F465836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 331 | 578 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10200572|Ga0207671_102005722 |
| Length | 178 |
| Sequence | MKGNLMKRFHVHVSVSNLDESIRFYSRLFGGEPTLLKPDYAKWMLDDPRVNFAISTHHQPTGVNHLGFQVDSDEELRGMQARLQAADARMIQEDEQPCCYARSDKYWVTDPSGIAWETFHTLASIPVYGEDTSVFHHGASTTPVRAETAGTKTVCCVPAPKSSPRSEREQCCSSNESA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 2 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 234 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 235 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 0.86 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0.35 |
| Rhizoplane | 3.28 |
| Rhizosphere | 90.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000321 | 3300003214 | Bacteria | 57780 |
| 2 | rootH1_10084223 | 3300003316 | Bacteria | 3873 |
| 3 | rootH1_10084223 | 3300003323 | Bacteria | 12648 |
| 4 | rootH2_10095172 | 3300003320 | Bacteria | 1485 |
| 5 | rootH2_10095173 | 3300003320 | Unclassified | 2030 |
| 6 | rootH1_10203424 | 3300003323 | Bacteria | 1486 |
| 7 | Ga0065704_10411670 | 3300005289 | Unclassified | 741 |
| 8 | Ga0065712_10220827 | 3300005290 | Bacteria | 1042 |
| 9 | Ga0065712_10293611 | 3300005290 | Bacteria | 873 |
| 10 | Ga0065715_10158843 | 3300005293 | Bacteria | 1642 |
| 11 | Ga0065707_10102058 | 3300005295 | Bacteria | 2829 |
| 12 | Ga0070658_10807118 | 3300005327 | Unclassified | 815 |
| 13 | Ga0070683_100233978 | 3300005329 | Unclassified | 1747 |
| 14 | Ga0070670_100134703 | 3300005331 | Bacteria | 2134 |
| 15 | Ga0070677_10102948 | 3300005333 | Unclassified | 1262 |
| 16 | Ga0068869_100093400 | 3300005334 | Bacteria | 2267 |
| 17 | Ga0068869_100283582 | 3300005334 | Bacteria | 1333 |
| 18 | Ga0068869_100578384 | 3300005334 | Bacteria | 947 |
| 19 | Ga0070666_10001013 | 3300005335 | Bacteria | 17214 |
| 20 | Ga0070666_10107936 | 3300005335 | Bacteria | 1924 |
| 21 | Ga0070666_10188234 | 3300005335 | Unclassified | 1450 |
| 22 | Ga0070666_10216222 | 3300005335 | Bacteria | 1351 |
| 23 | Ga0070680_100631990 | 3300005336 | Bacteria | 920 |
| 24 | Ga0070682_100463639 | 3300005337 | Bacteria | 973 |
| 25 | Ga0068868_100000522 | 3300005338 | Bacteria | 25761 |
| 26 | Ga0068868_100002574 | 3300005338 | Bacteria | 12586 |
| 27 | Ga0068868_100811065 | 3300005338 | Bacteria | 845 |
| 28 | Ga0070660_100869319 | 3300005339 | Bacteria | 759 |
| 29 | Ga0070689_100008295 | 3300005340 | Bacteria | 7312 |
| 30 | Ga0070689_100291326 | 3300005340 | Bacteria | 1357 |
| 31 | Ga0070689_101091633 | 3300005340 | Bacteria | 713 |
| 32 | Ga0070691_10168404 | 3300005341 | Unclassified | 1134 |
| 33 | Ga0070687_100179499 | 3300005343 | Bacteria | 1267 |
| 34 | Ga0070687_100620978 | 3300005343 | Unclassified | 745 |
| 35 | Ga0070675_100276312 | 3300005354 | Bacteria | 1475 |
| 36 | Ga0070675_100741985 | 3300005354 | Bacteria | 896 |
| 37 | Ga0070671_100018587 | 3300005355 | Bacteria | 5647 |
| 38 | Ga0070671_100025744 | 3300005355 | Bacteria | 4830 |
| 39 | Ga0070671_100084164 | 3300005355 | Bacteria | 2660 |
| 40 | Ga0070674_100289991 | 3300005356 | Bacteria | 1300 |
| 41 | Ga0070673_100000835 | 3300005364 | Bacteria | 17272 |
| 42 | Ga0070673_100136022 | 3300005364 | Bacteria | 2068 |
| 43 | Ga0070688_100010345 | 3300005365 | Bacteria | 5141 |
| 44 | Ga0070659_100321058 | 3300005366 | Unclassified | 1294 |
| 45 | Ga0070667_100015927 | 3300005367 | Bacteria | 6220 |
| 46 | Ga0070667_100058065 | 3300005367 | Bacteria | 3271 |
| 47 | Ga0070667_100076875 | 3300005367 | Bacteria | 2850 |
| 48 | Ga0070667_100436987 | 3300005367 | Bacteria | 1195 |
| 49 | Ga0070667_100558571 | 3300005367 | Bacteria | 1052 |
| 50 | Ga0070709_10038705 | 3300005434 | Bacteria | 2922 |
| 51 | Ga0070709_10498805 | 3300005434 | Bacteria | 924 |
| 52 | Ga0070714_100141889 | 3300005435 | Bacteria | 2157 |
| 53 | Ga0070713_100000712 | 3300005436 | Bacteria | 21343 |
| 54 | Ga0070710_10001809 | 3300005437 | Bacteria | 10106 |
| 55 | Ga0070701_10265870 | 3300005438 | Bacteria | 1041 |
| 56 | Ga0070711_100001177 | 3300005439 | Bacteria | 14082 |
| 57 | Ga0070711_100097721 | 3300005439 | Bacteria | 2130 |
| 58 | Ga0070711_100462536 | 3300005439 | Bacteria | 1040 |
| 59 | Ga0070705_100680545 | 3300005440 | Bacteria | 806 |
| 60 | Ga0070700_100200174 | 3300005441 | Unclassified | 1402 |
| 61 | Ga0070694_100638346 | 3300005444 | Bacteria | 861 |
| 62 | Ga0070708_100024240 | 3300005445 | Bacteria | 5172 |
| 63 | Ga0070708_100376308 | 3300005445 | Bacteria | 1339 |
| 64 | Ga0070663_100439519 | 3300005455 | Bacteria | 1073 |
| 65 | Ga0070678_100008526 | 3300005456 | Bacteria | 6141 |
| 66 | Ga0070678_100117482 | 3300005456 | Bacteria | 2091 |
| 67 | Ga0070678_100467500 | 3300005456 | Bacteria | 1107 |
| 68 | Ga0070662_100046499 | 3300005457 | Bacteria | 3118 |
| 69 | Ga0070662_100549598 | 3300005457 | Bacteria | 967 |
| 70 | Ga0068867_100075762 | 3300005459 | Bacteria | 2524 |
| 71 | Ga0068867_100293782 | 3300005459 | Bacteria | 1337 |
| 72 | Ga0068867_101200904 | 3300005459 | Bacteria | 697 |
| 73 | Ga0070685_10004441 | 3300005466 | Bacteria | 7091 |
| 74 | Ga0070706_101689018 | 3300005467 | Bacteria | 577 |
| 75 | Ga0070698_100193172 | 3300005471 | Bacteria | 1973 |
| 76 | Ga0070699_100026303 | 3300005518 | Bacteria | 5019 |
| 77 | Ga0070699_100261773 | 3300005518 | Bacteria | 1547 |
| 78 | Ga0070699_100713911 | 3300005518 | Unclassified | 916 |
| 79 | Ga0070697_100785246 | 3300005536 | Bacteria | 842 |
| 80 | Ga0068853_100564481 | 3300005539 | Bacteria | 1079 |
| 81 | Ga0070672_100330204 | 3300005543 | Unclassified | 1297 |
| 82 | Ga0070686_100004948 | 3300005544 | Bacteria | 7347 |
| 83 | Ga0070686_100043225 | 3300005544 | Bacteria | 2827 |
| 84 | Ga0070686_100381848 | 3300005544 | Unclassified | 1067 |
| 85 | Ga0070696_100377482 | 3300005546 | Bacteria | 1104 |
| 86 | Ga0070693_100220847 | 3300005547 | Bacteria | 1241 |
| 87 | Ga0070665_100011365 | 3300005548 | Bacteria | 9003 |
| 88 | Ga0070665_100063118 | 3300005548 | Bacteria | 3715 |
| 89 | Ga0070665_100077716 | 3300005548 | Bacteria | 3325 |
| 90 | Ga0070665_100093922 | 3300005548 | Bacteria | 3004 |
| 91 | Ga0070665_100182357 | 3300005548 | Bacteria | 2100 |
| 92 | Ga0070665_100556780 | 3300005548 | Bacteria | 1159 |
| 93 | Ga0070704_100095347 | 3300005549 | Bacteria | 2228 |
| 94 | Ga0070704_101189553 | 3300005549 | Unclassified | 695 |
| 95 | Ga0068855_100233950 | 3300005563 | Bacteria | 2056 |
| 96 | Ga0068855_100726896 | 3300005563 | Bacteria | 1060 |
| 97 | Ga0068855_101253547 | 3300005563 | Unclassified | 769 |
| 98 | Ga0070664_100669118 | 3300005564 | Unclassified | 965 |
| 99 | Ga0068857_100422641 | 3300005577 | Bacteria | 1243 |
| 100 | Ga0068854_100008340 | 3300005578 | Bacteria | 6657 |
| 101 | Ga0068854_100802741 | 3300005578 | Unclassified | 820 |
| 102 | Ga0068856_100225332 | 3300005614 | Bacteria | 1890 |
| 103 | Ga0070702_100035303 | 3300005615 | Bacteria | 2762 |
| 104 | Ga0070702_100071359 | 3300005615 | Bacteria | 2052 |
| 105 | Ga0070702_100610438 | 3300005615 | Bacteria | 819 |
| 106 | Ga0068852_100102527 | 3300005616 | Bacteria | 2586 |
| 107 | Ga0068852_100338123 | 3300005616 | Bacteria | 1467 |
| 108 | Ga0068859_100011219 | 3300005617 | Bacteria | 9011 |
| 109 | Ga0068859_100017980 | 3300005617 | Bacteria | 7105 |
| 110 | Ga0068859_100133085 | 3300005617 | Bacteria | 2559 |
| 111 | Ga0068859_100484645 | 3300005617 | Bacteria | 1332 |
| 112 | Ga0068864_100001938 | 3300005618 | Bacteria | 17002 |
| 113 | Ga0068864_100019247 | 3300005618 | Bacteria | 5707 |
| 114 | Ga0068864_100932774 | 3300005618 | Bacteria | 858 |
| 115 | Ga0068864_101076678 | 3300005618 | Bacteria | 799 |
| 116 | Ga0068864_101463325 | 3300005618 | Bacteria | 686 |
| 117 | Ga0068866_10022200 | 3300005718 | Bacteria | 2935 |
| 118 | Ga0068866_10193501 | 3300005718 | Bacteria | 1210 |
| 119 | Ga0068861_100412051 | 3300005719 | Bacteria | 1202 |
| 120 | Ga0068861_100797061 | 3300005719 | Bacteria | 886 |
| 121 | Ga0068861_101191516 | 3300005719 | Bacteria | 736 |
| 122 | Ga0068851_10001783 | 3300005834 | Bacteria | 9415 |
| 123 | Ga0068870_10038565 | 3300005840 | Bacteria | 2468 |
| 124 | Ga0068863_100008728 | 3300005841 | Bacteria | 9901 |
| 125 | Ga0068863_100094267 | 3300005841 | Bacteria | 2841 |
| 126 | Ga0068858_100004196 | 3300005842 | Bacteria | 14186 |
| 127 | Ga0068858_100038712 | 3300005842 | Bacteria | 4423 |
| 128 | Ga0068858_100074710 | 3300005842 | Bacteria | 3148 |
| 129 | Ga0068860_100018163 | 3300005843 | Bacteria | 6846 |
| 130 | Ga0068860_100058699 | 3300005843 | Bacteria | 3658 |
| 131 | Ga0068860_100065128 | 3300005843 | Bacteria | 3461 |
| 132 | Ga0068860_100750432 | 3300005843 | Bacteria | 987 |
| 133 | Ga0068860_100763134 | 3300005843 | Bacteria | 979 |
| 134 | Ga0068860_100981775 | 3300005843 | Bacteria | 862 |
| 135 | Ga0068862_100030215 | 3300005844 | Bacteria | 4566 |
| 136 | Ga0081540_1000303 | 3300005983 | Bacteria | 50969 |
| 137 | Ga0070717_11088910 | 3300006028 | Bacteria | 728 |
| 138 | Ga0075365_10091594 | 3300006038 | Bacteria | 2072 |
| 139 | Ga0075363_100136311 | 3300006048 | Bacteria | 1380 |
| 140 | Ga0075432_10011774 | 3300006058 | Bacteria | 2973 |
| 141 | Ga0070715_10023161 | 3300006163 | Bacteria | 2430 |
| 142 | Ga0070716_100032681 | 3300006173 | Bacteria | 2840 |
| 143 | Ga0070712_100001213 | 3300006175 | Bacteria | 15601 |
| 144 | Ga0097621_100018496 | 3300006237 | Bacteria | 5325 |
| 145 | Ga0097621_100041452 | 3300006237 | Bacteria | 3706 |
| 146 | Ga0068871_100030240 | 3300006358 | Bacteria | 4262 |
| 147 | Ga0068871_100062560 | 3300006358 | Bacteria | 3042 |
| 148 | Ga0075430_100167683 | 3300006846 | Bacteria | 1827 |
| 149 | Ga0075430_100259480 | 3300006846 | Bacteria | 1439 |
| 150 | Ga0075431_100562855 | 3300006847 | Unclassified | 1126 |
| 151 | Ga0075433_10206708 | 3300006852 | Bacteria | 1745 |
| 152 | Ga0075434_100064745 | 3300006871 | Bacteria | 3640 |
| 153 | Ga0075434_100130663 | 3300006871 | Bacteria | 2530 |
| 154 | Ga0075434_100398513 | 3300006871 | Bacteria | 1397 |
| 155 | Ga0075429_100176960 | 3300006880 | Bacteria | 1869 |
| 156 | Ga0068865_100047077 | 3300006881 | Bacteria | 2961 |
| 157 | Ga0068865_100167173 | 3300006881 | Bacteria | 1683 |
| 158 | Ga0075436_100259250 | 3300006914 | Bacteria | 1239 |
| 159 | Ga0097620_100011219 | 3300006931 | Bacteria | 9011 |
| 160 | Ga0097620_100017980 | 3300006931 | Bacteria | 7105 |
| 161 | Ga0097620_100133092 | 3300006931 | Bacteria | 2559 |
| 162 | Ga0097620_100484681 | 3300006931 | Bacteria | 1332 |
| 163 | Ga0079104_1015595 | 3300006946 | Bacteria | 2247 |
| 164 | Ga0075435_100042739 | 3300007076 | Bacteria | 3626 |
| 165 | Ga0075435_100157455 | 3300007076 | Bacteria | 1912 |
| 166 | Ga0099794_10140982 | 3300007265 | Bacteria | 1221 |
| 167 | Ga0099795_10428369 | 3300007788 | Bacteria | 606 |
| 168 | Ga0105250_10021756 | 3300009092 | Bacteria | 2587 |
| 169 | Ga0105240_10026698 | 3300009093 | Bacteria | 7575 |
| 170 | Ga0105240_10032843 | 3300009093 | Bacteria | 6713 |
| 171 | Ga0105240_10084608 | 3300009093 | Bacteria | 3889 |
| 172 | Ga0105240_10123602 | 3300009093 | Bacteria | 3113 |
| 173 | Ga0105240_11474083 | 3300009093 | Unclassified | 714 |
| 174 | Ga0105245_10002420 | 3300009098 | Bacteria | 16890 |
| 175 | Ga0105245_10015461 | 3300009098 | Bacteria | 6653 |
| 176 | Ga0105245_10615861 | 3300009098 | Bacteria | 1113 |
| 177 | Ga0105245_10803596 | 3300009098 | Bacteria | 979 |
| 178 | Ga0105247_10001303 | 3300009101 | Bacteria | 18336 |
| 179 | Ga0105247_10009670 | 3300009101 | Bacteria | 5847 |
| 180 | Ga0114129_10067285 | 3300009147 | Bacteria | 4997 |
| 181 | Ga0105243_10213111 | 3300009148 | Bacteria | 1702 |
| 182 | Ga0105243_10299809 | 3300009148 | Bacteria | 1456 |
| 183 | Ga0105241_10031856 | 3300009174 | Bacteria | 3949 |
| 184 | Ga0105241_10058376 | 3300009174 | Bacteria | 2963 |
| 185 | Ga0105241_10425112 | 3300009174 | Bacteria | 1170 |
| 186 | Ga0105241_10783144 | 3300009174 | Bacteria | 877 |
| 187 | Ga0105242_10004900 | 3300009176 | Bacteria | 10363 |
| 188 | Ga0105242_10016942 | 3300009176 | Bacteria | 5671 |
| 189 | Ga0105242_10050753 | 3300009176 | Bacteria | 3378 |
| 190 | Ga0105242_10179972 | 3300009176 | Bacteria | 1865 |
| 191 | Ga0105242_10269495 | 3300009176 | Unclassified | 1541 |
| 192 | Ga0105248_10015968 | 3300009177 | Bacteria | 8268 |
| 193 | Ga0105248_10130118 | 3300009177 | Bacteria | 2839 |
| 194 | Ga0105237_10021349 | 3300009545 | Bacteria | 6657 |
| 195 | Ga0105237_10070831 | 3300009545 | Bacteria | 3482 |
| 196 | Ga0105237_10131656 | 3300009545 | Bacteria | 2496 |
| 197 | Ga0105237_10420212 | 3300009545 | Bacteria | 1342 |
| 198 | Ga0105237_10847970 | 3300009545 | Bacteria | 920 |
| 199 | Ga0105237_10899212 | 3300009545 | Bacteria | 892 |
| 200 | Ga0105238_10002918 | 3300009551 | Bacteria | 17077 |
| 201 | Ga0105238_10026691 | 3300009551 | Bacteria | 5888 |
| 202 | Ga0105249_10029342 | 3300009553 | Bacteria | 4967 |
| 203 | Ga0105249_10288863 | 3300009553 | Bacteria | 1641 |
| 204 | Ga0105249_10313021 | 3300009553 | Bacteria | 1579 |
| 205 | Ga0105249_10373082 | 3300009553 | Bacteria | 1451 |
| 206 | Ga0105249_11713625 | 3300009553 | Bacteria | 701 |
| 207 | Ga0105239_10044769 | 3300010375 | Bacteria | 4850 |
| 208 | Ga0105239_10154747 | 3300010375 | Bacteria | 2560 |
| 209 | Ga0105239_10992634 | 3300010375 | Bacteria | 965 |
| 210 | Ga0105246_10041725 | 3300011119 | Bacteria | 3103 |
| 211 | Ga0105246_10140731 | 3300011119 | Unclassified | 1814 |
| 212 | Ga0105246_10203873 | 3300011119 | Bacteria | 1539 |
| 213 | Ga0157315_1004010 | 3300012508 | Bacteria | 1029 |
| 214 | Ga0157370_10115549 | 3300013104 | Bacteria | 2507 |
| 215 | Ga0157374_10000534 | 3300013296 | Bacteria | 34050 |
| 216 | Ga0157374_10050535 | 3300013296 | Bacteria | 3865 |
| 217 | Ga0157374_10114547 | 3300013296 | Bacteria | 2596 |
| 218 | Ga0157374_10296343 | 3300013296 | Bacteria | 1599 |
| 219 | Ga0157378_10025221 | 3300013297 | Bacteria | 5237 |
| 220 | Ga0157378_10072609 | 3300013297 | Bacteria | 3092 |
| 221 | Ga0157378_10174871 | 3300013297 | Bacteria | 2016 |
| 222 | Ga0157378_10243347 | 3300013297 | Bacteria | 1719 |
| 223 | Ga0157378_10419276 | 3300013297 | Bacteria | 1323 |
| 224 | Ga0157378_10562810 | 3300013297 | Bacteria | 1147 |
| 225 | Ga0163162_10004145 | 3300013306 | Bacteria | 13918 |
| 226 | Ga0163162_10051375 | 3300013306 | Bacteria | 4137 |
| 227 | Ga0163162_10119052 | 3300013306 | Bacteria | 2743 |
| 228 | Ga0163162_10255430 | 3300013306 | Bacteria | 1884 |
| 229 | Ga0163162_10421120 | 3300013306 | Bacteria | 1468 |
| 230 | Ga0163162_10773297 | 3300013306 | Bacteria | 1079 |
| 231 | Ga0163162_11740097 | 3300013306 | Bacteria | 712 |
| 232 | Ga0157372_10723359 | 3300013307 | Unclassified | 1158 |
| 233 | Ga0157372_11321120 | 3300013307 | Bacteria | 832 |
| 234 | Ga0157375_10016183 | 3300013308 | Bacteria | 6690 |
| 235 | Ga0157375_11744863 | 3300013308 | Unclassified | 737 |
| 236 | Ga0163163_10002518 | 3300014325 | Bacteria | 15510 |
| 237 | Ga0163163_10004501 | 3300014325 | Bacteria | 11895 |
| 238 | Ga0157380_10020598 | 3300014326 | Unclassified | 4932 |
| 239 | Ga0182008_10135533 | 3300014497 | Bacteria | 1230 |
| 240 | Ga0182008_10309190 | 3300014497 | Bacteria | 829 |
| 241 | Ga0157377_10148069 | 3300014745 | Bacteria | 1449 |
| 242 | Ga0157377_10220389 | 3300014745 | Bacteria | 1214 |
| 243 | Ga0157379_10011237 | 3300014968 | Bacteria | 7801 |
| 244 | Ga0157379_10013954 | 3300014968 | Bacteria | 7041 |
| 245 | Ga0157379_10096339 | 3300014968 | Bacteria | 2656 |
| 246 | Ga0157379_10190000 | 3300014968 | Bacteria | 1856 |
| 247 | Ga0157379_10262494 | 3300014968 | Bacteria | 1569 |
| 248 | Ga0157379_11893576 | 3300014968 | Bacteria | 588 |
| 249 | Ga0157376_10005553 | 3300014969 | Bacteria | 8819 |
| 250 | Ga0157376_10057824 | 3300014969 | Bacteria | 3246 |
| 251 | Ga0157376_10088352 | 3300014969 | Bacteria | 2677 |
| 252 | Ga0157376_10383003 | 3300014969 | Bacteria | 1355 |
| 253 | Ga0157376_10393271 | 3300014969 | Bacteria | 1338 |
| 254 | Ga0182007_10084654 | 3300015262 | Bacteria | 1041 |
| 255 | Ga0224572_1004446 | 3300024225 | Bacteria | 2439 |
| 256 | Ga0207656_10022841 | 3300025321 | Bacteria | 2513 |
| 257 | Ga0207710_10001602 | 3300025900 | Bacteria | 11074 |
| 258 | Ga0207710_10032229 | 3300025900 | Bacteria | 2295 |
| 259 | Ga0207688_10255827 | 3300025901 | Unclassified | 1062 |
| 260 | Ga0207680_10011165 | 3300025903 | Bacteria | 4526 |
| 261 | Ga0207680_10075541 | 3300025903 | Bacteria | 2101 |
| 262 | Ga0207680_10087841 | 3300025903 | Bacteria | 1970 |
| 263 | Ga0207680_10182609 | 3300025903 | Bacteria | 1419 |
| 264 | Ga0207685_10012812 | 3300025905 | Bacteria | 2572 |
| 265 | Ga0207699_10008937 | 3300025906 | Bacteria | 4968 |
| 266 | Ga0207645_10090371 | 3300025907 | Bacteria | 1969 |
| 267 | Ga0207645_10096399 | 3300025907 | Bacteria | 1905 |
| 268 | Ga0207643_10017345 | 3300025908 | Bacteria | 3936 |
| 269 | Ga0207705_10169213 | 3300025909 | Bacteria | 1645 |
| 270 | Ga0207705_10948501 | 3300025909 | Unclassified | 666 |
| 271 | Ga0207654_10148842 | 3300025911 | Bacteria | 1501 |
| 272 | Ga0207654_10260372 | 3300025911 | Bacteria | 1166 |
| 273 | Ga0207707_10569318 | 3300025912 | Bacteria | 961 |
| 274 | Ga0207707_10933870 | 3300025912 | Unclassified | 715 |
| 275 | Ga0207695_10017237 | 3300025913 | Bacteria | 8412 |
| 276 | Ga0207695_10098682 | 3300025913 | Bacteria | 2920 |
| 277 | Ga0207695_10115012 | 3300025913 | Bacteria | 2665 |
| 278 | Ga0207671_10062347 | 3300025914 | Bacteria | 2769 |
| 279 | Ga0207671_10101661 | 3300025914 | Bacteria | 2178 |
| 280 | Ga0207671_10200572 | 3300025914 | Bacteria | 1558 |
| 281 | Ga0207671_11128419 | 3300025914 | Bacteria | 615 |
| 282 | Ga0207693_10000883 | 3300025915 | Bacteria | 26856 |
| 283 | Ga0207663_10005484 | 3300025916 | Bacteria | 6397 |
| 284 | Ga0207662_10133198 | 3300025918 | Bacteria | 1569 |
| 285 | Ga0207662_10312163 | 3300025918 | Unclassified | 1048 |
| 286 | Ga0207657_10162796 | 3300025919 | Bacteria | 1811 |
| 287 | Ga0207649_10063142 | 3300025920 | Bacteria | 2337 |
| 288 | Ga0207681_10585673 | 3300025923 | Bacteria | 921 |
| 289 | Ga0207681_10639540 | 3300025923 | Unclassified | 881 |
| 290 | Ga0207694_10005499 | 3300025924 | Bacteria | 9725 |
| 291 | Ga0207694_10894699 | 3300025924 | Unclassified | 751 |
| 292 | Ga0207650_10108882 | 3300025925 | Bacteria | 2142 |
| 293 | Ga0207650_10343569 | 3300025925 | Bacteria | 1226 |
| 294 | Ga0207687_10001328 | 3300025927 | Bacteria | 16912 |
| 295 | Ga0207687_10003454 | 3300025927 | Bacteria | 10643 |
| 296 | Ga0207687_10136960 | 3300025927 | Bacteria | 1853 |
| 297 | Ga0207700_10004910 | 3300025928 | Bacteria | 7944 |
| 298 | Ga0207664_11021443 | 3300025929 | Bacteria | 741 |
| 299 | Ga0207644_10005524 | 3300025931 | Bacteria | 8228 |
| 300 | Ga0207644_10022263 | 3300025931 | Bacteria | 4328 |
| 301 | Ga0207644_10411694 | 3300025931 | Bacteria | 1106 |
| 302 | Ga0207690_10046682 | 3300025932 | Bacteria | 2870 |
| 303 | Ga0207690_10399087 | 3300025932 | Unclassified | 1096 |
| 304 | Ga0207706_10001164 | 3300025933 | Bacteria | 26664 |
| 305 | Ga0207706_10127467 | 3300025933 | Bacteria | 2238 |
| 306 | Ga0207686_10000574 | 3300025934 | Bacteria | 23161 |
| 307 | Ga0207686_10025103 | 3300025934 | Bacteria | 3462 |
| 308 | Ga0207686_10037206 | 3300025934 | Bacteria | 2935 |
| 309 | Ga0207686_10062264 | 3300025934 | Bacteria | 2368 |
| 310 | Ga0207686_10208838 | 3300025934 | Bacteria | 1402 |
| 311 | Ga0207686_10349815 | 3300025934 | Bacteria | 1112 |
| 312 | Ga0207670_11197799 | 3300025936 | Unclassified | 643 |
| 313 | Ga0207669_10312018 | 3300025937 | Bacteria | 1200 |
| 314 | Ga0207669_10647986 | 3300025937 | Unclassified | 863 |
| 315 | Ga0207704_10025578 | 3300025938 | Bacteria | 3223 |
| 316 | Ga0207704_10102567 | 3300025938 | Bacteria | 1911 |
| 317 | Ga0207704_10221572 | 3300025938 | Bacteria | 1400 |
| 318 | Ga0207665_10054567 | 3300025939 | Bacteria | 2695 |
| 319 | Ga0207665_10171636 | 3300025939 | Bacteria | 1566 |
| 320 | Ga0207691_10452770 | 3300025940 | Bacteria | 1092 |
| 321 | Ga0207689_10030956 | 3300025942 | Bacteria | 4458 |
| 322 | Ga0207689_10110500 | 3300025942 | Bacteria | 2259 |
| 323 | Ga0207689_10192899 | 3300025942 | Unclassified | 1681 |
| 324 | Ga0207689_10651575 | 3300025942 | Bacteria | 887 |
| 325 | Ga0207661_10477502 | 3300025944 | Bacteria | 1138 |
| 326 | Ga0207661_10979361 | 3300025944 | Unclassified | 779 |
| 327 | Ga0207679_10064697 | 3300025945 | Bacteria | 2734 |
| 328 | Ga0207679_10684965 | 3300025945 | Bacteria | 929 |
| 329 | Ga0207679_10744100 | 3300025945 | Unclassified | 891 |
| 330 | Ga0207667_10019902 | 3300025949 | Bacteria | 7479 |
| 331 | Ga0207667_10138117 | 3300025949 | Bacteria | 2510 |
| 332 | Ga0207667_10390490 | 3300025949 | Bacteria | 1417 |
| 333 | Ga0207651_10413907 | 3300025960 | Bacteria | 1149 |
| 334 | Ga0207651_10955755 | 3300025960 | Bacteria | 764 |
| 335 | Ga0207651_12072487 | 3300025960 | Bacteria | 511 |
| 336 | Ga0207712_10000488 | 3300025961 | Bacteria | 33024 |
| 337 | Ga0207712_10031774 | 3300025961 | Bacteria | 3558 |
| 338 | Ga0207712_10215758 | 3300025961 | Bacteria | 1531 |
| 339 | Ga0207712_10358142 | 3300025961 | Bacteria | 1215 |
| 340 | Ga0207712_10417598 | 3300025961 | Bacteria | 1131 |
| 341 | Ga0207712_10934600 | 3300025961 | Unclassified | 768 |
| 342 | Ga0207658_10030475 | 3300025986 | Bacteria | 3819 |
| 343 | Ga0207658_10054185 | 3300025986 | Bacteria | 2966 |
| 344 | Ga0207658_10486269 | 3300025986 | Bacteria | 1097 |
| 345 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 346 | Ga0207677_10000157 | 3300026023 | Bacteria | 53946 |
| 347 | Ga0207677_10102598 | 3300026023 | Bacteria | 2109 |
| 348 | Ga0207677_10652976 | 3300026023 | Bacteria | 929 |
| 349 | Ga0207639_10300280 | 3300026041 | Bacteria | 1419 |
| 350 | Ga0207678_10033556 | 3300026067 | Bacteria | 4471 |
| 351 | Ga0207708_10037154 | 3300026075 | Bacteria | 3710 |
| 352 | Ga0207702_11642370 | 3300026078 | Unclassified | 636 |
| 353 | Ga0207641_10002007 | 3300026088 | Bacteria | 19404 |
| 354 | Ga0207641_10020066 | 3300026088 | Bacteria | 5488 |
| 355 | Ga0207641_10067393 | 3300026088 | Bacteria | 3066 |
| 356 | Ga0207641_11385522 | 3300026088 | Bacteria | 704 |
| 357 | Ga0207648_10054827 | 3300026089 | Bacteria | 3481 |
| 358 | Ga0207648_10095647 | 3300026089 | Bacteria | 2599 |
| 359 | Ga0207676_10000219 | 3300026095 | Bacteria | 49390 |
| 360 | Ga0207676_10005360 | 3300026095 | Bacteria | 9082 |
| 361 | Ga0207674_10010018 | 3300026116 | Bacteria | 10784 |
| 362 | Ga0207674_10441918 | 3300026116 | Bacteria | 1257 |
| 363 | Ga0207675_100247245 | 3300026118 | Bacteria | 1725 |
| 364 | Ga0207675_100937850 | 3300026118 | Bacteria | 883 |
| 365 | Ga0207675_100953618 | 3300026118 | Bacteria | 875 |
| 366 | Ga0207683_10001745 | 3300026121 | Bacteria | 19275 |
| 367 | Ga0207683_10030169 | 3300026121 | Bacteria | 4697 |
| 368 | Ga0207683_10558413 | 3300026121 | Bacteria | 1059 |
| 369 | Ga0207698_10081836 | 3300026142 | Bacteria | 2608 |
| 370 | Ga0209281_1011400 | 3300027111 | Bacteria | 1993 |
| 371 | Ga0209973_1004488 | 3300027252 | Bacteria | 1439 |
| 372 | Ga0209969_1002320 | 3300027360 | Bacteria | 2628 |
| 373 | Ga0209967_1014135 | 3300027364 | Bacteria | 1136 |
| 374 | Ga0209981_1001042 | 3300027378 | Bacteria | 3515 |
| 375 | Ga0209996_1000384 | 3300027395 | Bacteria | 5406 |
| 376 | Ga0209984_1001756 | 3300027424 | Bacteria | 2375 |
| 377 | Ga0210000_1001529 | 3300027462 | Plasmid | 3259 |
| 378 | Ga0209968_1000346 | 3300027526 | Bacteria | 7751 |
| 379 | Ga0209982_1001132 | 3300027552 | Plasmid | 3567 |
| 380 | Ga0210002_1001021 | 3300027617 | Bacteria | 3866 |
| 381 | Ga0209971_1002421 | 3300027682 | Bacteria | 4489 |
| 382 | Ga0209998_10001474 | 3300027717 | Bacteria | 5679 |
| 383 | Ga0209974_10009400 | 3300027876 | Bacteria | 3317 |
| 384 | Ga0207428_10030176 | 3300027907 | Bacteria | 4485 |
| 385 | Ga0265357_1032552 | 3300028023 | Bacteria | 598 |
| 386 | Ga0268266_10009726 | 3300028379 | Bacteria | 8453 |
| 387 | Ga0268266_10010743 | 3300028379 | Bacteria | 7978 |
| 388 | Ga0268266_10092956 | 3300028379 | Bacteria | 2647 |
| 389 | Ga0268266_10263302 | 3300028379 | Bacteria | 1598 |
| 390 | Ga0268265_10111979 | 3300028380 | Bacteria | 2230 |
| 391 | Ga0268265_10285799 | 3300028380 | Bacteria | 1478 |
| 392 | Ga0268264_10031199 | 3300028381 | Bacteria | 4369 |
| 393 | Ga0268264_10038421 | 3300028381 | Bacteria | 3951 |
| 394 | Ga0268264_10211346 | 3300028381 | Bacteria | 1781 |
| 395 | Ga0268264_10277517 | 3300028381 | Bacteria | 1568 |
| 396 | Ga0265338_10446081 | 3300028800 | Bacteria | 917 |
| 397 | Ga0265762_1018597 | 3300030760 | Bacteria | 1269 |
| 398 | Ga0265763_1013973 | 3300030763 | Bacteria | 783 |
| 399 | Ga0265763_1024672 | 3300030763 | Bacteria | 653 |
| 400 | Ga0265763_1042787 | 3300030763 | Bacteria | 551 |
| 401 | Ga0265328_10214670 | 3300031239 | Bacteria | 732 |
| 402 | Ga0265331_10008403 | 3300031250 | Bacteria | 5873 |
| 403 | Ga0265327_10008760 | 3300031251 | Bacteria | 7471 |
| 404 | Ga0307408_100507594 | 3300031548 | Bacteria | 1057 |
| 405 | Ga0307508_10597119 | 3300031616 | Bacteria | 705 |
| 406 | Ga0307516_10001812 | 3300031730 | Bacteria | 29367 |
| 407 | Ga0316577_10310923 | 3300031733 | Bacteria | 893 |
| 408 | Ga0307411_10320865 | 3300032005 | Bacteria | 1251 |
| 409 | Ga0307510_10000012 | 3300033180 | Bacteria | 345634 |
| 410 | Ga0307510_10010364 | 3300033180 | Bacteria | 11068 |
| 411 | Ga0316586_1031693 | 3300033527 | Bacteria | 908 |
| 412 | Ga0373926_0054562 | 3300035083 | Bacteria | 1448 |
| 413 | Ga0373934_0003710 | 3300035086 | Bacteria | 5621 |
| 414 | Ga0373944_0083162 | 3300035089 | Bacteria | 1060 |
| 415 | Ga0373944_0140179 | 3300035089 | Bacteria | 846 |
| 416 | Ga0373923_0018613 | 3300035111 | Bacteria | 2676 |
| 417 | Ga0373936_0043113 | 3300035113 | Bacteria | 1813 |
| 418 | Ga0373945_0081224 | 3300035116 | Bacteria | 1242 |
| 419 | Ga0373945_0097167 | 3300035116 | Bacteria | 1148 |
| 420 | Ga0373954_0005421 | 3300035118 | Bacteria | 5518 |
| 421 | Ga0373956_0054394 | 3300035119 | Bacteria | 1803 |
| 422 | Ga0373957_0002782 | 3300035120 | Bacteria | 5038 |
| 423 | Ga0373943_0023094 | 3300035170 | Bacteria | 2889 |
| 424 | Ga0373943_0101023 | 3300035170 | Bacteria | 1508 |
| 425 | Ga0373955_0002969 | 3300035172 | Bacteria | 7428 |
| 426 | Ga0373955_0197379 | 3300035172 | Bacteria | 1197 |
| 427 | Ga0373924_0484091 | 3300035410 | Bacteria | 556 |
| 428 | Ga0373935_0905917 | 3300035692 | Bacteria | 653 |
| 429 | Ga0373927_0045030 | 3300035695 | Bacteria | 2855 |
| 430 | Ga0373927_0083991 | 3300035695 | Bacteria | 2065 |
| 431 | Ga0373927_0197535 | 3300035695 | Bacteria | 1320 |
| 432 | Ga0373933_0007759 | 3300035724 | Bacteria | 5861 |
| 433 | Ga0373947_0032915 | 3300035725 | Bacteria | 3057 |
| 434 | Ga0373947_0165948 | 3300035725 | Bacteria | 1430 |
| 435 | Ga0373937_0010563 | 3300036401 | Bacteria | 8065 |
| 436 | Ga0373937_0057872 | 3300036401 | Bacteria | 3561 |
| 437 | Ga0316582_0033406 | 3300036647 | Bacteria | 3160 |
| 438 | Ga0373925_0032587 | 3300037068 | Bacteria | 3836 |
| 439 | Ga0373925_0120934 | 3300037068 | Bacteria | 2032 |
| 440 | Ga0395900_0073098 | 3300037418 | Bacteria | 3525 |
| 441 | Ga0395898_0000627 | 3300037466 | Bacteria | 64588 |
| 442 | Ga0395901_0000080 | 3300038443 | Bacteria | 134397 |
| 443 | Ga0395901_0067955 | 3300038443 | Bacteria | 3712 |
| 444 | Ga0436363_0006987 | 3300039450 | Bacteria | 1764 |
| 445 | Ga0451853_2772157 | 3300041512 | Bacteria | 2152 |
| 446 | Ga0450921_012635 | 3300042123 | Bacteria | 734 |
| 447 | Ga0450896_010886 | 3300042133 | Bacteria | 1278 |
| 448 | Ga0439460_0190185 | 3300042461 | Bacteria | 696 |
| 449 | Ga0466972_0507489 | 3300044658 | Bacteria | 568 |
| 450 | Ga0466966_0351007 | 3300044684 | Bacteria | 886 |
| 451 | Ga0466963_0663508 | 3300044694 | Bacteria | 736 |
| 452 | Ga0466968_0089667 | 3300044735 | Bacteria | 1361 |
| 453 | Ga0466957_0005242 | 3300044842 | Bacteria | 7258 |
| 454 | Ga0466959_0055261 | 3300045049 | Bacteria | 2899 |
| 455 | Ga0466959_0064941 | 3300045049 | Bacteria | 2649 |
| 456 | Ga0451576_0467357 | 3300045051 | Unclassified | 1325 |
| 457 | Ga0495603_0273141 | 3300046455 | Bacteria | 972 |
| 458 | Ga0495629_0147703 | 3300046459 | Bacteria | 1634 |
| 459 | Ga0495580_0023641 | 3300046472 | Bacteria | 4509 |
| 460 | Ga0495580_0029903 | 3300046472 | Bacteria | 3950 |
| 461 | Ga0495639_0007331 | 3300046475 | Bacteria | 4733 |
| 462 | Ga0495639_0094437 | 3300046475 | Bacteria | 1406 |
| 463 | Ga0495664_0014812 | 3300046477 | Bacteria | 4427 |
| 464 | Ga0495585_0012249 | 3300046492 | Bacteria | 5052 |
| 465 | Ga0495594_0472022 | 3300046499 | Bacteria | 713 |
| 466 | Ga0495608_0419013 | 3300046511 | Bacteria | 817 |
| 467 | Ga0495628_0078698 | 3300046516 | Bacteria | 2564 |
| 468 | Ga0495628_0249140 | 3300046516 | Bacteria | 1327 |
| 469 | Ga0495630_0587736 | 3300046517 | Bacteria | 854 |
| 470 | Ga0495631_0027166 | 3300046518 | Bacteria | 2622 |
| 471 | Ga0495642_0222146 | 3300046528 | Bacteria | 825 |
| 472 | Ga0495665_0139274 | 3300046531 | Bacteria | 1268 |
| 473 | Ga0495665_0592503 | 3300046531 | Bacteria | 554 |
| 474 | Ga0495640_0050117 | 3300046533 | Bacteria | 2878 |
| 475 | Ga0495645_0077144 | 3300046543 | Bacteria | 2396 |
| 476 | Ga0495645_0083775 | 3300046543 | Bacteria | 2285 |
| 477 | Ga0495622_0432787 | 3300046557 | Bacteria | 565 |
| 478 | Ga0495633_0042588 | 3300046558 | Bacteria | 2155 |
| 479 | Ga0495633_0086004 | 3300046558 | Bacteria | 1462 |
| 480 | Ga0495611_0007774 | 3300046648 | Bacteria | 4553 |
| 481 | Ga0495635_0257938 | 3300046663 | Bacteria | 1174 |
| 482 | Ga0495661_0012073 | 3300046665 | Bacteria | 5843 |
| 483 | Ga0495588_0336533 | 3300046674 | Bacteria | 794 |
| 484 | Ga0495599_0142629 | 3300046678 | Bacteria | 1486 |
| 485 | Ga0495647_0017294 | 3300046681 | Bacteria | 2549 |
| 486 | Ga0495658_0079497 | 3300046683 | Bacteria | 1921 |
| 487 | Ga0495613_0006094 | 3300046689 | Bacteria | 9021 |
| 488 | Ga0495624_0202537 | 3300046690 | Bacteria | 1206 |
| 489 | Ga0495670_0125175 | 3300046691 | Bacteria | 1337 |
| 490 | Ga0495589_0035782 | 3300046794 | Bacteria | 2489 |
| 491 | Ga0495600_0348131 | 3300046809 | Bacteria | 928 |
| 492 | Ga0495581_0099133 | 3300047315 | Bacteria | 1692 |
| 493 | Ga0495581_0129733 | 3300047315 | Bacteria | 1469 |
| 494 | Ga0495636_0009952 | 3300047318 | Bacteria | 3746 |
| 495 | Ga0495680_0253822 | 3300047322 | Bacteria | 1246 |
| 496 | Ga0495683_0109399 | 3300047323 | Bacteria | 1321 |
| 497 | Ga0495684_0387404 | 3300047471 | Bacteria | 984 |
| 498 | Ga0495593_0081520 | 3300047673 | Bacteria | 1673 |
| 499 | Ga0496100_0208143 | 3300048903 | Bacteria | 1429 |
| 500 | Ga0496100_1265272 | 3300048903 | Bacteria | 582 |
| 501 | Ga0496101_0137554 | 3300048904 | Bacteria | 1860 |
| 502 | Ga0496102_0080347 | 3300048905 | Bacteria | 3004 |
| 503 | Ga0496103_0012225 | 3300048906 | Bacteria | 5097 |
| 504 | Ga0496104_0018401 | 3300048907 | Bacteria | 6373 |
| 505 | Ga0496104_0043570 | 3300048907 | Bacteria | 4214 |
| 506 | Ga0496105_0005107 | 3300048908 | Bacteria | 9951 |
| 507 | Ga0496105_0006648 | 3300048908 | Bacteria | 8901 |
| 508 | Ga0496107_0305350 | 3300048910 | Bacteria | 1184 |
| 509 | Ga0496108_0173318 | 3300048911 | Bacteria | 1867 |
| 510 | Ga0496108_0497094 | 3300048911 | Bacteria | 1065 |
| 511 | Ga0496109_0045777 | 3300048912 | Bacteria | 3972 |
| 512 | Ga0496112_0006656 | 3300048915 | Bacteria | 10171 |
| 513 | Ga0496112_0066865 | 3300048915 | Bacteria | 3547 |
| 514 | Ga0496114_0065107 | 3300048917 | Bacteria | 3053 |
| 515 | Ga0496114_0106752 | 3300048917 | Bacteria | 2396 |
| 516 | Ga0496115_0010978 | 3300048918 | Bacteria | 6782 |
| 517 | Ga0496115_0037278 | 3300048918 | Bacteria | 3852 |
| 518 | Ga0496116_0002912 | 3300048919 | Bacteria | 17468 |
| 519 | Ga0496117_0000523 | 3300048920 | Bacteria | 63335 |
| 520 | Ga0496118_0000180 | 3300048921 | Bacteria | 112199 |
| 521 | Ga0496118_0164441 | 3300048921 | Bacteria | 1366 |
| 522 | Ga0496119_0027289 | 3300048922 | Bacteria | 3929 |
| 523 | Ga0496120_0096244 | 3300048923 | Bacteria | 1573 |
| 524 | Ga0496121_0040697 | 3300048924 | Bacteria | 4072 |
| 525 | Ga0496121_0047627 | 3300048924 | Bacteria | 3655 |
| 526 | Ga0496121_0069171 | 3300048924 | Bacteria | 2851 |
| 527 | Ga0496124_0215296 | 3300048927 | Bacteria | 1450 |
| 528 | Ga0496125_0050425 | 3300048928 | Bacteria | 3446 |
| 529 | Ga0496125_0051802 | 3300048928 | Bacteria | 3382 |
| 530 | Ga0496126_0056538 | 3300048929 | Bacteria | 3546 |
| 531 | Ga0501031_0177048 | 3300049568 | Bacteria | 1393 |
| 532 | Ga0501032_0001175 | 3300049569 | Bacteria | 20997 |
| 533 | Ga0501032_1048769 | 3300049569 | Bacteria | 511 |
| 534 | Ga0501034_0001266 | 3300049571 | Bacteria | 34323 |
| 535 | Ga0501034_0001321 | 3300049571 | Bacteria | 33531 |
| 536 | Ga0501034_0190281 | 3300049571 | Bacteria | 2015 |
| 537 | Ga0501034_0529015 | 3300049571 | Bacteria | 1090 |
| 538 | Ga0501036_0016570 | 3300049572 | Bacteria | 6155 |
| 539 | Ga0501039_0014619 | 3300049575 | Bacteria | 6008 |
| 540 | Ga0501039_0877256 | 3300049575 | Bacteria | 699 |
| 541 | Ga0501046_0000610 | 3300049580 | Bacteria | 35093 |
| 542 | Ga0501046_0923634 | 3300049580 | Unclassified | 608 |
| 543 | Ga0501047_0057973 | 3300049581 | Bacteria | 3742 |
| 544 | Ga0501048_0102465 | 3300049582 | Bacteria | 2020 |
| 545 | Ga0501067_0459517 | 3300049583 | Bacteria | 711 |
| 546 | Ga0501068_0002048 | 3300049584 | Bacteria | 10758 |
| 547 | Ga0501070_0439229 | 3300049586 | Bacteria | 1053 |
| 548 | Ga0501071_0206392 | 3300049587 | Unclassified | 1477 |
| 549 | Ga0501072_0027722 | 3300049588 | Bacteria | 4418 |
| 550 | Ga0501073_0008419 | 3300049589 | Bacteria | 7650 |
| 551 | Ga0501079_0149772 | 3300049741 | Unclassified | 1819 |
| 552 | Ga0501080_0012220 | 3300049742 | Bacteria | 7869 |
| 553 | Ga0501080_0027328 | 3300049742 | Bacteria | 5305 |
| 554 | Ga0501080_0312088 | 3300049742 | Bacteria | 1425 |
| 555 | Ga0501044_0006722 | 3300049823 | Bacteria | 12679 |
| 556 | Ga0501044_0016555 | 3300049823 | Bacteria | 7913 |
| 557 | nmdc:mga03n38_282597_c1 | 3300050490 | Bacteria | 886 |
| 558 | nmdc:mga0k408_61009_c1 | 3300050493 | Bacteria | 2192 |
| 559 | nmdc:mga05p37_336634_c1 | 3300050507 | Bacteria | 1781 |
| 560 | nmdc:mga09592_712282_c1 | 3300050508 | Bacteria | 854 |
| 561 | nmdc:mga0qj67_223297_c1 | 3300050509 | Bacteria | 1529 |
| 562 | nmdc:mga0qj67_681524_c1 | 3300050509 | Bacteria | 819 |
| 563 | nmdc:mga06r32_484933_c1 | 3300050510 | Bacteria | 1214 |
| 564 | nmdc:mga0n895_106546_c1 | 3300050512 | Bacteria | 2816 |
| 565 | nmdc:mga0n895_482303_c1 | 3300050512 | Bacteria | 1250 |
| 566 | nmdc:mga0n895_560603_c1 | 3300050512 | Bacteria | 1148 |
| 567 | nmdc:mga0rr50_262041_c1 | 3300050513 | Bacteria | 1438 |
| 568 | nmdc:mga0rr50_29937_c1 | 3300050513 | Bacteria | 3847 |
| 569 | nmdc:mga0a205_32731_c1 | 3300050515 | Bacteria | 3913 |
| 570 | nmdc:mga0a205_515593_c1 | 3300050515 | Bacteria | 1052 |
| 571 | nmdc:mga0sz30_84551_c1 | 3300050516 | Bacteria | 1376 |
| 572 | Ga0495601_0534951 | 3300053077 | Bacteria | 755 |
| 573 | Ga0495595_0063988 | 3300053084 | Bacteria | 1728 |
| 574 | Ga0495619_0043002 | 3300053085 | Bacteria | 2960 |
| 575 | Ga0495619_0911856 | 3300053085 | Bacteria | 591 |
| 576 | Ga0500619_008010 | 3300053154 | Bacteria | 2540 |
| 577 | Ga0500645_012564 | 3300053730 | Bacteria | 2735 |
| 578 | Ga0501084_0078250 | 3300054114 | Bacteria | 2772 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014497 | Ga0182008_10135533 | Ga0182008_101355331 | 131 |
| 2 | 3300015262 | Ga0182007_10084654 | Ga0182007_100846542 | 131 |
| 3 | 3300046557 | Ga0495622_0432787 | Ga0495622_0432787_13_447 | 133 |
| 4 | 3300044658 | Ga0466972_0507489 | Ga0466972_0507489_109_543 | 134 |
| 5 | 3300044684 | Ga0466966_0351007 | Ga0466966_0351007_102_566 | 134 |
| 6 | 3300045049 | Ga0466959_0064941 | Ga0466959_0064941_741_1205 | 134 |
| 7 | 3300048906 | Ga0496103_0012225 | Ga0496103_0012225_149_634 | 134 |
| 8 | 3300048919 | Ga0496116_0002912 | Ga0496116_0002912_6296_6781 | 134 |
| 9 | 3300048920 | Ga0496117_0000523 | Ga0496117_0000523_57970_58455 | 134 |
| 10 | 3300048921 | Ga0496118_0000180 | Ga0496118_0000180_6334_6819 | 134 |
| 11 | 3300048922 | Ga0496119_0027289 | Ga0496119_0027289_1551_2036 | 134 |
| 12 | 3300048924 | Ga0496121_0040697 | Ga0496121_0040697_1628_2113 | 134 |
| 13 | 3300048928 | Ga0496125_0050425 | Ga0496125_0050425_695_1180 | 134 |
| 14 | 3300053730 | Ga0500645_012564 | Ga0500645_012564_1877_2311 | 134 |
| 15 | 3300003320 | rootH2_10095172 | rootH2_100951722 | 135 |
| 16 | 3300013297 | Ga0157378_10243347 | Ga0157378_102433472 | 135 |
| 17 | 3300028800 | Ga0265338_10446081 | Ga0265338_104460812 | 135 |
| 18 | 3300046517 | Ga0495630_0587736 | Ga0495630_0587736_36_470 | 135 |
| 19 | 3300049569 | Ga0501032_1048769 | Ga0501032_1048769_61_501 | 135 |
| 20 | 3300049581 | Ga0501047_0057973 | Ga0501047_0057973_2352_2792 | 135 |
| 21 | 3300049823 | Ga0501044_0016555 | Ga0501044_0016555_2862_3302 | 135 |
| 22 | 3300025909 | Ga0207705_10169213 | Ga0207705_101692131 | 136 |
| 23 | 3300006846 | Ga0075430_100167683 | Ga0075430_1001676833 | 138 |
| 24 | 3300009093 | Ga0105240_10123602 | Ga0105240_101236024 | 138 |
| 25 | 3300009551 | Ga0105238_10002918 | Ga0105238_1000291814 | 138 |
| 26 | 3300025914 | Ga0207671_10101661 | Ga0207671_101016613 | 138 |
| 27 | 3300025919 | Ga0207657_10162796 | Ga0207657_101627963 | 138 |
| 28 | 3300025924 | Ga0207694_10005499 | Ga0207694_100054992 | 138 |
| 29 | 3300025949 | Ga0207667_10138117 | Ga0207667_101381173 | 138 |
| 30 | 3300035089 | Ga0373944_0140179 | Ga0373944_0140179_14_454 | 138 |
| 31 | 3300042123 | Ga0450921_012635 | Ga0450921_012635_205_699 | 138 |
| 32 | 3300042133 | Ga0450896_010886 | Ga0450896_010886_551_1045 | 138 |
| 33 | 3300044735 | Ga0466968_0089667 | Ga0466968_0089667_569_1069 | 138 |
| 34 | 3300050509 | nmdc:mga0qj67_223297_c1 | nmdc:mga0qj67_223297_c1_492_953 | 138 |
| 35 | 3300050515 | nmdc:mga0a205_515593_c1 | nmdc:mga0a205_515593_c1_410_844 | 138 |
| 36 | 3300005338 | Ga0068868_100000522 | Ga0068868_1000005222 | 139 |
| 37 | 3300005340 | Ga0070689_101091633 | Ga0070689_1010916332 | 139 |
| 38 | 3300005343 | Ga0070687_100179499 | Ga0070687_1001794992 | 139 |
| 39 | 3300005438 | Ga0070701_10265870 | Ga0070701_102658702 | 139 |
| 40 | 3300005549 | Ga0070704_100095347 | Ga0070704_1000953472 | 139 |
| 41 | 3300005617 | Ga0068859_100133085 | Ga0068859_1001330855 | 139 |
| 42 | 3300005719 | Ga0068861_100412051 | Ga0068861_1004120513 | 139 |
| 43 | 3300005843 | Ga0068860_100763134 | Ga0068860_1007631342 | 139 |
| 44 | 3300006931 | Ga0097620_100133092 | Ga0097620_1001330922 | 139 |
| 45 | 3300007076 | Ga0075435_100157455 | Ga0075435_1001574552 | 139 |
| 46 | 3300009553 | Ga0105249_10288863 | Ga0105249_102888633 | 139 |
| 47 | 3300009553 | Ga0105249_11713625 | Ga0105249_117136251 | 139 |
| 48 | 3300013306 | Ga0163162_11740097 | Ga0163162_117400972 | 139 |
| 49 | 3300014968 | Ga0157379_11893576 | Ga0157379_118935761 | 139 |
| 50 | 3300025918 | Ga0207662_10133198 | Ga0207662_101331983 | 139 |
| 51 | 3300025924 | Ga0207694_10894699 | Ga0207694_108946992 | 139 |
| 52 | 3300025961 | Ga0207712_10215758 | Ga0207712_102157582 | 139 |
| 53 | 3300026023 | Ga0207677_10000091 | Ga0207677_100000912 | 139 |
| 54 | 3300026118 | Ga0207675_100247245 | Ga0207675_1002472453 | 139 |
| 55 | 3300028023 | Ga0265357_1032552 | Ga0265357_10325522 | 139 |
| 56 | 3300028380 | Ga0268265_10285799 | Ga0268265_102857992 | 139 |
| 57 | 3300030763 | Ga0265763_1013973 | Ga0265763_10139732 | 139 |
| 58 | 3300030763 | Ga0265763_1042787 | Ga0265763_10427871 | 139 |
| 59 | 3300035695 | Ga0373927_0197535 | Ga0373927_0197535_83_523 | 139 |
| 60 | 3300049571 | Ga0501034_0001321 | Ga0501034_0001321_12190_12633 | 139 |
| 61 | 3300049575 | Ga0501039_0877256 | Ga0501039_0877256_149_592 | 139 |
| 62 | 3300049584 | Ga0501068_0002048 | Ga0501068_0002048_8436_8879 | 139 |
| 63 | 3300049588 | Ga0501072_0027722 | Ga0501072_0027722_1391_1834 | 139 |
| 64 | 3300049589 | Ga0501073_0008419 | Ga0501073_0008419_1606_2049 | 139 |
| 65 | 3300049742 | Ga0501080_0012220 | Ga0501080_0012220_5359_5802 | 139 |
| 66 | 3300049742 | Ga0501080_0312088 | Ga0501080_0312088_931_1374 | 139 |
| 67 | 3300050490 | nmdc:mga03n38_282597_c1 | nmdc:mga03n38_282597_c1_158_631 | 139 |
| 68 | 3300053085 | Ga0495619_0911856 | Ga0495619_0911856_71_544 | 139 |
| 69 | 3300054114 | Ga0501084_0078250 | Ga0501084_0078250_632_1075 | 139 |
| 70 | 3300003316 | rootH1_10084223 | rootH1_100842233 | 140 |
| 71 | 3300003320 | rootH2_10095173 | rootH2_100951733 | 140 |
| 72 | 3300003323 | rootH1_10203424 | rootH1_102034242 | 140 |
| 73 | 3300005439 | Ga0070711_100462536 | Ga0070711_1004625361 | 140 |
| 74 | 3300005548 | Ga0070665_100182357 | Ga0070665_1001823572 | 140 |
| 75 | 3300005548 | Ga0070665_100556780 | Ga0070665_1005567802 | 140 |
| 76 | 3300005616 | Ga0068852_100102527 | Ga0068852_1001025274 | 140 |
| 77 | 3300005844 | Ga0068862_100030215 | Ga0068862_1000302153 | 140 |
| 78 | 3300007788 | Ga0099795_10428369 | Ga0099795_104283691 | 140 |
| 79 | 3300009093 | Ga0105240_10084608 | Ga0105240_100846084 | 140 |
| 80 | 3300009174 | Ga0105241_10058376 | Ga0105241_100583762 | 140 |
| 81 | 3300009545 | Ga0105237_10899212 | Ga0105237_108992122 | 140 |
| 82 | 3300009553 | Ga0105249_10029342 | Ga0105249_100293424 | 140 |
| 83 | 3300010375 | Ga0105239_10044769 | Ga0105239_100447699 | 140 |
| 84 | 3300013307 | Ga0157372_11321120 | Ga0157372_113211202 | 140 |
| 85 | 3300014968 | Ga0157379_10262494 | Ga0157379_102624942 | 140 |
| 86 | 3300025911 | Ga0207654_10148842 | Ga0207654_101488422 | 140 |
| 87 | 3300025913 | Ga0207695_10098682 | Ga0207695_100986823 | 140 |
| 88 | 3300025913 | Ga0207695_10115012 | Ga0207695_101150123 | 140 |
| 89 | 3300025914 | Ga0207671_11128419 | Ga0207671_111284191 | 140 |
| 90 | 3300025961 | Ga0207712_10031774 | Ga0207712_100317743 | 140 |
| 91 | 3300026142 | Ga0207698_10081836 | Ga0207698_100818364 | 140 |
| 92 | 3300028379 | Ga0268266_10010743 | Ga0268266_100107433 | 140 |
| 93 | 3300028380 | Ga0268265_10111979 | Ga0268265_101119793 | 140 |
| 94 | 3300031733 | Ga0316577_10310923 | Ga0316577_103109232 | 140 |
| 95 | 3300032005 | Ga0307411_10320865 | Ga0307411_103208652 | 140 |
| 96 | 3300035410 | Ga0373924_0484091 | Ga0373924_0484091_43_480 | 140 |
| 97 | 3300036647 | Ga0316582_0033406 | Ga0316582_0033406_1109_1585 | 140 |
| 98 | 3300046690 | Ga0495624_0202537 | Ga0495624_0202537_152_637 | 140 |
| 99 | 3300048903 | Ga0496100_1265272 | Ga0496100_1265272_65_550 | 140 |
| 100 | 3300048907 | Ga0496104_0018401 | Ga0496104_0018401_5523_6008 | 140 |
| 101 | 3300048908 | Ga0496105_0006648 | Ga0496105_0006648_2981_3466 | 140 |
| 102 | 3300048917 | Ga0496114_0065107 | Ga0496114_0065107_1258_1743 | 140 |
| 103 | 3300048918 | Ga0496115_0037278 | Ga0496115_0037278_1678_2163 | 140 |
| 104 | 3300048923 | Ga0496120_0096244 | Ga0496120_0096244_13_519 | 140 |
| 105 | 3300053154 | Ga0500619_008010 | Ga0500619_008010_284_730 | 140 |
| 106 | 3300005334 | Ga0068869_100283582 | Ga0068869_1002835822 | 141 |
| 107 | 3300005335 | Ga0070666_10001013 | Ga0070666_100010133 | 141 |
| 108 | 3300005338 | Ga0068868_100002574 | Ga0068868_10000257412 | 141 |
| 109 | 3300005340 | Ga0070689_100008295 | Ga0070689_1000082956 | 141 |
| 110 | 3300005364 | Ga0070673_100000835 | Ga0070673_10000083518 | 141 |
| 111 | 3300005365 | Ga0070688_100010345 | Ga0070688_1000103452 | 141 |
| 112 | 3300005367 | Ga0070667_100058065 | Ga0070667_1000580653 | 141 |
| 113 | 3300005434 | Ga0070709_10038705 | Ga0070709_100387051 | 141 |
| 114 | 3300005439 | Ga0070711_100001177 | Ga0070711_10000117713 | 141 |
| 115 | 3300005440 | Ga0070705_100680545 | Ga0070705_1006805452 | 141 |
| 116 | 3300005456 | Ga0070678_100467500 | Ga0070678_1004675003 | 141 |
| 117 | 3300005457 | Ga0070662_100046499 | Ga0070662_1000464992 | 141 |
| 118 | 3300005459 | Ga0068867_101200904 | Ga0068867_1012009042 | 141 |
| 119 | 3300005466 | Ga0070685_10004441 | Ga0070685_100044413 | 141 |
| 120 | 3300005544 | Ga0070686_100043225 | Ga0070686_1000432253 | 141 |
| 121 | 3300005548 | Ga0070665_100077716 | Ga0070665_1000777164 | 141 |
| 122 | 3300005563 | Ga0068855_100233950 | Ga0068855_1002339503 | 141 |
| 123 | 3300005614 | Ga0068856_100225332 | Ga0068856_1002253323 | 141 |
| 124 | 3300005615 | Ga0070702_100035303 | Ga0070702_1000353032 | 141 |
| 125 | 3300005616 | Ga0068852_100338123 | Ga0068852_1003381232 | 141 |
| 126 | 3300005617 | Ga0068859_100011219 | Ga0068859_1000112193 | 141 |
| 127 | 3300005618 | Ga0068864_100001938 | Ga0068864_10000193817 | 141 |
| 128 | 3300005840 | Ga0068870_10038565 | Ga0068870_100385652 | 141 |
| 129 | 3300005842 | Ga0068858_100004196 | Ga0068858_10000419610 | 141 |
| 130 | 3300005843 | Ga0068860_100018163 | Ga0068860_1000181637 | 141 |
| 131 | 3300006237 | Ga0097621_100041452 | Ga0097621_1000414523 | 141 |
| 132 | 3300006871 | Ga0075434_100064745 | Ga0075434_1000647453 | 141 |
| 133 | 3300006931 | Ga0097620_100011219 | Ga0097620_1000112193 | 141 |
| 134 | 3300007265 | Ga0099794_10140982 | Ga0099794_101409823 | 141 |
| 135 | 3300009098 | Ga0105245_10002420 | Ga0105245_100024204 | 141 |
| 136 | 3300009101 | Ga0105247_10009670 | Ga0105247_100096703 | 141 |
| 137 | 3300009174 | Ga0105241_10031856 | Ga0105241_100318563 | 141 |
| 138 | 3300009174 | Ga0105241_10425112 | Ga0105241_104251122 | 141 |
| 139 | 3300009176 | Ga0105242_10050753 | Ga0105242_100507533 | 141 |
| 140 | 3300013104 | Ga0157370_10115549 | Ga0157370_101155495 | 141 |
| 141 | 3300013306 | Ga0163162_10773297 | Ga0163162_107732972 | 141 |
| 142 | 3300014325 | Ga0163163_10002518 | Ga0163163_1000251816 | 141 |
| 143 | 3300014745 | Ga0157377_10220389 | Ga0157377_102203892 | 141 |
| 144 | 3300014969 | Ga0157376_10005553 | Ga0157376_100055533 | 141 |
| 145 | 3300025906 | Ga0207699_10008937 | Ga0207699_100089371 | 141 |
| 146 | 3300025908 | Ga0207643_10017345 | Ga0207643_100173452 | 141 |
| 147 | 3300025915 | Ga0207693_10000883 | Ga0207693_100008835 | 141 |
| 148 | 3300025916 | Ga0207663_10005484 | Ga0207663_100054846 | 141 |
| 149 | 3300025925 | Ga0207650_10108882 | Ga0207650_101088822 | 141 |
| 150 | 3300025927 | Ga0207687_10001328 | Ga0207687_1000132813 | 141 |
| 151 | 3300025934 | Ga0207686_10037206 | Ga0207686_100372063 | 141 |
| 152 | 3300025942 | Ga0207689_10030956 | Ga0207689_100309563 | 141 |
| 153 | 3300025960 | Ga0207651_10955755 | Ga0207651_109557551 | 141 |
| 154 | 3300026023 | Ga0207677_10000157 | Ga0207677_1000015713 | 141 |
| 155 | 3300026088 | Ga0207641_10002007 | Ga0207641_1000200713 | 141 |
| 156 | 3300026095 | Ga0207676_10000219 | Ga0207676_1000021940 | 141 |
| 157 | 3300026121 | Ga0207683_10558413 | Ga0207683_105584133 | 141 |
| 158 | 3300028381 | Ga0268264_10211346 | Ga0268264_102113462 | 141 |
| 159 | 3300035119 | Ga0373956_0054394 | Ga0373956_0054394_17_484 | 141 |
| 160 | 3300035120 | Ga0373957_0002782 | Ga0373957_0002782_1150_1617 | 141 |
| 161 | 3300035172 | Ga0373955_0002969 | Ga0373955_0002969_2453_2920 | 141 |
| 162 | 3300035724 | Ga0373933_0007759 | Ga0373933_0007759_338_805 | 141 |
| 163 | 3300044842 | Ga0466957_0005242 | Ga0466957_0005242_5797_6291 | 141 |
| 164 | 3300046528 | Ga0495642_0222146 | Ga0495642_0222146_80_607 | 141 |
| 165 | 3300046543 | Ga0495645_0083775 | Ga0495645_0083775_1183_1650 | 141 |
| 166 | 3300047471 | Ga0495684_0387404 | Ga0495684_0387404_288_755 | 141 |
| 167 | 3300048907 | Ga0496104_0043570 | Ga0496104_0043570_2772_3239 | 141 |
| 168 | 3300048908 | Ga0496105_0005107 | Ga0496105_0005107_8232_8699 | 141 |
| 169 | 3300048911 | Ga0496108_0497094 | Ga0496108_0497094_562_1029 | 141 |
| 170 | 3300048912 | Ga0496109_0045777 | Ga0496109_0045777_2316_2783 | 141 |
| 171 | 3300050493 | nmdc:mga0k408_61009_c1 | nmdc:mga0k408_61009_c1_323_814 | 141 |
| 172 | 3300050512 | nmdc:mga0n895_106546_c1 | nmdc:mga0n895_106546_c1_2133_2600 | 141 |
| 173 | 3300050516 | nmdc:mga0sz30_84551_c1 | nmdc:mga0sz30_84551_c1_309_800 | 141 |
| 174 | 3300005518 | Ga0070699_100261773 | Ga0070699_1002617732 | 142 |
| 175 | 3300005548 | Ga0070665_100011365 | Ga0070665_1000113654 | 142 |
| 176 | 3300005617 | Ga0068859_100484645 | Ga0068859_1004846453 | 142 |
| 177 | 3300005841 | Ga0068863_100094267 | Ga0068863_1000942673 | 142 |
| 178 | 3300006048 | Ga0075363_100136311 | Ga0075363_1001363113 | 142 |
| 179 | 3300006931 | Ga0097620_100484681 | Ga0097620_1004846813 | 142 |
| 180 | 3300009545 | Ga0105237_10847970 | Ga0105237_108479702 | 142 |
| 181 | 3300026088 | Ga0207641_10067393 | Ga0207641_100673935 | 142 |
| 182 | 3300028379 | Ga0268266_10009726 | Ga0268266_100097269 | 142 |
| 183 | 3300041512 | Ga0451853_2772157 | Ga0451853_2772157_814_1284 | 142 |
| 184 | 3300006038 | Ga0075365_10091594 | Ga0075365_100915942 | 143 |
| 185 | 3300010375 | Ga0105239_10154747 | Ga0105239_101547472 | 143 |
| 186 | 3300014968 | Ga0157379_10011237 | Ga0157379_100112374 | 143 |
| 187 | 3300025912 | Ga0207707_10569318 | Ga0207707_105693182 | 143 |
| 188 | 3300025920 | Ga0207649_10063142 | Ga0207649_100631423 | 143 |
| 189 | 3300025932 | Ga0207690_10046682 | Ga0207690_100466823 | 143 |
| 190 | 3300025942 | Ga0207689_10651575 | Ga0207689_106515751 | 143 |
| 191 | 3300025945 | Ga0207679_10064697 | Ga0207679_100646973 | 143 |
| 192 | 3300025961 | Ga0207712_10417598 | Ga0207712_104175982 | 143 |
| 193 | 3300026041 | Ga0207639_10300280 | Ga0207639_103002802 | 143 |
| 194 | 3300026116 | Ga0207674_10010018 | Ga0207674_100100184 | 143 |
| 195 | 3300031548 | Ga0307408_100507594 | Ga0307408_1005075942 | 143 |
| 196 | 3300048921 | Ga0496118_0164441 | Ga0496118_0164441_806_1297 | 143 |
| 197 | 3300048924 | Ga0496121_0069171 | Ga0496121_0069171_2150_2641 | 143 |
| 198 | 3300048929 | Ga0496126_0056538 | Ga0496126_0056538_1231_1722 | 143 |
| 199 | 3300049568 | Ga0501031_0177048 | Ga0501031_0177048_371_841 | 143 |
| 200 | 3300049569 | Ga0501032_0001175 | Ga0501032_0001175_20243_20713 | 143 |
| 201 | 3300049571 | Ga0501034_0001266 | Ga0501034_0001266_33232_33702 | 143 |
| 202 | 3300049582 | Ga0501048_0102465 | Ga0501048_0102465_812_1348 | 143 |
| 203 | 3300049742 | Ga0501080_0027328 | Ga0501080_0027328_769_1239 | 143 |
| 204 | 3300005293 | Ga0065715_10158843 | Ga0065715_101588432 | 144 |
| 205 | 3300005445 | Ga0070708_100376308 | Ga0070708_1003763082 | 144 |
| 206 | 3300005471 | Ga0070698_100193172 | Ga0070698_1001931723 | 144 |
| 207 | 3300005518 | Ga0070699_100713911 | Ga0070699_1007139111 | 144 |
| 208 | 3300005536 | Ga0070697_100785246 | Ga0070697_1007852461 | 144 |
| 209 | 3300005549 | Ga0070704_101189553 | Ga0070704_1011895531 | 144 |
| 210 | 3300005618 | Ga0068864_100019247 | Ga0068864_1000192473 | 144 |
| 211 | 3300005843 | Ga0068860_100065128 | Ga0068860_1000651286 | 144 |
| 212 | 3300006946 | Ga0079104_1015595 | Ga0079104_10155954 | 144 |
| 213 | 3300011119 | Ga0105246_10041725 | Ga0105246_100417252 | 144 |
| 214 | 3300014325 | Ga0163163_10004501 | Ga0163163_1000450114 | 144 |
| 215 | 3300024225 | Ga0224572_1004446 | Ga0224572_10044462 | 144 |
| 216 | 3300026095 | Ga0207676_10005360 | Ga0207676_100053608 | 144 |
| 217 | 3300027111 | Ga0209281_1011400 | Ga0209281_10114002 | 144 |
| 218 | 3300028381 | Ga0268264_10277517 | Ga0268264_102775173 | 144 |
| 219 | 3300030763 | Ga0265763_1024672 | Ga0265763_10246722 | 144 |
| 220 | 3300031616 | Ga0307508_10597119 | Ga0307508_105971191 | 144 |
| 221 | 3300035692 | Ga0373935_0905917 | Ga0373935_0905917_36_614 | 144 |
| 222 | 3300035725 | Ga0373947_0165948 | Ga0373947_0165948_551_1036 | 144 |
| 223 | 3300046475 | Ga0495639_0094437 | Ga0495639_0094437_256_741 | 144 |
| 224 | 3300046499 | Ga0495594_0472022 | Ga0495594_0472022_200_685 | 144 |
| 225 | 3300046531 | Ga0495665_0592503 | Ga0495665_0592503_57_542 | 144 |
| 226 | 3300046674 | Ga0495588_0336533 | Ga0495588_0336533_57_542 | 144 |
| 227 | 3300047315 | Ga0495581_0129733 | Ga0495581_0129733_784_1269 | 144 |
| 228 | 3300005334 | Ga0068869_100093400 | Ga0068869_1000934002 | 145 |
| 229 | 3300005335 | Ga0070666_10107936 | Ga0070666_101079362 | 145 |
| 230 | 3300005355 | Ga0070671_100025744 | Ga0070671_1000257442 | 145 |
| 231 | 3300005355 | Ga0070671_100084164 | Ga0070671_1000841643 | 145 |
| 232 | 3300005367 | Ga0070667_100076875 | Ga0070667_1000768752 | 145 |
| 233 | 3300005367 | Ga0070667_100558571 | Ga0070667_1005585712 | 145 |
| 234 | 3300005436 | Ga0070713_100000712 | Ga0070713_10000071217 | 145 |
| 235 | 3300005437 | Ga0070710_10001809 | Ga0070710_100018094 | 145 |
| 236 | 3300005456 | Ga0070678_100008526 | Ga0070678_1000085265 | 145 |
| 237 | 3300005459 | Ga0068867_100293782 | Ga0068867_1002937822 | 145 |
| 238 | 3300005539 | Ga0068853_100564481 | Ga0068853_1005644812 | 145 |
| 239 | 3300005547 | Ga0070693_100220847 | Ga0070693_1002208472 | 145 |
| 240 | 3300005578 | Ga0068854_100008340 | Ga0068854_1000083406 | 145 |
| 241 | 3300005615 | Ga0070702_100071359 | Ga0070702_1000713592 | 145 |
| 242 | 3300005718 | Ga0068866_10022200 | Ga0068866_100222002 | 145 |
| 243 | 3300005719 | Ga0068861_100797061 | Ga0068861_1007970612 | 145 |
| 244 | 3300005834 | Ga0068851_10001783 | Ga0068851_100017833 | 145 |
| 245 | 3300005843 | Ga0068860_100058699 | Ga0068860_1000586993 | 145 |
| 246 | 3300005983 | Ga0081540_1000303 | Ga0081540_100030315 | 145 |
| 247 | 3300006163 | Ga0070715_10023161 | Ga0070715_100231613 | 145 |
| 248 | 3300006173 | Ga0070716_100032681 | Ga0070716_1000326812 | 145 |
| 249 | 3300006175 | Ga0070712_100001213 | Ga0070712_1000012135 | 145 |
| 250 | 3300006358 | Ga0068871_100062560 | Ga0068871_1000625603 | 145 |
| 251 | 3300009098 | Ga0105245_10803596 | Ga0105245_108035962 | 145 |
| 252 | 3300009148 | Ga0105243_10299809 | Ga0105243_102998092 | 145 |
| 253 | 3300009176 | Ga0105242_10016942 | Ga0105242_100169423 | 145 |
| 254 | 3300009177 | Ga0105248_10130118 | Ga0105248_101301182 | 145 |
| 255 | 3300009545 | Ga0105237_10420212 | Ga0105237_104202122 | 145 |
| 256 | 3300009553 | Ga0105249_10373082 | Ga0105249_103730823 | 145 |
| 257 | 3300013296 | Ga0157374_10000534 | Ga0157374_100005342 | 145 |
| 258 | 3300013297 | Ga0157378_10025221 | Ga0157378_100252214 | 145 |
| 259 | 3300013297 | Ga0157378_10072609 | Ga0157378_100726093 | 145 |
| 260 | 3300013306 | Ga0163162_10004145 | Ga0163162_100041453 | 145 |
| 261 | 3300013306 | Ga0163162_10051375 | Ga0163162_100513753 | 145 |
| 262 | 3300014968 | Ga0157379_10096339 | Ga0157379_100963391 | 145 |
| 263 | 3300014969 | Ga0157376_10088352 | Ga0157376_100883522 | 145 |
| 264 | 3300025321 | Ga0207656_10022841 | Ga0207656_100228412 | 145 |
| 265 | 3300025903 | Ga0207680_10011165 | Ga0207680_100111655 | 145 |
| 266 | 3300025903 | Ga0207680_10087841 | Ga0207680_100878413 | 145 |
| 267 | 3300025905 | Ga0207685_10012812 | Ga0207685_100128122 | 145 |
| 268 | 3300025907 | Ga0207645_10096399 | Ga0207645_100963991 | 145 |
| 269 | 3300025911 | Ga0207654_10260372 | Ga0207654_102603722 | 145 |
| 270 | 3300025914 | Ga0207671_10062347 | Ga0207671_100623473 | 145 |
| 271 | 3300025923 | Ga0207681_10585673 | Ga0207681_105856732 | 145 |
| 272 | 3300025927 | Ga0207687_10003454 | Ga0207687_100034548 | 145 |
| 273 | 3300025928 | Ga0207700_10004910 | Ga0207700_100049108 | 145 |
| 274 | 3300025931 | Ga0207644_10005524 | Ga0207644_100055248 | 145 |
| 275 | 3300025931 | Ga0207644_10411694 | Ga0207644_104116942 | 145 |
| 276 | 3300025933 | Ga0207706_10001164 | Ga0207706_1000116421 | 145 |
| 277 | 3300025933 | Ga0207706_10127467 | Ga0207706_101274672 | 145 |
| 278 | 3300025934 | Ga0207686_10000574 | Ga0207686_1000057417 | 145 |
| 279 | 3300025934 | Ga0207686_10349815 | Ga0207686_103498151 | 145 |
| 280 | 3300025937 | Ga0207669_10312018 | Ga0207669_103120182 | 145 |
| 281 | 3300025938 | Ga0207704_10025578 | Ga0207704_100255783 | 145 |
| 282 | 3300025939 | Ga0207665_10054567 | Ga0207665_100545673 | 145 |
| 283 | 3300025939 | Ga0207665_10171636 | Ga0207665_101716363 | 145 |
| 284 | 3300025942 | Ga0207689_10110500 | Ga0207689_101105002 | 145 |
| 285 | 3300025949 | Ga0207667_10390490 | Ga0207667_103904902 | 145 |
| 286 | 3300025960 | Ga0207651_12072487 | Ga0207651_120724871 | 145 |
| 287 | 3300025961 | Ga0207712_10000488 | Ga0207712_1000048821 | 145 |
| 288 | 3300025986 | Ga0207658_10030475 | Ga0207658_100304754 | 145 |
| 289 | 3300025986 | Ga0207658_10054185 | Ga0207658_100541853 | 145 |
| 290 | 3300026023 | Ga0207677_10102598 | Ga0207677_101025982 | 145 |
| 291 | 3300026067 | Ga0207678_10033556 | Ga0207678_100335563 | 145 |
| 292 | 3300026088 | Ga0207641_11385522 | Ga0207641_113855222 | 145 |
| 293 | 3300026089 | Ga0207648_10054827 | Ga0207648_100548273 | 145 |
| 294 | 3300026118 | Ga0207675_100953618 | Ga0207675_1009536181 | 145 |
| 295 | 3300026121 | Ga0207683_10001745 | Ga0207683_100017453 | 145 |
| 296 | 3300028381 | Ga0268264_10038421 | Ga0268264_100384213 | 145 |
| 297 | 3300030760 | Ga0265762_1018597 | Ga0265762_10185972 | 145 |
| 298 | 3300031730 | Ga0307516_10001812 | Ga0307516_1000181211 | 145 |
| 299 | 3300033527 | Ga0316586_1031693 | Ga0316586_10316932 | 145 |
| 300 | 3300035083 | Ga0373926_0054562 | Ga0373926_0054562_554_1015 | 145 |
| 301 | 3300035086 | Ga0373934_0003710 | Ga0373934_0003710_940_1401 | 145 |
| 302 | 3300035089 | Ga0373944_0083162 | Ga0373944_0083162_341_802 | 145 |
| 303 | 3300035111 | Ga0373923_0018613 | Ga0373923_0018613_1026_1487 | 145 |
| 304 | 3300035113 | Ga0373936_0043113 | Ga0373936_0043113_913_1374 | 145 |
| 305 | 3300035116 | Ga0373945_0081224 | Ga0373945_0081224_334_795 | 145 |
| 306 | 3300035116 | Ga0373945_0097167 | Ga0373945_0097167_181_642 | 145 |
| 307 | 3300035118 | Ga0373954_0005421 | Ga0373954_0005421_834_1295 | 145 |
| 308 | 3300035170 | Ga0373943_0023094 | Ga0373943_0023094_554_1015 | 145 |
| 309 | 3300035170 | Ga0373943_0101023 | Ga0373943_0101023_908_1369 | 145 |
| 310 | 3300035172 | Ga0373955_0197379 | Ga0373955_0197379_498_959 | 145 |
| 311 | 3300035695 | Ga0373927_0045030 | Ga0373927_0045030_916_1377 | 145 |
| 312 | 3300035695 | Ga0373927_0083991 | Ga0373927_0083991_94_555 | 145 |
| 313 | 3300035725 | Ga0373947_0032915 | Ga0373947_0032915_1222_1683 | 145 |
| 314 | 3300036401 | Ga0373937_0010563 | Ga0373937_0010563_3224_3685 | 145 |
| 315 | 3300036401 | Ga0373937_0057872 | Ga0373937_0057872_1590_2051 | 145 |
| 316 | 3300037068 | Ga0373925_0032587 | Ga0373925_0032587_183_644 | 145 |
| 317 | 3300037068 | Ga0373925_0120934 | Ga0373925_0120934_249_710 | 145 |
| 318 | 3300046455 | Ga0495603_0273141 | Ga0495603_0273141_193_654 | 145 |
| 319 | 3300046459 | Ga0495629_0147703 | Ga0495629_0147703_530_991 | 145 |
| 320 | 3300046472 | Ga0495580_0023641 | Ga0495580_0023641_2688_3149 | 145 |
| 321 | 3300046472 | Ga0495580_0029903 | Ga0495580_0029903_1514_1975 | 145 |
| 322 | 3300046475 | Ga0495639_0007331 | Ga0495639_0007331_3177_3638 | 145 |
| 323 | 3300046477 | Ga0495664_0014812 | Ga0495664_0014812_2561_3022 | 145 |
| 324 | 3300046516 | Ga0495628_0078698 | Ga0495628_0078698_691_1152 | 145 |
| 325 | 3300046516 | Ga0495628_0249140 | Ga0495628_0249140_434_895 | 145 |
| 326 | 3300046531 | Ga0495665_0139274 | Ga0495665_0139274_530_991 | 145 |
| 327 | 3300046533 | Ga0495640_0050117 | Ga0495640_0050117_2088_2549 | 145 |
| 328 | 3300046543 | Ga0495645_0077144 | Ga0495645_0077144_1171_1632 | 145 |
| 329 | 3300046663 | Ga0495635_0257938 | Ga0495635_0257938_55_516 | 145 |
| 330 | 3300046678 | Ga0495599_0142629 | Ga0495599_0142629_858_1319 | 145 |
| 331 | 3300046681 | Ga0495647_0017294 | Ga0495647_0017294_531_992 | 145 |
| 332 | 3300046683 | Ga0495658_0079497 | Ga0495658_0079497_180_641 | 145 |
| 333 | 3300046689 | Ga0495613_0006094 | Ga0495613_0006094_7833_8294 | 145 |
| 334 | 3300046809 | Ga0495600_0348131 | Ga0495600_0348131_114_575 | 145 |
| 335 | 3300047315 | Ga0495581_0099133 | Ga0495581_0099133_706_1167 | 145 |
| 336 | 3300047322 | Ga0495680_0253822 | Ga0495680_0253822_730_1191 | 145 |
| 337 | 3300047673 | Ga0495593_0081520 | Ga0495593_0081520_1053_1514 | 145 |
| 338 | 3300048903 | Ga0496100_0208143 | Ga0496100_0208143_947_1408 | 145 |
| 339 | 3300048904 | Ga0496101_0137554 | Ga0496101_0137554_1150_1611 | 145 |
| 340 | 3300048915 | Ga0496112_0006656 | Ga0496112_0006656_6890_7351 | 145 |
| 341 | 3300048917 | Ga0496114_0106752 | Ga0496114_0106752_1133_1594 | 145 |
| 342 | 3300048918 | Ga0496115_0010978 | Ga0496115_0010978_5333_5794 | 145 |
| 343 | 3300049571 | Ga0501034_0190281 | Ga0501034_0190281_1490_1963 | 145 |
| 344 | 3300050513 | nmdc:mga0rr50_262041_c1 | nmdc:mga0rr50_262041_c1_769_1230 | 145 |
| 345 | 3300053077 | Ga0495601_0534951 | Ga0495601_0534951_119_580 | 145 |
| 346 | 3300053084 | Ga0495595_0063988 | Ga0495595_0063988_978_1439 | 145 |
| 347 | 3300053085 | Ga0495619_0043002 | Ga0495619_0043002_1566_2027 | 145 |
| 348 | 3300005439 | Ga0070711_100097721 | Ga0070711_1000977213 | 146 |
| 349 | 3300005548 | Ga0070665_100093922 | Ga0070665_1000939223 | 146 |
| 350 | 3300005843 | Ga0068860_100750432 | Ga0068860_1007504322 | 146 |
| 351 | 3300005843 | Ga0068860_100981775 | Ga0068860_1009817752 | 146 |
| 352 | 3300006028 | Ga0070717_11088910 | Ga0070717_110889102 | 146 |
| 353 | 3300009177 | Ga0105248_10015968 | Ga0105248_100159685 | 146 |
| 354 | 3300013306 | Ga0163162_10119052 | Ga0163162_101190523 | 146 |
| 355 | 3300025929 | Ga0207664_11021443 | Ga0207664_110214432 | 146 |
| 356 | 3300026118 | Ga0207675_100937850 | Ga0207675_1009378502 | 146 |
| 357 | 3300049572 | Ga0501036_0016570 | Ga0501036_0016570_144_614 | 146 |
| 358 | 3300049575 | Ga0501039_0014619 | Ga0501039_0014619_453_923 | 146 |
| 359 | 3300049580 | Ga0501046_0000610 | Ga0501046_0000610_1602_2072 | 146 |
| 360 | 3300049583 | Ga0501067_0459517 | Ga0501067_0459517_29_499 | 146 |
| 361 | 3300049823 | Ga0501044_0006722 | Ga0501044_0006722_2200_2670 | 146 |
| 362 | iso_pu_bacteria | 2816332256 | 2817276071 | 146 |
| 363 | 3300005335 | Ga0070666_10188234 | Ga0070666_101882342 | 147 |
| 364 | 3300005364 | Ga0070673_100136022 | Ga0070673_1001360223 | 147 |
| 365 | 3300005445 | Ga0070708_100024240 | Ga0070708_1000242405 | 147 |
| 366 | 3300005518 | Ga0070699_100026303 | Ga0070699_1000263032 | 147 |
| 367 | 3300005548 | Ga0070665_100063118 | Ga0070665_1000631182 | 147 |
| 368 | 3300005563 | Ga0068855_100726896 | Ga0068855_1007268962 | 147 |
| 369 | 3300005578 | Ga0068854_100802741 | Ga0068854_1008027411 | 147 |
| 370 | 3300009093 | Ga0105240_10026698 | Ga0105240_100266982 | 147 |
| 371 | 3300010375 | Ga0105239_10992634 | Ga0105239_109926342 | 147 |
| 372 | 3300011119 | Ga0105246_10203873 | Ga0105246_102038732 | 147 |
| 373 | 3300013308 | Ga0157375_11744863 | Ga0157375_117448631 | 147 |
| 374 | 3300014497 | Ga0182008_10309190 | Ga0182008_103091901 | 147 |
| 375 | 3300025903 | Ga0207680_10182609 | Ga0207680_101826092 | 147 |
| 376 | 3300025913 | Ga0207695_10017237 | Ga0207695_100172374 | 147 |
| 377 | 3300025944 | Ga0207661_10477502 | Ga0207661_104775023 | 147 |
| 378 | 3300025949 | Ga0207667_10019902 | Ga0207667_100199022 | 147 |
| 379 | 3300025960 | Ga0207651_10413907 | Ga0207651_104139071 | 147 |
| 380 | 3300026078 | Ga0207702_11642370 | Ga0207702_116423702 | 147 |
| 381 | 3300028379 | Ga0268266_10092956 | Ga0268266_100929564 | 147 |
| 382 | 3300046511 | Ga0495608_0419013 | Ga0495608_0419013_73_528 | 147 |
| 383 | 3300005289 | Ga0065704_10411670 | Ga0065704_104116701 | 148 |
| 384 | 3300005290 | Ga0065712_10220827 | Ga0065712_102208271 | 148 |
| 385 | 3300005290 | Ga0065712_10293611 | Ga0065712_102936111 | 148 |
| 386 | 3300005327 | Ga0070658_10807118 | Ga0070658_108071181 | 148 |
| 387 | 3300005329 | Ga0070683_100233978 | Ga0070683_1002339782 | 148 |
| 388 | 3300005331 | Ga0070670_100134703 | Ga0070670_1001347032 | 148 |
| 389 | 3300005333 | Ga0070677_10102948 | Ga0070677_101029482 | 148 |
| 390 | 3300005334 | Ga0068869_100578384 | Ga0068869_1005783842 | 148 |
| 391 | 3300005336 | Ga0070680_100631990 | Ga0070680_1006319902 | 148 |
| 392 | 3300005337 | Ga0070682_100463639 | Ga0070682_1004636392 | 148 |
| 393 | 3300005338 | Ga0068868_100811065 | Ga0068868_1008110651 | 148 |
| 394 | 3300005339 | Ga0070660_100869319 | Ga0070660_1008693191 | 148 |
| 395 | 3300005340 | Ga0070689_100291326 | Ga0070689_1002913261 | 148 |
| 396 | 3300005341 | Ga0070691_10168404 | Ga0070691_101684041 | 148 |
| 397 | 3300005343 | Ga0070687_100620978 | Ga0070687_1006209782 | 148 |
| 398 | 3300005354 | Ga0070675_100741985 | Ga0070675_1007419852 | 148 |
| 399 | 3300005356 | Ga0070674_100289991 | Ga0070674_1002899912 | 148 |
| 400 | 3300005366 | Ga0070659_100321058 | Ga0070659_1003210581 | 148 |
| 401 | 3300005367 | Ga0070667_100436987 | Ga0070667_1004369872 | 148 |
| 402 | 3300005434 | Ga0070709_10498805 | Ga0070709_104988052 | 148 |
| 403 | 3300005441 | Ga0070700_100200174 | Ga0070700_1002001741 | 148 |
| 404 | 3300005444 | Ga0070694_100638346 | Ga0070694_1006383462 | 148 |
| 405 | 3300005455 | Ga0070663_100439519 | Ga0070663_1004395192 | 148 |
| 406 | 3300005456 | Ga0070678_100117482 | Ga0070678_1001174822 | 148 |
| 407 | 3300005457 | Ga0070662_100549598 | Ga0070662_1005495982 | 148 |
| 408 | 3300005459 | Ga0068867_100075762 | Ga0068867_1000757622 | 148 |
| 409 | 3300005543 | Ga0070672_100330204 | Ga0070672_1003302042 | 148 |
| 410 | 3300005544 | Ga0070686_100381848 | Ga0070686_1003818482 | 148 |
| 411 | 3300005546 | Ga0070696_100377482 | Ga0070696_1003774822 | 148 |
| 412 | 3300005563 | Ga0068855_101253547 | Ga0068855_1012535471 | 148 |
| 413 | 3300005564 | Ga0070664_100669118 | Ga0070664_1006691182 | 148 |
| 414 | 3300005577 | Ga0068857_100422641 | Ga0068857_1004226412 | 148 |
| 415 | 3300005615 | Ga0070702_100610438 | Ga0070702_1006104382 | 148 |
| 416 | 3300005618 | Ga0068864_100932774 | Ga0068864_1009327742 | 148 |
| 417 | 3300005618 | Ga0068864_101076678 | Ga0068864_1010766782 | 148 |
| 418 | 3300005618 | Ga0068864_101463325 | Ga0068864_1014633251 | 148 |
| 419 | 3300005718 | Ga0068866_10193501 | Ga0068866_101935012 | 148 |
| 420 | 3300005719 | Ga0068861_101191516 | Ga0068861_1011915161 | 148 |
| 421 | 3300005842 | Ga0068858_100074710 | Ga0068858_1000747105 | 148 |
| 422 | 3300006058 | Ga0075432_10011774 | Ga0075432_100117744 | 148 |
| 423 | 3300006237 | Ga0097621_100018496 | Ga0097621_1000184968 | 148 |
| 424 | 3300006358 | Ga0068871_100030240 | Ga0068871_1000302404 | 148 |
| 425 | 3300006846 | Ga0075430_100259480 | Ga0075430_1002594802 | 148 |
| 426 | 3300006847 | Ga0075431_100562855 | Ga0075431_1005628551 | 148 |
| 427 | 3300006852 | Ga0075433_10206708 | Ga0075433_102067082 | 148 |
| 428 | 3300006880 | Ga0075429_100176960 | Ga0075429_1001769601 | 148 |
| 429 | 3300006881 | Ga0068865_100047077 | Ga0068865_1000470774 | 148 |
| 430 | 3300006881 | Ga0068865_100167173 | Ga0068865_1001671733 | 148 |
| 431 | 3300006914 | Ga0075436_100259250 | Ga0075436_1002592503 | 148 |
| 432 | 3300007076 | Ga0075435_100042739 | Ga0075435_1000427393 | 148 |
| 433 | 3300009093 | Ga0105240_11474083 | Ga0105240_114740831 | 148 |
| 434 | 3300009098 | Ga0105245_10015461 | Ga0105245_100154618 | 148 |
| 435 | 3300009098 | Ga0105245_10615861 | Ga0105245_106158612 | 148 |
| 436 | 3300009147 | Ga0114129_10067285 | Ga0114129_100672852 | 148 |
| 437 | 3300009148 | Ga0105243_10213111 | Ga0105243_102131113 | 148 |
| 438 | 3300009174 | Ga0105241_10783144 | Ga0105241_107831441 | 148 |
| 439 | 3300009176 | Ga0105242_10004900 | Ga0105242_100049008 | 148 |
| 440 | 3300009176 | Ga0105242_10179972 | Ga0105242_101799722 | 148 |
| 441 | 3300009553 | Ga0105249_10313021 | Ga0105249_103130211 | 148 |
| 442 | 3300011119 | Ga0105246_10140731 | Ga0105246_101407312 | 148 |
| 443 | 3300012508 | Ga0157315_1004010 | Ga0157315_10040102 | 148 |
| 444 | 3300013296 | Ga0157374_10050535 | Ga0157374_100505351 | 148 |
| 445 | 3300013296 | Ga0157374_10296343 | Ga0157374_102963432 | 148 |
| 446 | 3300013297 | Ga0157378_10174871 | Ga0157378_101748713 | 148 |
| 447 | 3300013297 | Ga0157378_10419276 | Ga0157378_104192762 | 148 |
| 448 | 3300013297 | Ga0157378_10562810 | Ga0157378_105628102 | 148 |
| 449 | 3300013306 | Ga0163162_10255430 | Ga0163162_102554303 | 148 |
| 450 | 3300013306 | Ga0163162_10421120 | Ga0163162_104211203 | 148 |
| 451 | 3300013307 | Ga0157372_10723359 | Ga0157372_107233592 | 148 |
| 452 | 3300013308 | Ga0157375_10016183 | Ga0157375_100161837 | 148 |
| 453 | 3300014326 | Ga0157380_10020598 | Ga0157380_100205982 | 148 |
| 454 | 3300014745 | Ga0157377_10148069 | Ga0157377_101480692 | 148 |
| 455 | 3300014968 | Ga0157379_10190000 | Ga0157379_101900002 | 148 |
| 456 | 3300014969 | Ga0157376_10057824 | Ga0157376_100578242 | 148 |
| 457 | 3300014969 | Ga0157376_10383003 | Ga0157376_103830032 | 148 |
| 458 | 3300025901 | Ga0207688_10255827 | Ga0207688_102558272 | 148 |
| 459 | 3300025907 | Ga0207645_10090371 | Ga0207645_100903712 | 148 |
| 460 | 3300025909 | Ga0207705_10948501 | Ga0207705_109485011 | 148 |
| 461 | 3300025912 | Ga0207707_10933870 | Ga0207707_109338702 | 148 |
| 462 | 3300025918 | Ga0207662_10312163 | Ga0207662_103121632 | 148 |
| 463 | 3300025925 | Ga0207650_10343569 | Ga0207650_103435692 | 148 |
| 464 | 3300025927 | Ga0207687_10136960 | Ga0207687_101369603 | 148 |
| 465 | 3300025932 | Ga0207690_10399087 | Ga0207690_103990872 | 148 |
| 466 | 3300025934 | Ga0207686_10025103 | Ga0207686_100251032 | 148 |
| 467 | 3300025934 | Ga0207686_10062264 | Ga0207686_100622642 | 148 |
| 468 | 3300025937 | Ga0207669_10647986 | Ga0207669_106479861 | 148 |
| 469 | 3300025938 | Ga0207704_10102567 | Ga0207704_101025672 | 148 |
| 470 | 3300025938 | Ga0207704_10221572 | Ga0207704_102215723 | 148 |
| 471 | 3300025940 | Ga0207691_10452770 | Ga0207691_104527701 | 148 |
| 472 | 3300025942 | Ga0207689_10192899 | Ga0207689_101928992 | 148 |
| 473 | 3300025944 | Ga0207661_10979361 | Ga0207661_109793611 | 148 |
| 474 | 3300025945 | Ga0207679_10684965 | Ga0207679_106849652 | 148 |
| 475 | 3300025945 | Ga0207679_10744100 | Ga0207679_107441002 | 148 |
| 476 | 3300025961 | Ga0207712_10358142 | Ga0207712_103581422 | 148 |
| 477 | 3300025961 | Ga0207712_10934600 | Ga0207712_109346001 | 148 |
| 478 | 3300026023 | Ga0207677_10652976 | Ga0207677_106529762 | 148 |
| 479 | 3300026075 | Ga0207708_10037154 | Ga0207708_100371543 | 148 |
| 480 | 3300026089 | Ga0207648_10095647 | Ga0207648_100956472 | 148 |
| 481 | 3300026116 | Ga0207674_10441918 | Ga0207674_104419182 | 148 |
| 482 | 3300026121 | Ga0207683_10030169 | Ga0207683_100301693 | 148 |
| 483 | 3300027360 | Ga0209969_1002320 | Ga0209969_10023202 | 148 |
| 484 | 3300027364 | Ga0209967_1014135 | Ga0209967_10141351 | 148 |
| 485 | 3300027378 | Ga0209981_1001042 | Ga0209981_10010422 | 148 |
| 486 | 3300027462 | Ga0210000_1001529 | Ga0210000_10015294 | 148 |
| 487 | 3300027526 | Ga0209968_1000346 | Ga0209968_10003464 | 148 |
| 488 | 3300027552 | Ga0209982_1001132 | Ga0209982_10011323 | 148 |
| 489 | 3300027617 | Ga0210002_1001021 | Ga0210002_10010214 | 148 |
| 490 | 3300027682 | Ga0209971_1002421 | Ga0209971_10024215 | 148 |
| 491 | 3300027717 | Ga0209998_10001474 | Ga0209998_100014743 | 148 |
| 492 | 3300045051 | Ga0451576_0467357 | Ga0451576_0467357_432_905 | 148 |
| 493 | 3300049571 | Ga0501034_0529015 | Ga0501034_0529015_374_859 | 148 |
| 494 | 3300049586 | Ga0501070_0439229 | Ga0501070_0439229_19_504 | 148 |
| 495 | 3300050508 | nmdc:mga09592_712282_c1 | nmdc:mga09592_712282_c1_300_773 | 148 |
| 496 | 3300050510 | nmdc:mga06r32_484933_c1 | nmdc:mga06r32_484933_c1_702_1175 | 148 |
| 497 | 3300050513 | nmdc:mga0rr50_29937_c1 | nmdc:mga0rr50_29937_c1_897_1370 | 148 |
| 498 | 3300009545 | Ga0105237_10070831 | Ga0105237_100708314 | 149 |
| 499 | 3300027252 | Ga0209973_1004488 | Ga0209973_10044881 | 149 |
| 500 | 3300027395 | Ga0209996_1000384 | Ga0209996_10003843 | 149 |
| 501 | 3300027424 | Ga0209984_1001756 | Ga0209984_10017564 | 149 |
| 502 | 3300027876 | Ga0209974_10009400 | Ga0209974_100094002 | 149 |
| 503 | 3300027907 | Ga0207428_10030176 | Ga0207428_100301762 | 149 |
| 504 | 3300028379 | Ga0268266_10263302 | Ga0268266_102633022 | 149 |
| 505 | 3300050509 | nmdc:mga0qj67_681524_c1 | nmdc:mga0qj67_681524_c1_284_757 | 149 |
| 506 | 3300009545 | Ga0105237_10021349 | Ga0105237_100213492 | 150 |
| 507 | 3300009551 | Ga0105238_10026691 | Ga0105238_100266918 | 150 |
| 508 | 3300033180 | Ga0307510_10000012 | Ga0307510_1000001229 | 150 |
| 509 | iso_pu_bacteria | 2870068957 | 2870076915 | 150 |
| 510 | 3300005354 | Ga0070675_100276312 | Ga0070675_1002763123 | 151 |
| 511 | 3300037418 | Ga0395900_0073098 | Ga0395900_0073098_2972_3457 | 151 |
| 512 | 3300037466 | Ga0395898_0000627 | Ga0395898_0000627_1272_1757 | 151 |
| 513 | 3300038443 | Ga0395901_0000080 | Ga0395901_0000080_1257_1742 | 151 |
| 514 | 3300038443 | Ga0395901_0067955 | Ga0395901_0067955_1956_2441 | 151 |
| 515 | 3300039450 | Ga0436363_0006987 | Ga0436363_0006987_378_881 | 151 |
| 516 | 3300044694 | Ga0466963_0663508 | Ga0466963_0663508_44_574 | 151 |
| 517 | 3300005435 | Ga0070714_100141889 | Ga0070714_1001418893 | 152 |
| 518 | 3300025900 | Ga0207710_10032229 | Ga0207710_100322293 | 152 |
| 519 | 3300033180 | Ga0307510_10010364 | Ga0307510_100103647 | 152 |
| 520 | 3300046558 | Ga0495633_0042588 | Ga0495633_0042588_875_1366 | 152 |
| 521 | 3300046665 | Ga0495661_0012073 | Ga0495661_0012073_697_1188 | 152 |
| 522 | 3300009093 | Ga0105240_10032843 | Ga0105240_100328433 | 153 |
| 523 | 3300009545 | Ga0105237_10131656 | Ga0105237_101316563 | 153 |
| 524 | 3300025914 | Ga0207671_10200572 | Ga0207671_102005722 | 153 |
| 525 | 3300045049 | Ga0466959_0055261 | Ga0466959_0055261_1532_2056 | 153 |
| 526 | 3300046492 | Ga0495585_0012249 | Ga0495585_0012249_3132_3626 | 153 |
| 527 | 3300046518 | Ga0495631_0027166 | Ga0495631_0027166_968_1462 | 153 |
| 528 | 3300046558 | Ga0495633_0086004 | Ga0495633_0086004_235_729 | 153 |
| 529 | 3300046648 | Ga0495611_0007774 | Ga0495611_0007774_3621_4115 | 153 |
| 530 | 3300046691 | Ga0495670_0125175 | Ga0495670_0125175_465_959 | 153 |
| 531 | 3300046794 | Ga0495589_0035782 | Ga0495589_0035782_253_747 | 153 |
| 532 | 3300047318 | Ga0495636_0009952 | Ga0495636_0009952_159_653 | 153 |
| 533 | 3300047323 | Ga0495683_0109399 | Ga0495683_0109399_81_575 | 153 |
| 534 | 3300005335 | Ga0070666_10216222 | Ga0070666_102162222 | 154 |
| 535 | 3300005355 | Ga0070671_100018587 | Ga0070671_1000185872 | 154 |
| 536 | 3300005367 | Ga0070667_100015927 | Ga0070667_1000159272 | 154 |
| 537 | 3300005617 | Ga0068859_100017980 | Ga0068859_1000179805 | 154 |
| 538 | 3300005841 | Ga0068863_100008728 | Ga0068863_1000087286 | 154 |
| 539 | 3300005842 | Ga0068858_100038712 | Ga0068858_1000387125 | 154 |
| 540 | 3300006931 | Ga0097620_100017980 | Ga0097620_1000179805 | 154 |
| 541 | 3300009092 | Ga0105250_10021756 | Ga0105250_100217563 | 154 |
| 542 | 3300009101 | Ga0105247_10001303 | Ga0105247_1000130317 | 154 |
| 543 | 3300014968 | Ga0157379_10013954 | Ga0157379_100139542 | 154 |
| 544 | 3300025900 | Ga0207710_10001602 | Ga0207710_100016028 | 154 |
| 545 | 3300025903 | Ga0207680_10075541 | Ga0207680_100755413 | 154 |
| 546 | 3300026088 | Ga0207641_10020066 | Ga0207641_100200666 | 154 |
| 547 | 3300031239 | Ga0265328_10214670 | Ga0265328_102146701 | 154 |
| 548 | 3300031250 | Ga0265331_10008403 | Ga0265331_100084032 | 154 |
| 549 | 3300031251 | Ga0265327_10008760 | Ga0265327_100087605 | 154 |
| 550 | 3300048905 | Ga0496102_0080347 | Ga0496102_0080347_65_598 | 154 |
| 551 | 3300048915 | Ga0496112_0066865 | Ga0496112_0066865_564_1097 | 154 |
| 552 | 3300048924 | Ga0496121_0047627 | Ga0496121_0047627_2559_3092 | 154 |
| 553 | 3300048927 | Ga0496124_0215296 | Ga0496124_0215296_705_1238 | 154 |
| 554 | 3300005295 | Ga0065707_10102058 | Ga0065707_101020583 | 155 |
| 555 | 3300005467 | Ga0070706_101689018 | Ga0070706_1016890181 | 155 |
| 556 | 3300005544 | Ga0070686_100004948 | Ga0070686_1000049487 | 155 |
| 557 | 3300006871 | Ga0075434_100130663 | Ga0075434_1001306632 | 155 |
| 558 | 3300006871 | Ga0075434_100398513 | Ga0075434_1003985133 | 155 |
| 559 | 3300009176 | Ga0105242_10269495 | Ga0105242_102694952 | 155 |
| 560 | 3300013296 | Ga0157374_10114547 | Ga0157374_101145473 | 155 |
| 561 | 3300014969 | Ga0157376_10393271 | Ga0157376_103932712 | 155 |
| 562 | 3300025923 | Ga0207681_10639540 | Ga0207681_106395401 | 155 |
| 563 | 3300025931 | Ga0207644_10022263 | Ga0207644_100222635 | 155 |
| 564 | 3300025934 | Ga0207686_10208838 | Ga0207686_102088382 | 155 |
| 565 | 3300025936 | Ga0207670_11197799 | Ga0207670_111977991 | 155 |
| 566 | 3300025986 | Ga0207658_10486269 | Ga0207658_104862692 | 155 |
| 567 | 3300028381 | Ga0268264_10031199 | Ga0268264_100311994 | 155 |
| 568 | 3300042461 | Ga0439460_0190185 | Ga0439460_0190185_164_637 | 155 |
| 569 | 3300048910 | Ga0496107_0305350 | Ga0496107_0305350_98_631 | 155 |
| 570 | 3300048911 | Ga0496108_0173318 | Ga0496108_0173318_1034_1567 | 155 |
| 571 | 3300048928 | Ga0496125_0051802 | Ga0496125_0051802_348_881 | 155 |
| 572 | 3300049580 | Ga0501046_0923634 | Ga0501046_0923634_70_543 | 155 |
| 573 | 3300049587 | Ga0501071_0206392 | Ga0501071_0206392_433_906 | 155 |
| 574 | 3300049741 | Ga0501079_0149772 | Ga0501079_0149772_495_968 | 155 |
| 575 | 3300050507 | nmdc:mga05p37_336634_c1 | nmdc:mga05p37_336634_c1_1283_1756 | 155 |
| 576 | 3300050512 | nmdc:mga0n895_482303_c1 | nmdc:mga0n895_482303_c1_313_825 | 155 |
| 577 | 3300050512 | nmdc:mga0n895_560603_c1 | nmdc:mga0n895_560603_c1_458_931 | 155 |
| 578 | 3300050515 | nmdc:mga0a205_32731_c1 | nmdc:mga0a205_32731_c1_925_1398 | 155 |
| 579 | 3300003214 | JGI25165J46597_1000321 | JGI25165J46597_100032112 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v0f-assembly1.cif.gz_A | crystal structure of c-as lyase with mutation k105a and substrate roxarsone | 0.9429 | 1 | 115 |
| 5cb9-assembly1.cif.gz_A | crystal structure of c-as lyase with mercaptoethonal | 0.9167 | 1 | 114 |
| 5v0f-assembly1.cif.gz_A | crystal structure of c-as lyase with mutation k105a and substrate roxarsone | 0.9052 | 1 | 115 |
| 5hcw-assembly5.cif.gz_A | crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) | 0.8936 | 1 | 114 |
| 5hcw-assembly6.cif.gz_C | crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) | 0.8838 | 1 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hcwC00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8838 | 1 | 117 | 3.10.180.10 |
| 5hcwC00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8765 | 1 | 117 | 3.10.180.10 |
| 3sk1C01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.869 | 5 | 51 | 3.30.720.120 |
| 2kjzB01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8366 | 5 | 53 | 3.30.720.120 |
| 2kjzB01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7559 | 5 | 53 | 3.30.720.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0YRD2-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase (EC 4.4.1.5) | 0.9912 | 1 | 122 |
GO:0004462
GO:0046686 GO:0051213 |
| AF-A0A4Q3NYQ8-F1-model_v4 | deleted | 0.9908 | 1 | 57 |
|
| AF-A0A242MLI4-F1-model_v4 | Lactoylglutathione lyase / Cadmium-induced protein CadI | 0.9885 | 1 | 122 |
GO:0016829
GO:0046686 |
| AF-A0A850T755-F1-model_v4 | VOC family protein | 0.9758 | 1 | 126 |
GO:0046686
|
| AF-A0A0P0D2V1-F1-model_v4 | Glyoxalase | 0.9738 | 1 | 121 |
GO:0046686
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar