria 2963
185 Ga0105241_10425112 3300009174 Bacteria 1170
186 Ga0105241_10783144 3300009174 Bacteria 877
187 Ga0105242_10004900 3300009176 Bacteria 10363
188 Ga0105242_10016942 3300009176 Bacteria 5671
189 Ga0105242_10050753 3300009176 Bacteria 3378
190 Ga0105242_10179972 3300009176 Bacteria 1865
191 Ga0105242_10269495 3300009176 Unclassified 1541
192 Ga0105248_10015968 3300009177 Bacteria 8268
193 Ga0105248_10130118 3300009177 Bacteria 2839
194 Ga0105237_10021349 3300009545 Bacteria 6657
195 Ga0105237_10070831 3300009545 Bacteria 3482
196 Ga0105237_10131656 3300009545 Bacteria 2496
197 Ga0105237_10420212 3300009545 Bacteria 1342
198 Ga0105237_10847970 3300009545 Bacteria 920
199 Ga0105237_10899212 3300009545 Bacteria 892
200 Ga0105238_10002918 3300009551 Bacteria 17077
201 Ga0105238_10026691 3300009551 Bacteria 5888
202 Ga0105249_10029342 3300009553 Bacteria 4967
203 Ga0105249_10288863 3300009553 Bacteria 1641
204 Ga0105249_10313021 3300009553 Bacteria 1579
205 Ga0105249_10373082 3300009553 Bacteria 1451
206 Ga0105249_11713625 3300009553 Bacteria 701
207 Ga0105239_10044769 3300010375 Bacteria 4850
208 Ga0105239_10154747 3300010375 Bacteria 2560
209 Ga0105239_10992634 3300010375 Bacteria 965
210 Ga0105246_10041725 3300011119 Bacteria 3103
211 Ga0105246_10140731 3300011119 Unclassified 1814
212 Ga0105246_10203873 3300011119 Bacteria 1539
213 Ga0157315_1004010 3300012508 Bacteria 1029
214 Ga0157370_10115549 3300013104 Bacteria 2507
215 Ga0157374_10000534 3300013296 Bacteria 34050
216 Ga0157374_10050535 3300013296 Bacteria 3865
217 Ga0157374_10114547 3300013296 Bacteria 2596
218 Ga0157374_10296343 3300013296 Bacteria 1599
219 Ga0157378_10025221 3300013297 Bacteria 5237
220 Ga0157378_10072609 3300013297 Bacteria 3092
221 Ga0157378_10174871 3300013297 Bacteria 2016
222 Ga0157378_10243347 3300013297 Bacteria 1719
223 Ga0157378_10419276 3300013297 Bacteria 1323
224 Ga0157378_10562810 3300013297 Bacteria 1147
225 Ga0163162_10004145 3300013306 Bacteria 13918
226 Ga0163162_10051375 3300013306 Bacteria 4137
227 Ga0163162_10119052 3300013306 Bacteria 2743
228 Ga0163162_10255430 3300013306 Bacteria 1884
229 Ga0163162_10421120 3300013306 Bacteria 1468
230 Ga0163162_10773297 3300013306 Bacteria 1079
231 Ga0163162_11740097 3300013306 Bacteria 712
232 Ga0157372_10723359 3300013307 Unclassified 1158
233 Ga0157372_11321120 3300013307 Bacteria 832
234 Ga0157375_10016183 3300013308 Bacteria 6690
235 Ga0157375_11744863 3300013308 Unclassified 737
236 Ga0163163_10002518 3300014325 Bacteria 15510
237 Ga0163163_10004501 3300014325 Bacteria 11895
238 Ga0157380_10020598 3300014326 Unclassified 4932
239 Ga0182008_10135533 3300014497 Bacteria 1230
240 Ga0182008_10309190 3300014497 Bacteria 829
241 Ga0157377_10148069 3300014745 Bacteria 1449
242 Ga0157377_10220389 3300014745 Bacteria 1214
243 Ga0157379_10011237 3300014968 Bacteria 7801
244 Ga0157379_10013954 3300014968 Bacteria 7041
245 Ga0157379_10096339 3300014968 Bacteria 2656
246 Ga0157379_10190000 3300014968 Bacteria 1856
247 Ga0157379_10262494 3300014968 Bacteria 1569
248 Ga0157379_11893576 3300014968 Bacteria 588
249 Ga0157376_10005553 3300014969 Bacteria 8819
250 Ga0157376_10057824 3300014969 Bacteria 3246
251 Ga0157376_10088352 3300014969 Bacteria 2677
252 Ga0157376_10383003 3300014969 Bacteria 1355
253 Ga0157376_10393271 3300014969 Bacteria 1338
254 Ga0182007_10084654 3300015262 Bacteria 1041
255 Ga0224572_1004446 3300024225 Bacteria 2439
256 Ga0207656_10022841 3300025321 Bacteria 2513
257 Ga0207710_10001602 3300025900 Bacteria 11074
258 Ga0207710_10032229 3300025900 Bacteria 2295
259 Ga0207688_10255827 3300025901 Unclassified 1062
260 Ga0207680_10011165 3300025903 Bacteria 4526
261 Ga0207680_10075541 3300025903 Bacteria 2101
262 Ga0207680_10087841 3300025903 Bacteria 1970
263 Ga0207680_10182609 3300025903 Bacteria 1419
264 Ga0207685_10012812 3300025905 Bacteria 2572
265 Ga0207699_10008937 3300025906 Bacteria 4968
266 Ga0207645_10090371 3300025907 Bacteria 1969
267 Ga0207645_10096399 3300025907 Bacteria 1905
268 Ga0207643_10017345 3300025908 Bacteria 3936
269 Ga0207705_10169213 3300025909 Bacteria 1645
270 Ga0207705_10948501 3300025909 Unclassified 666
271 Ga0207654_10148842 3300025911 Bacteria 1501
272 Ga0207654_10260372 3300025911 Bacteria 1166
273 Ga0207707_10569318 3300025912 Bacteria 961
274 Ga0207707_10933870 3300025912 Unclassified 715
275 Ga0207695_10017237 3300025913 Bacteria 8412
276 Ga0207695_10098682 3300025913 Bacteria 2920
277 Ga0207695_10115012 3300025913 Bacteria 2665
278 Ga0207671_10062347 3300025914 Bacteria 2769
279 Ga0207671_10101661 3300025914 Bacteria 2178
280 Ga0207671_10200572 3300025914 Bacteria 1558
281 Ga0207671_11128419 3300025914 Bacteria 615
282 Ga0207693_10000883 3300025915 Bacteria 26856
283 Ga0207663_10005484 3300025916 Bacteria 6397
284 Ga0207662_10133198 3300025918 Bacteria 1569
285 Ga0207662_10312163 3300025918 Unclassified 1048
286 Ga0207657_10162796 3300025919 Bacteria 1811
287 Ga0207649_10063142 3300025920 Bacteria 2337
288 Ga0207681_10585673 3300025923 Bacteria 921
289 Ga0207681_10639540 3300025923 Unclassified 881
290 Ga0207694_10005499 3300025924 Bacteria 9725
291 Ga0207694_10894699 3300025924 Unclassified 751
292 Ga0207650_10108882 3300025925 Bacteria 2142
293 Ga0207650_10343569 3300025925 Bacteria 1226
294 Ga0207687_10001328 3300025927 Bacteria 16912
295 Ga0207687_10003454 3300025927 Bacteria 10643
296 Ga0207687_10136960 3300025927 Bacteria 1853
297 Ga0207700_10004910 3300025928 Bacteria 7944
298 Ga0207664_11021443 3300025929 Bacteria 741
299 Ga0207644_10005524 3300025931 Bacteria 8228
300 Ga0207644_10022263 3300025931 Bacteria 4328
301 Ga0207644_10411694 3300025931 Bacteria 1106
302 Ga0207690_10046682 3300025932 Bacteria 2870
303 Ga0207690_10399087 3300025932 Unclassified 1096
304 Ga0207706_10001164 3300025933 Bacteria 26664
305 Ga0207706_10127467 3300025933 Bacteria 2238
306 Ga0207686_10000574 3300025934 Bacteria 23161
307 Ga0207686_10025103 3300025934 Bacteria 3462
308 Ga0207686_10037206 3300025934 Bacteria 2935
309 Ga0207686_10062264 3300025934 Bacteria 2368
310 Ga0207686_10208838 3300025934 Bacteria 1402
311 Ga0207686_10349815 3300025934 Bacteria 1112
312 Ga0207670_11197799 3300025936 Unclassified 643
313 Ga0207669_10312018 3300025937 Bacteria 1200
314 Ga0207669_10647986 3300025937 Unclassified 863
315 Ga0207704_10025578 3300025938 Bacteria 3223
316 Ga0207704_10102567 3300025938 Bacteria 1911
317 Ga0207704_10221572 3300025938 Bacteria 1400
318 Ga0207665_10054567 3300025939 Bacteria 2695
319 Ga0207665_10171636 3300025939 Bacteria 1566
320 Ga0207691_10452770 3300025940 Bacteria 1092
321 Ga0207689_10030956 3300025942 Bacteria 4458
322 Ga0207689_10110500 3300025942 Bacteria 2259
323 Ga0207689_10192899 3300025942 Unclassified 1681
324 Ga0207689_10651575 3300025942 Bacteria 887
325 Ga0207661_10477502 3300025944 Bacteria 1138
326 Ga0207661_10979361 3300025944 Unclassified 779
327 Ga0207679_10064697 3300025945 Bacteria 2734
328 Ga0207679_10684965 3300025945 Bacteria 929
329 Ga0207679_10744100 3300025945 Unclassified 891
330 Ga0207667_10019902 3300025949 Bacteria 7479
331 Ga0207667_10138117 3300025949 Bacteria 2510
332 Ga0207667_10390490 3300025949 Bacteria 1417
333 Ga0207651_10413907 3300025960 Bacteria 1149
334 Ga0207651_10955755 3300025960 Bacteria 764
335 Ga0207651_12072487 3300025960 Bacteria 511
336 Ga0207712_10000488 3300025961 Bacteria 33024
337 Ga0207712_10031774 3300025961 Bacteria 3558
338 Ga0207712_10215758 3300025961 Bacteria 1531
339 Ga0207712_10358142 3300025961 Bacteria 1215
340 Ga0207712_10417598 3300025961 Bacteria 1131
341 Ga0207712_10934600 3300025961 Unclassified 768
342 Ga0207658_10030475 3300025986 Bacteria 3819
343 Ga0207658_10054185 3300025986 Bacteria 2966
344 Ga0207658_10486269 3300025986 Bacteria 1097
345 Ga0207677_10000091 3300026023 Bacteria 74163
346 Ga0207677_10000157 3300026023 Bacteria 53946
347 Ga0207677_10102598 3300026023 Bacteria 2109
348 Ga0207677_10652976 3300026023 Bacteria 929
349 Ga0207639_10300280 3300026041 Bacteria 1419
350 Ga0207678_10033556 3300026067 Bacteria 4471
351 Ga0207708_10037154 3300026075 Bacteria 3710
352 Ga0207702_11642370 3300026078 Unclassified 636
353 Ga0207641_10002007 3300026088 Bacteria 19404
354 Ga0207641_10020066 3300026088 Bacteria 5488
355 Ga0207641_10067393 3300026088 Bacteria 3066
356 Ga0207641_11385522 3300026088 Bacteria 704
357 Ga0207648_10054827 3300026089 Bacteria 3481
358 Ga0207648_10095647 3300026089 Bacteria 2599
359 Ga0207676_10000219 3300026095 Bacteria 49390
360 Ga0207676_10005360 3300026095 Bacteria 9082
361 Ga0207674_10010018 3300026116 Bacteria 10784
362 Ga0207674_10441918 3300026116 Bacteria 1257
363 Ga0207675_100247245 3300026118 Bacteria 1725
364 Ga0207675_100937850 3300026118 Bacteria 883
365 Ga0207675_100953618 3300026118 Bacteria 875
366 Ga0207683_10001745 3300026121 Bacteria 19275
367 Ga0207683_10030169 3300026121 Bacteria 4697
368 Ga0207683_10558413 3300026121 Bacteria 1059
369 Ga0207698_10081836 3300026142 Bacteria 2608
370 Ga0209281_1011400 3300027111 Bacteria 1993
371 Ga0209973_1004488 3300027252 Bacteria 1439
372 Ga0209969_1002320 3300027360 Bacteria 2628
373 Ga0209967_1014135 3300027364 Bacteria 1136
374 Ga0209981_1001042 3300027378 Bacteria 3515
375 Ga0209996_1000384 3300027395 Bacteria 5406
376 Ga0209984_1001756 3300027424 Bacteria 2375
377 Ga0210000_1001529 3300027462 Plasmid 3259
378 Ga0209968_1000346 3300027526 Bacteria 7751
379 Ga0209982_1001132 3300027552 Plasmid 3567
380 Ga0210002_1001021 3300027617 Bacteria 3866
381 Ga0209971_1002421 3300027682 Bacteria 4489
382 Ga0209998_10001474 3300027717 Bacteria 5679
383 Ga0209974_10009400 3300027876 Bacteria 3317
384 Ga0207428_10030176 3300027907 Bacteria 4485
385 Ga0265357_1032552 3300028023 Bacteria 598
386 Ga0268266_10009726 3300028379 Bacteria 8453
387 Ga0268266_10010743 3300028379 Bacteria 7978
388 Ga0268266_10092956 3300028379 Bacteria 2647
389 Ga0268266_10263302 3300028379 Bacteria 1598
390 Ga0268265_10111979 3300028380 Bacteria 2230
391 Ga0268265_10285799 3300028380 Bacteria 1478
392 Ga0268264_10031199 3300028381 Bacteria 4369
393 Ga0268264_10038421 3300028381 Bacteria 3951
394 Ga0268264_10211346 3300028381 Bacteria 1781
395 Ga0268264_10277517 3300028381 Bacteria 1568
396 Ga0265338_10446081 3300028800 Bacteria 917
397 Ga0265762_1018597 3300030760 Bacteria 1269
398 Ga0265763_1013973 3300030763 Bacteria 783
399 Ga0265763_1024672 3300030763 Bacteria 653
400 Ga0265763_1042787 3300030763 Bacteria 551
401 Ga0265328_10214670 3300031239 Bacteria 732
402 Ga0265331_10008403 3300031250 Bacteria 5873
403 Ga0265327_10008760 3300031251 Bacteria 7471
404 Ga0307408_100507594 3300031548 Bacteria 1057
405 Ga0307508_10597119 3300031616 Bacteria 705
406 Ga0307516_10001812 3300031730 Bacteria 29367
407 Ga0316577_10310923 3300031733 Bacteria 893
408 Ga0307411_10320865 3300032005 Bacteria 1251
409 Ga0307510_10000012 3300033180 Bacteria 345634
410 Ga0307510_10010364 3300033180 Bacteria 11068
411 Ga0316586_1031693 3300033527 Bacteria 908
412 Ga0373926_0054562 3300035083 Bacteria 1448
413 Ga0373934_0003710 3300035086 Bacteria 5621
414 Ga0373944_0083162 3300035089 Bacteria 1060
415 Ga0373944_0140179 3300035089 Bacteria 846
416 Ga0373923_0018613 3300035111 Bacteria 2676
417 Ga0373936_0043113 3300035113 Bacteria 1813
418 Ga0373945_0081224 3300035116 Bacteria 1242
419 Ga0373945_0097167 3300035116 Bacteria 1148
420 Ga0373954_0005421 3300035118 Bacteria 5518
421 Ga0373956_0054394 3300035119 Bacteria 1803
422 Ga0373957_0002782 3300035120 Bacteria 5038
423 Ga0373943_0023094 3300035170 Bacteria 2889
424 Ga0373943_0101023 3300035170 Bacteria 1508
425 Ga0373955_0002969 3300035172 Bacteria 7428
426 Ga0373955_0197379 3300035172 Bacteria 1197
427 Ga0373924_0484091 3300035410 Bacteria 556
428 Ga0373935_0905917 3300035692 Bacteria 653
429 Ga0373927_0045030 3300035695 Bacteria 2855
430 Ga0373927_0083991 3300035695 Bacteria 2065
431 Ga0373927_0197535 3300035695 Bacteria 1320
432 Ga0373933_0007759 3300035724 Bacteria 5861
433 Ga0373947_0032915 3300035725 Bacteria 3057
434 Ga0373947_0165948 3300035725 Bacteria 1430
435 Ga0373937_0010563 3300036401 Bacteria 8065
436 Ga0373937_0057872 3300036401 Bacteria 3561
437 Ga0316582_0033406 3300036647 Bacteria 3160
438 Ga0373925_0032587 3300037068 Bacteria 3836
439 Ga0373925_0120934 3300037068 Bacteria 2032
440 Ga0395900_0073098 3300037418 Bacteria 3525
441 Ga0395898_0000627 3300037466 Bacteria 64588
442 Ga0395901_0000080 3300038443 Bacteria 134397
443 Ga0395901_0067955 3300038443 Bacteria 3712
444 Ga0436363_0006987 3300039450 Bacteria 1764
445 Ga0451853_2772157 3300041512 Bacteria 2152
446 Ga0450921_012635 3300042123 Bacteria 734
447 Ga0450896_010886 3300042133 Bacteria 1278
448 Ga0439460_0190185 3300042461 Bacteria 696
449 Ga0466972_0507489 3300044658 Bacteria 568
450 Ga0466966_0351007 3300044684 Bacteria 886
451 Ga0466963_0663508 3300044694 Bacteria 736
452 Ga0466968_0089667 3300044735 Bacteria 1361
453 Ga0466957_0005242 3300044842 Bacteria 7258
454 Ga0466959_0055261 3300045049 Bacteria 2899
455 Ga0466959_0064941 3300045049 Bacteria 2649
456 Ga0451576_0467357 3300045051 Unclassified 1325
457 Ga0495603_0273141 3300046455 Bacteria 972
458 Ga0495629_0147703 3300046459 Bacteria 1634
459 Ga0495580_0023641 3300046472 Bacteria 4509
460 Ga0495580_0029903 3300046472 Bacteria 3950
461 Ga0495639_0007331 3300046475 Bacteria 4733
462 Ga0495639_0094437 3300046475 Bacteria 1406
463 Ga0495664_0014812 3300046477 Bacteria 4427
464 Ga0495585_0012249 3300046492 Bacteria 5052
465 Ga0495594_0472022 3300046499 Bacteria 713
466 Ga0495608_0419013 3300046511 Bacteria 817
467 Ga0495628_0078698 3300046516 Bacteria 2564
468 Ga0495628_0249140 3300046516 Bacteria 1327
469 Ga0495630_0587736 3300046517 Bacteria 854
470 Ga0495631_0027166 3300046518 Bacteria 2622
471 Ga0495642_0222146 3300046528 Bacteria 825
472 Ga0495665_0139274 3300046531 Bacteria 1268
473 Ga0495665_0592503 3300046531 Bacteria 554
474 Ga0495640_0050117 3300046533 Bacteria 2878
475 Ga0495645_0077144 3300046543 Bacteria 2396
476 Ga0495645_0083775 3300046543 Bacteria 2285
477 Ga0495622_0432787 3300046557 Bacteria 565
478 Ga0495633_0042588 3300046558 Bacteria 2155
479 Ga0495633_0086004 3300046558 Bacteria 1462
480 Ga0495611_0007774 3300046648 Bacteria 4553
481 Ga0495635_0257938 3300046663 Bacteria 1174
482 Ga0495661_0012073 3300046665 Bacteria 5843
483 Ga0495588_0336533 3300046674 Bacteria 794
484 Ga0495599_0142629 3300046678 Bacteria 1486
485 Ga0495647_0017294 3300046681 Bacteria 2549
486 Ga0495658_0079497 3300046683 Bacteria 1921
487 Ga0495613_0006094 3300046689 Bacteria 9021
488 Ga0495624_0202537 3300046690 Bacteria 1206
489 Ga0495670_0125175 3300046691 Bacteria 1337
490 Ga0495589_0035782 3300046794 Bacteria 2489
491 Ga0495600_0348131 3300046809 Bacteria 928
492 Ga0495581_0099133 3300047315 Bacteria 1692
493 Ga0495581_0129733 3300047315 Bacteria 1469
494 Ga0495636_0009952 3300047318 Bacteria 3746
495 Ga0495680_0253822 3300047322 Bacteria 1246
496 Ga0495683_0109399 3300047323 Bacteria 1321
497 Ga0495684_0387404 3300047471 Bacteria 984
498 Ga0495593_0081520 3300047673 Bacteria 1673
499 Ga0496100_0208143 3300048903 Bacteria 1429
500 Ga0496100_1265272 3300048903 Bacteria 582
501 Ga0496101_0137554 3300048904 Bacteria 1860
502 Ga0496102_0080347 3300048905 Bacteria 3004
503 Ga0496103_0012225 3300048906 Bacteria 5097
504 Ga0496104_0018401 3300048907 Bacteria 6373
505 Ga0496104_0043570 3300048907 Bacteria 4214
506 Ga0496105_0005107 3300048908 Bacteria 9951
507 Ga0496105_0006648 3300048908 Bacteria 8901
508 Ga0496107_0305350 3300048910 Bacteria 1184
509 Ga0496108_0173318 3300048911 Bacteria 1867
510 Ga0496108_0497094 3300048911 Bacteria 1065
511 Ga0496109_0045777 3300048912 Bacteria 3972
512 Ga0496112_0006656 3300048915 Bacteria 10171
513 Ga0496112_0066865 3300048915 Bacteria 3547
514 Ga0496114_0065107 3300048917 Bacteria 3053
515 Ga0496114_0106752 3300048917 Bacteria 2396
516 Ga0496115_0010978 3300048918 Bacteria 6782
517 Ga0496115_0037278 3300048918 Bacteria 3852
518 Ga0496116_0002912 3300048919 Bacteria 17468
519 Ga0496117_0000523 3300048920 Bacteria 63335
520 Ga0496118_0000180 3300048921 Bacteria 112199
521 Ga0496118_0164441 3300048921 Bacteria 1366
522 Ga0496119_0027289 3300048922 Bacteria 3929
523 Ga0496120_0096244 3300048923 Bacteria 1573
524 Ga0496121_0040697 3300048924 Bacteria 4072
525 Ga0496121_0047627 3300048924 Bacteria 3655
526 Ga0496121_0069171 3300048924 Bacteria 2851
527 Ga0496124_0215296 3300048927 Bacteria 1450
528 Ga0496125_0050425 3300048928 Bacteria 3446
529 Ga0496125_0051802 3300048928 Bacteria 3382
530 Ga0496126_0056538 3300048929 Bacteria 3546
531 Ga0501031_0177048 3300049568 Bacteria 1393
532 Ga0501032_0001175 3300049569 Bacteria 20997
533 Ga0501032_1048769 3300049569 Bacteria 511
534 Ga0501034_0001266 3300049571 Bacteria 34323
535 Ga0501034_0001321 3300049571 Bacteria 33531
536 Ga0501034_0190281 3300049571 Bacteria 2015
537 Ga0501034_0529015 3300049571 Bacteria 1090
538 Ga0501036_0016570 3300049572 Bacteria 6155
539 Ga0501039_0014619 3300049575 Bacteria 6008
540 Ga0501039_0877256 3300049575 Bacteria 699
541 Ga0501046_0000610 3300049580 Bacteria 35093
542 Ga0501046_0923634 3300049580 Unclassified 608
543 Ga0501047_0057973 3300049581 Bacteria 3742
544 Ga0501048_0102465 3300049582 Bacteria 2020
545 Ga0501067_0459517 3300049583 Bacteria 711
546 Ga0501068_0002048 3300049584 Bacteria 10758
547 Ga0501070_0439229 3300049586 Bacteria 1053
548 Ga0501071_0206392 3300049587 Unclassified 1477
549 Ga0501072_0027722 3300049588 Bacteria 4418
550 Ga0501073_0008419 3300049589 Bacteria 7650
551 Ga0501079_0149772 3300049741 Unclassified 1819
552 Ga0501080_0012220 3300049742 Bacteria 7869
553 Ga0501080_0027328 3300049742 Bacteria 5305
554 Ga0501080_0312088 3300049742 Bacteria 1425
555 Ga0501044_0006722 3300049823 Bacteria 12679
556 Ga0501044_0016555 3300049823 Bacteria 7913
557 nmdc:mga03n38_282597_c1 3300050490 Bacteria 886
558 nmdc:mga0k408_61009_c1 3300050493 Bacteria 2192
559 nmdc:mga05p37_336634_c1 3300050507 Bacteria 1781
560 nmdc:mga09592_712282_c1 3300050508 Bacteria 854
561 nmdc:mga0qj67_223297_c1 3300050509 Bacteria 1529
562 nmdc:mga0qj67_681524_c1 3300050509 Bacteria 819
563 nmdc:mga06r32_484933_c1 3300050510 Bacteria 1214
564 nmdc:mga0n895_106546_c1 3300050512 Bacteria 2816
565 nmdc:mga0n895_482303_c1 3300050512 Bacteria 1250
566 nmdc:mga0n895_560603_c1 3300050512 Bacteria 1148
567 nmdc:mga0rr50_262041_c1 3300050513 Bacteria 1438
568 nmdc:mga0rr50_29937_c1 3300050513 Bacteria 3847
569 nmdc:mga0a205_32731_c1 3300050515 Bacteria 3913
570 nmdc:mga0a205_515593_c1 3300050515 Bacteria 1052
571 nmdc:mga0sz30_84551_c1 3300050516 Bacteria 1376
572 Ga0495601_0534951 3300053077 Bacteria 755
573 Ga0495595_0063988 3300053084 Bacteria 1728
574 Ga0495619_0043002 3300053085 Bacteria 2960
575 Ga0495619_0911856 3300053085 Bacteria 591
576 Ga0500619_008010 3300053154 Bacteria 2540
577 Ga0500645_012564 3300053730 Bacteria 2735
578 Ga0501084_0078250 3300054114 Bacteria 2772

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10135533 Ga0182008_101355331 131
2 3300015262 Ga0182007_10084654 Ga0182007_100846542 131
3 3300046557 Ga0495622_0432787 Ga0495622_0432787_13_447 133
4 3300044658 Ga0466972_0507489 Ga0466972_0507489_109_543 134
5 3300044684 Ga0466966_0351007 Ga0466966_0351007_102_566 134
6 3300045049 Ga0466959_0064941 Ga0466959_0064941_741_1205 134
7 3300048906 Ga0496103_0012225 Ga0496103_0012225_149_634 134
8 3300048919 Ga0496116_0002912 Ga0496116_0002912_6296_6781 134
9 3300048920 Ga0496117_0000523 Ga0496117_0000523_57970_58455 134
10 3300048921 Ga0496118_0000180 Ga0496118_0000180_6334_6819 134
11 3300048922 Ga0496119_0027289 Ga0496119_0027289_1551_2036 134
12 3300048924 Ga0496121_0040697 Ga0496121_0040697_1628_2113 134
13 3300048928 Ga0496125_0050425 Ga0496125_0050425_695_1180 134
14 3300053730 Ga0500645_012564 Ga0500645_012564_1877_2311 134
15 3300003320 rootH2_10095172 rootH2_100951722 135
16 3300013297 Ga0157378_10243347 Ga0157378_102433472 135
17 3300028800 Ga0265338_10446081 Ga0265338_104460812 135
18 3300046517 Ga0495630_0587736 Ga0495630_0587736_36_470 135
19 3300049569 Ga0501032_1048769 Ga0501032_1048769_61_501 135
20 3300049581 Ga0501047_0057973 Ga0501047_0057973_2352_2792 135
21 3300049823 Ga0501044_0016555 Ga0501044_0016555_2862_3302 135
22 3300025909 Ga0207705_10169213 Ga0207705_101692131 136
23 3300006846 Ga0075430_100167683 Ga0075430_1001676833 138
24 3300009093 Ga0105240_10123602 Ga0105240_101236024 138
25 3300009551 Ga0105238_10002918 Ga0105238_1000291814 138
26 3300025914 Ga0207671_10101661 Ga0207671_101016613 138
27 3300025919 Ga0207657_10162796 Ga0207657_101627963 138
28 3300025924 Ga0207694_10005499 Ga0207694_100054992 138
29 3300025949 Ga0207667_10138117 Ga0207667_101381173 138
30 3300035089 Ga0373944_0140179 Ga0373944_0140179_14_454 138
31 3300042123 Ga0450921_012635 Ga0450921_012635_205_699 138
32 3300042133 Ga0450896_010886 Ga0450896_010886_551_1045 138
33 3300044735 Ga0466968_0089667 Ga0466968_0089667_569_1069 138
34 3300050509 nmdc:mga0qj67_223297_c1 nmdc:mga0qj67_223297_c1_492_953 138
35 3300050515 nmdc:mga0a205_515593_c1 nmdc:mga0a205_515593_c1_410_844 138
36 3300005338 Ga0068868_100000522 Ga0068868_1000005222 139
37 3300005340 Ga0070689_101091633 Ga0070689_1010916332 139
38 3300005343 Ga0070687_100179499 Ga0070687_1001794992 139
39 3300005438 Ga0070701_10265870 Ga0070701_102658702 139
40 3300005549 Ga0070704_100095347 Ga0070704_1000953472 139
41 3300005617 Ga0068859_100133085 Ga0068859_1001330855 139
42 3300005719 Ga0068861_100412051 Ga0068861_1004120513 139
43 3300005843 Ga0068860_100763134 Ga0068860_1007631342 139
44 3300006931 Ga0097620_100133092 Ga0097620_1001330922 139
45 3300007076 Ga0075435_100157455 Ga0075435_1001574552 139
46 3300009553 Ga0105249_10288863 Ga0105249_102888633 139
47 3300009553 Ga0105249_11713625 Ga0105249_117136251 139
48 3300013306 Ga0163162_11740097 Ga0163162_117400972 139
49 3300014968 Ga0157379_11893576 Ga0157379_118935761 139
50 3300025918 Ga0207662_10133198 Ga0207662_101331983 139
51 3300025924 Ga0207694_10894699 Ga0207694_108946992 139
52 3300025961 Ga0207712_10215758 Ga0207712_102157582 139
53 3300026023 Ga0207677_10000091 Ga0207677_100000912 139
54 3300026118 Ga0207675_100247245 Ga0207675_1002472453 139
55 3300028023 Ga0265357_1032552 Ga0265357_10325522 139
56 3300028380 Ga0268265_10285799 Ga0268265_102857992 139
57 3300030763 Ga0265763_1013973 Ga0265763_10139732 139
58 3300030763 Ga0265763_1042787 Ga0265763_10427871 139
59 3300035695 Ga0373927_0197535 Ga0373927_0197535_83_523 139
60 3300049571 Ga0501034_0001321 Ga0501034_0001321_12190_12633 139
61 3300049575 Ga0501039_0877256 Ga0501039_0877256_149_592 139
62 3300049584 Ga0501068_0002048 Ga0501068_0002048_8436_8879 139
63 3300049588 Ga0501072_0027722 Ga0501072_0027722_1391_1834 139
64 3300049589 Ga0501073_0008419 Ga0501073_0008419_1606_2049 139
65 3300049742 Ga0501080_0012220 Ga0501080_0012220_5359_5802 139
66 3300049742 Ga0501080_0312088 Ga0501080_0312088_931_1374 139
67 3300050490 nmdc:mga03n38_282597_c1 nmdc:mga03n38_282597_c1_158_631 139
68 3300053085 Ga0495619_0911856 Ga0495619_0911856_71_544 139
69 3300054114 Ga0501084_0078250 Ga0501084_0078250_632_1075 139
70 3300003316 rootH1_10084223 rootH1_100842233 140
71 3300003320 rootH2_10095173 rootH2_100951733 140
72 3300003323 rootH1_10203424 rootH1_102034242 140
73 3300005439 Ga0070711_100462536 Ga0070711_1004625361 140
74 3300005548 Ga0070665_100182357 Ga0070665_1001823572 140
75 3300005548 Ga0070665_100556780 Ga0070665_1005567802 140
76 3300005616 Ga0068852_100102527 Ga0068852_1001025274 140
77 3300005844 Ga0068862_100030215 Ga0068862_1000302153 140
78 3300007788 Ga0099795_10428369 Ga0099795_104283691 140
79 3300009093 Ga0105240_10084608 Ga0105240_100846084 140
80 3300009174 Ga0105241_10058376 Ga0105241_100583762 140
81 3300009545 Ga0105237_10899212 Ga0105237_108992122 140
82 3300009553 Ga0105249_10029342 Ga0105249_100293424 140
83 3300010375 Ga0105239_10044769 Ga0105239_100447699 140
84 3300013307 Ga0157372_11321120 Ga0157372_113211202 140
85 3300014968 Ga0157379_10262494 Ga0157379_102624942 140
86 3300025911 Ga0207654_10148842 Ga0207654_101488422 140
87 3300025913 Ga0207695_10098682 Ga0207695_100986823 140
88 3300025913 Ga0207695_10115012 Ga0207695_101150123 140
89 3300025914 Ga0207671_11128419 Ga0207671_111284191 140
90 3300025961 Ga0207712_10031774 Ga0207712_100317743 140
91 3300026142 Ga0207698_10081836 Ga0207698_100818364 140
92 3300028379 Ga0268266_10010743 Ga0268266_100107433 140
93 3300028380 Ga0268265_10111979 Ga0268265_101119793 140
94 3300031733 Ga0316577_10310923 Ga0316577_103109232 140
95 3300032005 Ga0307411_10320865 Ga0307411_103208652 140
96 3300035410 Ga0373924_0484091 Ga0373924_0484091_43_480 140
97 3300036647 Ga0316582_0033406 Ga0316582_0033406_1109_1585 140
98 3300046690 Ga0495624_0202537 Ga0495624_0202537_152_637 140
99 3300048903 Ga0496100_1265272 Ga0496100_1265272_65_550 140
100 3300048907 Ga0496104_0018401 Ga0496104_0018401_5523_6008 140
101 3300048908 Ga0496105_0006648 Ga0496105_0006648_2981_3466 140
102 3300048917 Ga0496114_0065107 Ga0496114_0065107_1258_1743 140
103 3300048918 Ga0496115_0037278 Ga0496115_0037278_1678_2163 140
104 3300048923 Ga0496120_0096244 Ga0496120_0096244_13_519 140
105 3300053154 Ga0500619_008010 Ga0500619_008010_284_730 140
106 3300005334 Ga0068869_100283582 Ga0068869_1002835822 141
107 3300005335 Ga0070666_10001013 Ga0070666_100010133 141
108 3300005338 Ga0068868_100002574 Ga0068868_10000257412 141
109 3300005340 Ga0070689_100008295 Ga0070689_1000082956 141
110 3300005364 Ga0070673_100000835 Ga0070673_10000083518 141
111 3300005365 Ga0070688_100010345 Ga0070688_1000103452 141
112 3300005367 Ga0070667_100058065 Ga0070667_1000580653 141
113 3300005434 Ga0070709_10038705 Ga0070709_100387051 141
114 3300005439 Ga0070711_100001177 Ga0070711_10000117713 141
115 3300005440 Ga0070705_100680545 Ga0070705_1006805452 141
116 3300005456 Ga0070678_100467500 Ga0070678_1004675003 141
117 3300005457 Ga0070662_100046499 Ga0070662_1000464992 141
118 3300005459 Ga0068867_101200904 Ga0068867_1012009042 141
119 3300005466 Ga0070685_10004441 Ga0070685_100044413 141
120 3300005544 Ga0070686_100043225 Ga0070686_1000432253 141
121 3300005548 Ga0070665_100077716 Ga0070665_1000777164 141
122 3300005563 Ga0068855_100233950 Ga0068855_1002339503 141
123 3300005614 Ga0068856_100225332 Ga0068856_1002253323 141
124 3300005615 Ga0070702_100035303 Ga0070702_1000353032 141
125 3300005616 Ga0068852_100338123 Ga0068852_1003381232 141
126 3300005617 Ga0068859_100011219 Ga0068859_1000112193 141
127 3300005618 Ga0068864_100001938 Ga0068864_10000193817 141
128 3300005840 Ga0068870_10038565 Ga0068870_100385652 141
129 3300005842 Ga0068858_100004196 Ga0068858_10000419610 141
130 3300005843 Ga0068860_100018163 Ga0068860_1000181637 141
131 3300006237 Ga0097621_100041452 Ga0097621_1000414523 141
132 3300006871 Ga0075434_100064745 Ga0075434_1000647453 141
133 3300006931 Ga0097620_100011219 Ga0097620_1000112193 141
134 3300007265 Ga0099794_10140982 Ga0099794_101409823 141
135 3300009098 Ga0105245_10002420 Ga0105245_100024204 141
136 3300009101 Ga0105247_10009670 Ga0105247_100096703 141
137 3300009174 Ga0105241_10031856 Ga0105241_100318563 141
138 3300009174 Ga0105241_10425112 Ga0105241_104251122 141
139 3300009176 Ga0105242_10050753 Ga0105242_100507533 141
140 3300013104 Ga0157370_10115549 Ga0157370_101155495 141
141 3300013306 Ga0163162_10773297 Ga0163162_107732972 141
142 3300014325 Ga0163163_10002518 Ga0163163_1000251816 141
143 3300014745 Ga0157377_10220389 Ga0157377_102203892 141
144 3300014969 Ga0157376_10005553 Ga0157376_100055533 141
145 3300025906 Ga0207699_10008937 Ga0207699_100089371 141
146 3300025908 Ga0207643_10017345 Ga0207643_100173452 141
147 3300025915 Ga0207693_10000883 Ga0207693_100008835 141
148 3300025916 Ga0207663_10005484 Ga0207663_100054846 141
149 3300025925 Ga0207650_10108882 Ga0207650_101088822 141
150 3300025927 Ga0207687_10001328 Ga0207687_1000132813 141
151 3300025934 Ga0207686_10037206 Ga0207686_100372063 141
152 3300025942 Ga0207689_10030956 Ga0207689_100309563 141
153 3300025960 Ga0207651_10955755 Ga0207651_109557551 141
154 3300026023 Ga0207677_10000157 Ga0207677_1000015713 141
155 3300026088 Ga0207641_10002007 Ga0207641_1000200713 141
156 3300026095 Ga0207676_10000219 Ga0207676_1000021940 141
157 3300026121 Ga0207683_10558413 Ga0207683_105584133 141
158 3300028381 Ga0268264_10211346 Ga0268264_102113462 141
159 3300035119 Ga0373956_0054394 Ga0373956_0054394_17_484 141
160 3300035120 Ga0373957_0002782 Ga0373957_0002782_1150_1617 141
161 3300035172 Ga0373955_0002969 Ga0373955_0002969_2453_2920 141
162 3300035724 Ga0373933_0007759 Ga0373933_0007759_338_805 141
163 3300044842 Ga0466957_0005242 Ga0466957_0005242_5797_6291 141
164 3300046528 Ga0495642_0222146 Ga0495642_0222146_80_607 141
165 3300046543 Ga0495645_0083775 Ga0495645_0083775_1183_1650 141
166 3300047471 Ga0495684_0387404 Ga0495684_0387404_288_755 141
167 3300048907 Ga0496104_0043570 Ga0496104_0043570_2772_3239 141
168 3300048908 Ga0496105_0005107 Ga0496105_0005107_8232_8699 141
169 3300048911 Ga0496108_0497094 Ga0496108_0497094_562_1029 141
170 3300048912 Ga0496109_0045777 Ga0496109_0045777_2316_2783 141
171 3300050493 nmdc:mga0k408_61009_c1 nmdc:mga0k408_61009_c1_323_814 141
172 3300050512 nmdc:mga0n895_106546_c1 nmdc:mga0n895_106546_c1_2133_2600 141
173 3300050516 nmdc:mga0sz30_84551_c1 nmdc:mga0sz30_84551_c1_309_800 141
174 3300005518 Ga0070699_100261773 Ga0070699_1002617732 142
175 3300005548 Ga0070665_100011365 Ga0070665_1000113654 142
176 3300005617 Ga0068859_100484645 Ga0068859_1004846453 142
177 3300005841 Ga0068863_100094267 Ga0068863_1000942673 142
178 3300006048 Ga0075363_100136311 Ga0075363_1001363113 142
179 3300006931 Ga0097620_100484681 Ga0097620_1004846813 142
180 3300009545 Ga0105237_10847970 Ga0105237_108479702 142
181 3300026088 Ga0207641_10067393 Ga0207641_100673935 142
182 3300028379 Ga0268266_10009726 Ga0268266_100097269 142
183 3300041512 Ga0451853_2772157 Ga0451853_2772157_814_1284 142
184 3300006038 Ga0075365_10091594 Ga0075365_100915942 143
185 3300010375 Ga0105239_10154747 Ga0105239_101547472 143
186 3300014968 Ga0157379_10011237 Ga0157379_100112374 143
187 3300025912 Ga0207707_10569318 Ga0207707_105693182 143
188 3300025920 Ga0207649_10063142 Ga0207649_100631423 143
189 3300025932 Ga0207690_10046682 Ga0207690_100466823 143
190 3300025942 Ga0207689_10651575 Ga0207689_106515751 143
191 3300025945 Ga0207679_10064697 Ga0207679_100646973 143
192 3300025961 Ga0207712_10417598 Ga0207712_104175982 143
193 3300026041 Ga0207639_10300280 Ga0207639_103002802 143
194 3300026116 Ga0207674_10010018 Ga0207674_100100184 143
195 3300031548 Ga0307408_100507594 Ga0307408_1005075942 143
196 3300048921 Ga0496118_0164441 Ga0496118_0164441_806_1297 143
197 3300048924 Ga0496121_0069171 Ga0496121_0069171_2150_2641 143
198 3300048929 Ga0496126_0056538 Ga0496126_0056538_1231_1722 143
199 3300049568 Ga0501031_0177048 Ga0501031_0177048_371_841 143
200 3300049569 Ga0501032_0001175 Ga0501032_0001175_20243_20713 143
201 3300049571 Ga0501034_0001266 Ga0501034_0001266_33232_33702 143
202 3300049582 Ga0501048_0102465 Ga0501048_0102465_812_1348 143
203 3300049742 Ga0501080_0027328 Ga0501080_0027328_769_1239 143
204 3300005293 Ga0065715_10158843 Ga0065715_101588432 144
205 3300005445 Ga0070708_100376308 Ga0070708_1003763082 144
206 3300005471 Ga0070698_100193172 Ga0070698_1001931723 144
207 3300005518 Ga0070699_100713911 Ga0070699_1007139111 144
208 3300005536 Ga0070697_100785246 Ga0070697_1007852461 144
209 3300005549 Ga0070704_101189553 Ga0070704_1011895531 144
210 3300005618 Ga0068864_100019247 Ga0068864_1000192473 144
211 3300005843 Ga0068860_100065128 Ga0068860_1000651286 144
212 3300006946 Ga0079104_1015595 Ga0079104_10155954 144
213 3300011119 Ga0105246_10041725 Ga0105246_100417252 144
214 3300014325 Ga0163163_10004501 Ga0163163_1000450114 144
215 3300024225 Ga0224572_1004446 Ga0224572_10044462 144
216 3300026095 Ga0207676_10005360 Ga0207676_100053608 144
217 3300027111 Ga0209281_1011400 Ga0209281_10114002 144
218 3300028381 Ga0268264_10277517 Ga0268264_102775173 144
219 3300030763 Ga0265763_1024672 Ga0265763_10246722 144
220 3300031616 Ga0307508_10597119 Ga0307508_105971191 144
221 3300035692 Ga0373935_0905917 Ga0373935_0905917_36_614 144
222 3300035725 Ga0373947_0165948 Ga0373947_0165948_551_1036 144
223 3300046475 Ga0495639_0094437 Ga0495639_0094437_256_741 144
224 3300046499 Ga0495594_0472022 Ga0495594_0472022_200_685 144
225 3300046531 Ga0495665_0592503 Ga0495665_0592503_57_542 144
226 3300046674 Ga0495588_0336533 Ga0495588_0336533_57_542 144
227 3300047315 Ga0495581_0129733 Ga0495581_0129733_784_1269 144
228 3300005334 Ga0068869_100093400 Ga0068869_1000934002 145
229 3300005335 Ga0070666_10107936 Ga0070666_101079362 145
230 3300005355 Ga0070671_100025744 Ga0070671_1000257442 145
231 3300005355 Ga0070671_100084164 Ga0070671_1000841643 145
232 3300005367 Ga0070667_100076875 Ga0070667_1000768752 145
233 3300005367 Ga0070667_100558571 Ga0070667_1005585712 145
234 3300005436 Ga0070713_100000712 Ga0070713_10000071217 145
235 3300005437 Ga0070710_10001809 Ga0070710_100018094 145
236 3300005456 Ga0070678_100008526 Ga0070678_1000085265 145
237 3300005459 Ga0068867_100293782 Ga0068867_1002937822 145
238 3300005539 Ga0068853_100564481 Ga0068853_1005644812 145
239 3300005547 Ga0070693_100220847 Ga0070693_1002208472 145
240 3300005578 Ga0068854_100008340 Ga0068854_1000083406 145
241 3300005615 Ga0070702_100071359 Ga0070702_1000713592 145
242 3300005718 Ga0068866_10022200 Ga0068866_100222002 145
243 3300005719 Ga0068861_100797061 Ga0068861_1007970612 145
244 3300005834 Ga0068851_10001783 Ga0068851_100017833 145
245 3300005843 Ga0068860_100058699 Ga0068860_1000586993 145
246 3300005983 Ga0081540_1000303 Ga0081540_100030315 145
247 3300006163 Ga0070715_10023161 Ga0070715_100231613 145
248 3300006173 Ga0070716_100032681 Ga0070716_1000326812 145
249 3300006175 Ga0070712_100001213 Ga0070712_1000012135 145
250 3300006358 Ga0068871_100062560 Ga0068871_1000625603 145
251 3300009098 Ga0105245_10803596 Ga0105245_108035962 145
252 3300009148 Ga0105243_10299809 Ga0105243_102998092 145
253 3300009176 Ga0105242_10016942 Ga0105242_100169423 145
254 3300009177 Ga0105248_10130118 Ga0105248_101301182 145
255 3300009545 Ga0105237_10420212 Ga0105237_104202122 145
256 3300009553 Ga0105249_10373082 Ga0105249_103730823 145
257 3300013296 Ga0157374_10000534 Ga0157374_100005342 145
258 3300013297 Ga0157378_10025221 Ga0157378_100252214 145
259 3300013297 Ga0157378_10072609 Ga0157378_100726093 145
260 3300013306 Ga0163162_10004145 Ga0163162_100041453 145
261 3300013306 Ga0163162_10051375 Ga0163162_100513753 145
262 3300014968 Ga0157379_10096339 Ga0157379_100963391 145
263 3300014969 Ga0157376_10088352 Ga0157376_100883522 145
264 3300025321 Ga0207656_10022841 Ga0207656_100228412 145
265 3300025903 Ga0207680_10011165 Ga0207680_100111655 145
266 3300025903 Ga0207680_10087841 Ga0207680_100878413 145
267 3300025905 Ga0207685_10012812 Ga0207685_100128122 145
268 3300025907 Ga0207645_10096399 Ga0207645_100963991 145
269 3300025911 Ga0207654_10260372 Ga0207654_102603722 145
270 3300025914 Ga0207671_10062347 Ga0207671_100623473 145
271 3300025923 Ga0207681_10585673 Ga0207681_105856732 145
272 3300025927 Ga0207687_10003454 Ga0207687_100034548 145
273 3300025928 Ga0207700_10004910 Ga0207700_100049108 145
274 3300025931 Ga0207644_10005524 Ga0207644_100055248 145
275 3300025931 Ga0207644_10411694 Ga0207644_104116942 145
276 3300025933 Ga0207706_10001164 Ga0207706_1000116421 145
277 3300025933 Ga0207706_10127467 Ga0207706_101274672 145
278 3300025934 Ga0207686_10000574 Ga0207686_1000057417 145
279 3300025934 Ga0207686_10349815 Ga0207686_103498151 145
280 3300025937 Ga0207669_10312018 Ga0207669_103120182 145
281 3300025938 Ga0207704_10025578 Ga0207704_100255783 145
282 3300025939 Ga0207665_10054567 Ga0207665_100545673 145
283 3300025939 Ga0207665_10171636 Ga0207665_101716363 145
284 3300025942 Ga0207689_10110500 Ga0207689_101105002 145
285 3300025949 Ga0207667_10390490 Ga0207667_103904902 145
286 3300025960 Ga0207651_12072487 Ga0207651_120724871 145
287 3300025961 Ga0207712_10000488 Ga0207712_1000048821 145
288 3300025986 Ga0207658_10030475 Ga0207658_100304754 145
289 3300025986 Ga0207658_10054185 Ga0207658_100541853 145
290 3300026023 Ga0207677_10102598 Ga0207677_101025982 145
291 3300026067 Ga0207678_10033556 Ga0207678_100335563 145
292 3300026088 Ga0207641_11385522 Ga0207641_113855222 145
293 3300026089 Ga0207648_10054827 Ga0207648_100548273 145
294 3300026118 Ga0207675_100953618 Ga0207675_1009536181 145
295 3300026121 Ga0207683_10001745 Ga0207683_100017453 145
296 3300028381 Ga0268264_10038421 Ga0268264_100384213 145
297 3300030760 Ga0265762_1018597 Ga0265762_10185972 145
298 3300031730 Ga0307516_10001812 Ga0307516_1000181211 145
299 3300033527 Ga0316586_1031693 Ga0316586_10316932 145
300 3300035083 Ga0373926_0054562 Ga0373926_0054562_554_1015 145
301 3300035086 Ga0373934_0003710 Ga0373934_0003710_940_1401 145
302 3300035089 Ga0373944_0083162 Ga0373944_0083162_341_802 145
303 3300035111 Ga0373923_0018613 Ga0373923_0018613_1026_1487 145
304 3300035113 Ga0373936_0043113 Ga0373936_0043113_913_1374 145
305 3300035116 Ga0373945_0081224 Ga0373945_0081224_334_795 145
306 3300035116 Ga0373945_0097167 Ga0373945_0097167_181_642 145
307 3300035118 Ga0373954_0005421 Ga0373954_0005421_834_1295 145
308 3300035170 Ga0373943_0023094 Ga0373943_0023094_554_1015 145
309 3300035170 Ga0373943_0101023 Ga0373943_0101023_908_1369 145
310 3300035172 Ga0373955_0197379 Ga0373955_0197379_498_959 145
311 3300035695 Ga0373927_0045030 Ga0373927_0045030_916_1377 145
312 3300035695 Ga0373927_0083991 Ga0373927_0083991_94_555 145
313 3300035725 Ga0373947_0032915 Ga0373947_0032915_1222_1683 145
314 3300036401 Ga0373937_0010563 Ga0373937_0010563_3224_3685 145
315 3300036401 Ga0373937_0057872 Ga0373937_0057872_1590_2051 145
316 3300037068 Ga0373925_0032587 Ga0373925_0032587_183_644 145
317 3300037068 Ga0373925_0120934 Ga0373925_0120934_249_710 145
318 3300046455 Ga0495603_0273141 Ga0495603_0273141_193_654 145
319 3300046459 Ga0495629_0147703 Ga0495629_0147703_530_991 145
320 3300046472 Ga0495580_0023641 Ga0495580_0023641_2688_3149 145
321 3300046472 Ga0495580_0029903 Ga0495580_0029903_1514_1975 145
322 3300046475 Ga0495639_0007331 Ga0495639_0007331_3177_3638 145
323 3300046477 Ga0495664_0014812 Ga0495664_0014812_2561_3022 145
324 3300046516 Ga0495628_0078698 Ga0495628_0078698_691_1152 145
325 3300046516 Ga0495628_0249140 Ga0495628_0249140_434_895 145
326 3300046531 Ga0495665_0139274 Ga0495665_0139274_530_991 145
327 3300046533 Ga0495640_0050117 Ga0495640_0050117_2088_2549 145
328 3300046543 Ga0495645_0077144 Ga0495645_0077144_1171_1632 145
329 3300046663 Ga0495635_0257938 Ga0495635_0257938_55_516 145
330 3300046678 Ga0495599_0142629 Ga0495599_0142629_858_1319 145
331 3300046681 Ga0495647_0017294 Ga0495647_0017294_531_992 145
332 3300046683 Ga0495658_0079497 Ga0495658_0079497_180_641 145
333 3300046689 Ga0495613_0006094 Ga0495613_0006094_7833_8294 145
334 3300046809 Ga0495600_0348131 Ga0495600_0348131_114_575 145
335 3300047315 Ga0495581_0099133 Ga0495581_0099133_706_1167 145
336 3300047322 Ga0495680_0253822 Ga0495680_0253822_730_1191 145
337 3300047673 Ga0495593_0081520 Ga0495593_0081520_1053_1514 145
338 3300048903 Ga0496100_0208143 Ga0496100_0208143_947_1408 145
339 3300048904 Ga0496101_0137554 Ga0496101_0137554_1150_1611 145
340 3300048915 Ga0496112_0006656 Ga0496112_0006656_6890_7351 145
341 3300048917 Ga0496114_0106752 Ga0496114_0106752_1133_1594 145
342 3300048918 Ga0496115_0010978 Ga0496115_0010978_5333_5794 145
343 3300049571 Ga0501034_0190281 Ga0501034_0190281_1490_1963 145
344 3300050513 nmdc:mga0rr50_262041_c1 nmdc:mga0rr50_262041_c1_769_1230 145
345 3300053077 Ga0495601_0534951 Ga0495601_0534951_119_580 145
346 3300053084 Ga0495595_0063988 Ga0495595_0063988_978_1439 145
347 3300053085 Ga0495619_0043002 Ga0495619_0043002_1566_2027 145
348 3300005439 Ga0070711_100097721 Ga0070711_1000977213 146
349 3300005548 Ga0070665_100093922 Ga0070665_1000939223 146
350 3300005843 Ga0068860_100750432 Ga0068860_1007504322 146
351 3300005843 Ga0068860_100981775 Ga0068860_1009817752 146
352 3300006028 Ga0070717_11088910 Ga0070717_110889102 146
353 3300009177 Ga0105248_10015968 Ga0105248_100159685 146
354 3300013306 Ga0163162_10119052 Ga0163162_101190523 146
355 3300025929 Ga0207664_11021443 Ga0207664_110214432 146
356 3300026118 Ga0207675_100937850 Ga0207675_1009378502 146
357 3300049572 Ga0501036_0016570 Ga0501036_0016570_144_614 146
358 3300049575 Ga0501039_0014619 Ga0501039_0014619_453_923 146
359 3300049580 Ga0501046_0000610 Ga0501046_0000610_1602_2072 146
360 3300049583 Ga0501067_0459517 Ga0501067_0459517_29_499 146
361 3300049823 Ga0501044_0006722 Ga0501044_0006722_2200_2670 146
362 iso_pu_bacteria 2816332256 2817276071 146
363 3300005335 Ga0070666_10188234 Ga0070666_101882342 147
364 3300005364 Ga0070673_100136022 Ga0070673_1001360223 147
365 3300005445 Ga0070708_100024240 Ga0070708_1000242405 147
366 3300005518 Ga0070699_100026303 Ga0070699_1000263032 147
367 3300005548 Ga0070665_100063118 Ga0070665_1000631182 147
368 3300005563 Ga0068855_100726896 Ga0068855_1007268962 147
369 3300005578 Ga0068854_100802741 Ga0068854_1008027411 147
370 3300009093 Ga0105240_10026698 Ga0105240_100266982 147
371 3300010375 Ga0105239_10992634 Ga0105239_109926342 147
372 3300011119 Ga0105246_10203873 Ga0105246_102038732 147
373 3300013308 Ga0157375_11744863 Ga0157375_117448631 147
374 3300014497 Ga0182008_10309190 Ga0182008_103091901 147
375 3300025903 Ga0207680_10182609 Ga0207680_101826092 147
376 3300025913 Ga0207695_10017237 Ga0207695_100172374 147
377 3300025944 Ga0207661_10477502 Ga0207661_104775023 147
378 3300025949 Ga0207667_10019902 Ga0207667_100199022 147
379 3300025960 Ga0207651_10413907 Ga0207651_104139071 147
380 3300026078 Ga0207702_11642370 Ga0207702_116423702 147
381 3300028379 Ga0268266_10092956 Ga0268266_100929564 147
382 3300046511 Ga0495608_0419013 Ga0495608_0419013_73_528 147
383 3300005289 Ga0065704_10411670 Ga0065704_104116701 148
384 3300005290 Ga0065712_10220827 Ga0065712_102208271 148
385 3300005290 Ga0065712_10293611 Ga0065712_102936111 148
386 3300005327 Ga0070658_10807118 Ga0070658_108071181 148
387 3300005329 Ga0070683_100233978 Ga0070683_1002339782 148
388 3300005331 Ga0070670_100134703 Ga0070670_1001347032 148
389 3300005333 Ga0070677_10102948 Ga0070677_101029482 148
390 3300005334 Ga0068869_100578384 Ga0068869_1005783842 148
391 3300005336 Ga0070680_100631990 Ga0070680_1006319902 148
392 3300005337 Ga0070682_100463639 Ga0070682_1004636392 148
393 3300005338 Ga0068868_100811065 Ga0068868_1008110651 148
394 3300005339 Ga0070660_100869319 Ga0070660_1008693191 148
395 3300005340 Ga0070689_100291326 Ga0070689_1002913261 148
396 3300005341 Ga0070691_10168404 Ga0070691_101684041 148
397 3300005343 Ga0070687_100620978 Ga0070687_1006209782 148
398 3300005354 Ga0070675_100741985 Ga0070675_1007419852 148
399 3300005356 Ga0070674_100289991 Ga0070674_1002899912 148
400 3300005366 Ga0070659_100321058 Ga0070659_1003210581 148
401 3300005367 Ga0070667_100436987 Ga0070667_1004369872 148
402 3300005434 Ga0070709_10498805 Ga0070709_104988052 148
403 3300005441 Ga0070700_100200174 Ga0070700_1002001741 148
404 3300005444 Ga0070694_100638346 Ga0070694_1006383462 148
405 3300005455 Ga0070663_100439519 Ga0070663_1004395192 148
406 3300005456 Ga0070678_100117482 Ga0070678_1001174822 148
407 3300005457 Ga0070662_100549598 Ga0070662_1005495982 148
408 3300005459 Ga0068867_100075762 Ga0068867_1000757622 148
409 3300005543 Ga0070672_100330204 Ga0070672_1003302042 148
410 3300005544 Ga0070686_100381848 Ga0070686_1003818482 148
411 3300005546 Ga0070696_100377482 Ga0070696_1003774822 148
412 3300005563 Ga0068855_101253547 Ga0068855_1012535471 148
413 3300005564 Ga0070664_100669118 Ga0070664_1006691182 148
414 3300005577 Ga0068857_100422641 Ga0068857_1004226412 148
415 3300005615 Ga0070702_100610438 Ga0070702_1006104382 148
416 3300005618 Ga0068864_100932774 Ga0068864_1009327742 148
417 3300005618 Ga0068864_101076678 Ga0068864_1010766782 148
418 3300005618 Ga0068864_101463325 Ga0068864_1014633251 148
419 3300005718 Ga0068866_10193501 Ga0068866_101935012 148
420 3300005719 Ga0068861_101191516 Ga0068861_1011915161 148
421 3300005842 Ga0068858_100074710 Ga0068858_1000747105 148
422 3300006058 Ga0075432_10011774 Ga0075432_100117744 148
423 3300006237 Ga0097621_100018496 Ga0097621_1000184968 148
424 3300006358 Ga0068871_100030240 Ga0068871_1000302404 148
425 3300006846 Ga0075430_100259480 Ga0075430_1002594802 148
426 3300006847 Ga0075431_100562855 Ga0075431_1005628551 148
427 3300006852 Ga0075433_10206708 Ga0075433_102067082 148
428 3300006880 Ga0075429_100176960 Ga0075429_1001769601 148
429 3300006881 Ga0068865_100047077 Ga0068865_1000470774 148
430 3300006881 Ga0068865_100167173 Ga0068865_1001671733 148
431 3300006914 Ga0075436_100259250 Ga0075436_1002592503 148
432 3300007076 Ga0075435_100042739 Ga0075435_1000427393 148
433 3300009093 Ga0105240_11474083 Ga0105240_114740831 148
434 3300009098 Ga0105245_10015461 Ga0105245_100154618 148
435 3300009098 Ga0105245_10615861 Ga0105245_106158612 148
436 3300009147 Ga0114129_10067285 Ga0114129_100672852 148
437 3300009148 Ga0105243_10213111 Ga0105243_102131113 148
438 3300009174 Ga0105241_10783144 Ga0105241_107831441 148
439 3300009176 Ga0105242_10004900 Ga0105242_100049008 148
440 3300009176 Ga0105242_10179972 Ga0105242_101799722 148
441 3300009553 Ga0105249_10313021 Ga0105249_103130211 148
442 3300011119 Ga0105246_10140731 Ga0105246_101407312 148
443 3300012508 Ga0157315_1004010 Ga0157315_10040102 148
444 3300013296 Ga0157374_10050535 Ga0157374_100505351 148
445 3300013296 Ga0157374_10296343 Ga0157374_102963432 148
446 3300013297 Ga0157378_10174871 Ga0157378_101748713 148
447 3300013297 Ga0157378_10419276 Ga0157378_104192762 148
448 3300013297 Ga0157378_10562810 Ga0157378_105628102 148
449 3300013306 Ga0163162_10255430 Ga0163162_102554303 148
450 3300013306 Ga0163162_10421120 Ga0163162_104211203 148
451 3300013307 Ga0157372_10723359 Ga0157372_107233592 148
452 3300013308 Ga0157375_10016183 Ga0157375_100161837 148
453 3300014326 Ga0157380_10020598 Ga0157380_100205982 148
454 3300014745 Ga0157377_10148069 Ga0157377_101480692 148
455 3300014968 Ga0157379_10190000 Ga0157379_101900002 148
456 3300014969 Ga0157376_10057824 Ga0157376_100578242 148
457 3300014969 Ga0157376_10383003 Ga0157376_103830032 148
458 3300025901 Ga0207688_10255827 Ga0207688_102558272 148
459 3300025907 Ga0207645_10090371 Ga0207645_100903712 148
460 3300025909 Ga0207705_10948501 Ga0207705_109485011 148
461 3300025912 Ga0207707_10933870 Ga0207707_109338702 148
462 3300025918 Ga0207662_10312163 Ga0207662_103121632 148
463 3300025925 Ga0207650_10343569 Ga0207650_103435692 148
464 3300025927 Ga0207687_10136960 Ga0207687_101369603 148
465 3300025932 Ga0207690_10399087 Ga0207690_103990872 148
466 3300025934 Ga0207686_10025103 Ga0207686_100251032 148
467 3300025934 Ga0207686_10062264 Ga0207686_100622642 148
468 3300025937 Ga0207669_10647986 Ga0207669_106479861 148
469 3300025938 Ga0207704_10102567 Ga0207704_101025672 148
470 3300025938 Ga0207704_10221572 Ga0207704_102215723 148
471 3300025940 Ga0207691_10452770 Ga0207691_104527701 148
472 3300025942 Ga0207689_10192899 Ga0207689_101928992 148
473 3300025944 Ga0207661_10979361 Ga0207661_109793611 148
474 3300025945 Ga0207679_10684965 Ga0207679_106849652 148
475 3300025945 Ga0207679_10744100 Ga0207679_107441002 148
476 3300025961 Ga0207712_10358142 Ga0207712_103581422 148
477 3300025961 Ga0207712_10934600 Ga0207712_109346001 148
478 3300026023 Ga0207677_10652976 Ga0207677_106529762 148
479 3300026075 Ga0207708_10037154 Ga0207708_100371543 148
480 3300026089 Ga0207648_10095647 Ga0207648_100956472 148
481 3300026116 Ga0207674_10441918 Ga0207674_104419182 148
482 3300026121 Ga0207683_10030169 Ga0207683_100301693 148
483 3300027360 Ga0209969_1002320 Ga0209969_10023202 148
484 3300027364 Ga0209967_1014135 Ga0209967_10141351 148
485 3300027378 Ga0209981_1001042 Ga0209981_10010422 148
486 3300027462 Ga0210000_1001529 Ga0210000_10015294 148
487 3300027526 Ga0209968_1000346 Ga0209968_10003464 148
488 3300027552 Ga0209982_1001132 Ga0209982_10011323 148
489 3300027617 Ga0210002_1001021 Ga0210002_10010214 148
490 3300027682 Ga0209971_1002421 Ga0209971_10024215 148
491 3300027717 Ga0209998_10001474 Ga0209998_100014743 148
492 3300045051 Ga0451576_0467357 Ga0451576_0467357_432_905 148
493 3300049571 Ga0501034_0529015 Ga0501034_0529015_374_859 148
494 3300049586 Ga0501070_0439229 Ga0501070_0439229_19_504 148
495 3300050508 nmdc:mga09592_712282_c1 nmdc:mga09592_712282_c1_300_773 148
496 3300050510 nmdc:mga06r32_484933_c1 nmdc:mga06r32_484933_c1_702_1175 148
497 3300050513 nmdc:mga0rr50_29937_c1 nmdc:mga0rr50_29937_c1_897_1370 148
498 3300009545 Ga0105237_10070831 Ga0105237_100708314 149
499 3300027252 Ga0209973_1004488 Ga0209973_10044881 149
500 3300027395 Ga0209996_1000384 Ga0209996_10003843 149
501 3300027424 Ga0209984_1001756 Ga0209984_10017564 149
502 3300027876 Ga0209974_10009400 Ga0209974_100094002 149
503 3300027907 Ga0207428_10030176 Ga0207428_100301762 149
504 3300028379 Ga0268266_10263302 Ga0268266_102633022 149
505 3300050509 nmdc:mga0qj67_681524_c1 nmdc:mga0qj67_681524_c1_284_757 149
506 3300009545 Ga0105237_10021349 Ga0105237_100213492 150
507 3300009551 Ga0105238_10026691 Ga0105238_100266918 150
508 3300033180 Ga0307510_10000012 Ga0307510_1000001229 150
509 iso_pu_bacteria 2870068957 2870076915 150
510 3300005354 Ga0070675_100276312 Ga0070675_1002763123 151
511 3300037418 Ga0395900_0073098 Ga0395900_0073098_2972_3457 151
512 3300037466 Ga0395898_0000627 Ga0395898_0000627_1272_1757 151
513 3300038443 Ga0395901_0000080 Ga0395901_0000080_1257_1742 151
514 3300038443 Ga0395901_0067955 Ga0395901_0067955_1956_2441 151
515 3300039450 Ga0436363_0006987 Ga0436363_0006987_378_881 151
516 3300044694 Ga0466963_0663508 Ga0466963_0663508_44_574 151
517 3300005435 Ga0070714_100141889 Ga0070714_1001418893 152
518 3300025900 Ga0207710_10032229 Ga0207710_100322293 152
519 3300033180 Ga0307510_10010364 Ga0307510_100103647 152
520 3300046558 Ga0495633_0042588 Ga0495633_0042588_875_1366 152
521 3300046665 Ga0495661_0012073 Ga0495661_0012073_697_1188 152
522 3300009093 Ga0105240_10032843 Ga0105240_100328433 153
523 3300009545 Ga0105237_10131656 Ga0105237_101316563 153
524 3300025914 Ga0207671_10200572 Ga0207671_102005722 153
525 3300045049 Ga0466959_0055261 Ga0466959_0055261_1532_2056 153
526 3300046492 Ga0495585_0012249 Ga0495585_0012249_3132_3626 153
527 3300046518 Ga0495631_0027166 Ga0495631_0027166_968_1462 153
528 3300046558 Ga0495633_0086004 Ga0495633_0086004_235_729 153
529 3300046648 Ga0495611_0007774 Ga0495611_0007774_3621_4115 153
530 3300046691 Ga0495670_0125175 Ga0495670_0125175_465_959 153
531 3300046794 Ga0495589_0035782 Ga0495589_0035782_253_747 153
532 3300047318 Ga0495636_0009952 Ga0495636_0009952_159_653 153
533 3300047323 Ga0495683_0109399 Ga0495683_0109399_81_575 153
534 3300005335 Ga0070666_10216222 Ga0070666_102162222 154
535 3300005355 Ga0070671_100018587 Ga0070671_1000185872 154
536 3300005367 Ga0070667_100015927 Ga0070667_1000159272 154
537 3300005617 Ga0068859_100017980 Ga0068859_1000179805 154
538 3300005841 Ga0068863_100008728 Ga0068863_1000087286 154
539 3300005842 Ga0068858_100038712 Ga0068858_1000387125 154
540 3300006931 Ga0097620_100017980 Ga0097620_1000179805 154
541 3300009092 Ga0105250_10021756 Ga0105250_100217563 154
542 3300009101 Ga0105247_10001303 Ga0105247_1000130317 154
543 3300014968 Ga0157379_10013954 Ga0157379_100139542 154
544 3300025900 Ga0207710_10001602 Ga0207710_100016028 154
545 3300025903 Ga0207680_10075541 Ga0207680_100755413 154
546 3300026088 Ga0207641_10020066 Ga0207641_100200666 154
547 3300031239 Ga0265328_10214670 Ga0265328_102146701 154
548 3300031250 Ga0265331_10008403 Ga0265331_100084032 154
549 3300031251 Ga0265327_10008760 Ga0265327_100087605 154
550 3300048905 Ga0496102_0080347 Ga0496102_0080347_65_598 154
551 3300048915 Ga0496112_0066865 Ga0496112_0066865_564_1097 154
552 3300048924 Ga0496121_0047627 Ga0496121_0047627_2559_3092 154
553 3300048927 Ga0496124_0215296 Ga0496124_0215296_705_1238 154
554 3300005295 Ga0065707_10102058 Ga0065707_101020583 155
555 3300005467 Ga0070706_101689018 Ga0070706_1016890181 155
556 3300005544 Ga0070686_100004948 Ga0070686_1000049487 155
557 3300006871 Ga0075434_100130663 Ga0075434_1001306632 155
558 3300006871 Ga0075434_100398513 Ga0075434_1003985133 155
559 3300009176 Ga0105242_10269495 Ga0105242_102694952 155
560 3300013296 Ga0157374_10114547 Ga0157374_101145473 155
561 3300014969 Ga0157376_10393271 Ga0157376_103932712 155
562 3300025923 Ga0207681_10639540 Ga0207681_106395401 155
563 3300025931 Ga0207644_10022263 Ga0207644_100222635 155
564 3300025934 Ga0207686_10208838 Ga0207686_102088382 155
565 3300025936 Ga0207670_11197799 Ga0207670_111977991 155
566 3300025986 Ga0207658_10486269 Ga0207658_104862692 155
567 3300028381 Ga0268264_10031199 Ga0268264_100311994 155
568 3300042461 Ga0439460_0190185 Ga0439460_0190185_164_637 155
569 3300048910 Ga0496107_0305350 Ga0496107_0305350_98_631 155
570 3300048911 Ga0496108_0173318 Ga0496108_0173318_1034_1567 155
571 3300048928 Ga0496125_0051802 Ga0496125_0051802_348_881 155
572 3300049580 Ga0501046_0923634 Ga0501046_0923634_70_543 155
573 3300049587 Ga0501071_0206392 Ga0501071_0206392_433_906 155
574 3300049741 Ga0501079_0149772 Ga0501079_0149772_495_968 155
575 3300050507 nmdc:mga05p37_336634_c1 nmdc:mga05p37_336634_c1_1283_1756 155
576 3300050512 nmdc:mga0n895_482303_c1 nmdc:mga0n895_482303_c1_313_825 155
577 3300050512 nmdc:mga0n895_560603_c1 nmdc:mga0n895_560603_c1_458_931 155
578 3300050515 nmdc:mga0a205_32731_c1 nmdc:mga0a205_32731_c1_925_1398 155
579 3300003214 JGI25165J46597_1000321 JGI25165J46597_100032112 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

118

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.9429 1 115
5cb9-assembly1.cif.gz_A crystal structure of c-as lyase with mercaptoethonal 0.9167 1 114
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.9052 1 115
5hcw-assembly5.cif.gz_A crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.8936 1 114
5hcw-assembly6.cif.gz_C crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.8838 1 117
ID Description Score Start End Superfamily
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8838 1 117 3.10.180.10
5hcwC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8765 1 117 3.10.180.10
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.869 5 51 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8366 5 53 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7559 5 53 3.30.720.120
ID Description Score Start End GO Terms
AF-T0YRD2-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase (EC 4.4.1.5) 0.9912 1 122 GO:0004462
GO:0046686
GO:0051213
AF-A0A4Q3NYQ8-F1-model_v4 deleted 0.9908 1 57
AF-A0A242MLI4-F1-model_v4 Lactoylglutathione lyase / Cadmium-induced protein CadI 0.9885 1 122 GO:0016829
GO:0046686
AF-A0A850T755-F1-model_v4 VOC family protein 0.9758 1 126 GO:0046686
AF-A0A0P0D2V1-F1-model_v4 Glyoxalase 0.9738 1 121 GO:0046686

Feature Viewer

pLDDT pTM Quality
80.35 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map