F465743

General Info

Members Datasets Scaffolds Average Seq Length
578 333 530 306

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10090622|Ga0307405_100906222
Length 351
Sequence LRAAVLGTPKPAGPAAPKMPVRNGQRRHMDRWTEIELFVQTAELGSLSRAAEAVGLSNAAASRHLASLEGRLGVQLVQRNTRRLALTEMGESYYVRCKAILADLRDADAIVNATALDPMGTLRVTASLSFAMQHIAPLLRAYTERYPKVTVHVEVANRYLDLIDNNIDVAIRTREYENDSGITIRSLAETRRVLAASPGYLDRRGAPRRVEELATHDLLLYTYSNKPDELAFRRGEEQRTIRVKGLLESNDGQVLRAAALDGLGILVQPKYILYEDIVAGRLVPVLDDWDLPRLRINLAFQSRRHMSAKVRTFIDFLAAHFERMDYQRKWTSFDAGAGGEPGAAQRGGAPS

Samples

Sample ID Description Type Environment
1 2511231022 Pseudomonas sp. GM79 Isolate Nodule
2 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738543012 Acidovorax sp. CF301 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2816332133 Acidovorax radicis 2721A Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2818991450 Burkholderia sp. 604 Isolate Unclassified
21 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
24 2885198086 Variovorax sp. 679 Isolate Unclassified
25 2885211737 Variovorax sp. 553 Isolate Unclassified
26 2899924645 Variovorax sp. 369 Isolate Unclassified
27 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
28 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
29 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
30 2904456579 Variovorax sp. 2002 Isolate Unclassified
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
33 2928037797 Variovorax sp. 1126 Isolate Unclassified
34 2928044640 Variovorax sp. 1128 Isolate Unclassified
35 2928051484 Variovorax sp. 1133 Isolate Unclassified
36 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
40 2929520902 Variovorax beijingensis 502 Isolate Unclassified
41 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
42 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
197 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
205 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
209 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
315 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
320 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
330 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
331 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
332 641522639 Methylobacterium sp. 4-46 Isolate Nodule
333 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.7
Metatranscriptomes 0
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.55
Nodule 0.87
Rhizoplane 2.08
Rhizosphere 62.63
Stem 0
Stem Tuber 0
Unclassified 14.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010609 3300001979 Bacteria 3539
2 JGI25155J39150_1000625 3300002704 Bacteria 7349
3 JGI25156J39149_1018298 3300002705 Bacteria 1298
4 JGI25154J39366_1001194 3300002738 Bacteria 9859
5 JGI25152J39213_1002509 3300002773 Bacteria 6931
6 JGI25150J39212_1001450 3300002774 Bacteria 6616
7 JGI25159J45721_1008409 3300002987 Bacteria 2835
8 JGI25159J45721_1013293 3300002987 Bacteria 1914
9 JGI25151J46595_10000319 3300003187 Bacteria 52040
10 JGI25151J46595_10000748 3300003187 Bacteria 26504
11 Ga0055535_1000422 3300003761 Bacteria 39771
12 Ga0055542_1000074 3300003762 Bacteria 141185
13 Ga0055537_1000769 3300003773 Bacteria 16259
14 Ga0055537_1001115 3300003773 Bacteria 11612
15 Ga0055536_1003824 3300003781 Bacteria 7924
16 Ga0055536_1010095 3300003781 Bacteria 3799
17 Ga0055534_1003902 3300003784 Bacteria 4521
18 Ga0055528_1001962 3300003790 Bacteria 11612
19 Ga0055528_1003567 3300003790 Bacteria 7758
20 Ga0055530_10000860 3300003791 Bacteria 25047
21 Ga0055530_10005096 3300003791 Bacteria 6434
22 Ga0055540_1001520 3300003792 Bacteria 13685
23 Ga0055540_1002037 3300003792 Bacteria 11185
24 Ga0055540_1003472 3300003792 Bacteria 7607
25 Ga0055531_10000941 3300003794 Bacteria 23494
26 Ga0055531_10001221 3300003794 Bacteria 19608
27 Ga0055531_10002104 3300003794 Bacteria 13685
28 Ga0055531_10006372 3300003794 Bacteria 6713
29 Ga0055543_1001117 3300004625 Bacteria 11537
30 Ga0065165_1003053 3300005262 Bacteria 12539
31 Ga0065165_1009839 3300005262 Bacteria 4220
32 Ga0065714_10066731 3300005288 Bacteria 6393
33 Ga0070676_10003210 3300005328 Bacteria 8475
34 Ga0070670_100076493 3300005331 Bacteria 2876
35 Ga0068868_100099710 3300005338 Bacteria 2350
36 Ga0070669_100044278 3300005353 Bacteria 3243
37 Ga0070675_100007910 3300005354 Bacteria 8240
38 Ga0070671_100071631 3300005355 Bacteria 2893
39 Ga0070673_100025508 3300005364 Bacteria 4353
40 Ga0070659_100033731 3300005366 Bacteria 3978
41 Ga0070659_100064296 3300005366 Bacteria 2904
42 Ga0070663_100206474 3300005455 Unclassified 1536
43 Ga0070678_100022140 3300005456 Bacteria 4203
44 Ga0068867_100001085 3300005459 Bacteria 18625
45 Ga0070698_100202952 3300005471 Bacteria 1918
46 Ga0068853_100002357 3300005539 Bacteria 14135
47 Ga0068853_100193237 3300005539 Bacteria 1850
48 Ga0070672_100001313 3300005543 Bacteria 15322
49 Ga0070665_100206007 3300005548 Bacteria 1967
50 Ga0068855_100108408 3300005563 Bacteria 3190
51 Ga0070664_100122172 3300005564 Bacteria 2281
52 Ga0070664_100129733 3300005564 Bacteria 2214
53 Ga0068857_100105824 3300005577 Bacteria 2526
54 Ga0068854_100247983 3300005578 Bacteria 1421
55 Ga0068852_100045747 3300005616 Bacteria 3725
56 Ga0068851_10004140 3300005834 Bacteria 6528
57 Ga0068851_10009751 3300005834 Bacteria 4472
58 Ga0068870_10023339 3300005840 Bacteria 3049
59 Ga0068862_100022808 3300005844 Bacteria 5238
60 Ga0075365_10000475 3300006038 Bacteria 15140
61 Ga0075365_10001106 3300006038 Bacteria 11756
62 Ga0075365_10068915 3300006038 Bacteria 2377
63 Ga0075363_100056622 3300006048 Bacteria 2102
64 Ga0075432_10018132 3300006058 Bacteria 2400
65 Ga0075432_10037719 3300006058 Bacteria 1683
66 Ga0075362_10022570 3300006177 Bacteria 2653
67 Ga0075367_10097831 3300006178 Bacteria 1791
68 Ga0075366_10024357 3300006195 Bacteria 3530
69 Ga0097621_100209974 3300006237 Bacteria 1694
70 Ga0075370_10002231 3300006353 Bacteria 8910
71 Ga0075370_10008143 3300006353 Bacteria 5380
72 Ga0075370_10064162 3300006353 Bacteria 2094
73 Ga0068871_100103223 3300006358 Bacteria 2390
74 Ga0105251_10000044 3300009011 Bacteria 113730
75 Ga0105244_10005708 3300009036 Bacteria 8214
76 Ga0105244_10008568 3300009036 Bacteria 6377
77 Ga0105244_10014006 3300009036 Bacteria 4655
78 Ga0105244_10095277 3300009036 Bacteria 1461
79 Ga0105250_10009376 3300009092 Bacteria 4125
80 Ga0105250_10036987 3300009092 Bacteria 1959
81 Ga0105240_10076623 3300009093 Bacteria 4122
82 Ga0105240_10105838 3300009093 Bacteria 3414
83 Ga0105245_10153704 3300009098 Bacteria 2178
84 Ga0105245_10200274 3300009098 Bacteria 1917
85 Ga0105243_10002680 3300009148 Bacteria 14793
86 Ga0105243_10404212 3300009148 Bacteria 1269
87 Ga0105241_10101770 3300009174 Bacteria 2285
88 Ga0105242_10396528 3300009176 Bacteria 1287
89 Ga0105237_10116320 3300009545 Bacteria 2667
90 Ga0105237_10172918 3300009545 Bacteria 2160
91 Ga0105246_10008048 3300011119 Bacteria 6471
92 Ga0105246_10090628 3300011119 Bacteria 2202
93 Ga0157371_10013731 3300013102 Bacteria 6141
94 Ga0157371_10128646 3300013102 Bacteria 1801
95 Ga0157370_10007277 3300013104 Bacteria 12079
96 Ga0157369_10004076 3300013105 Bacteria 17299
97 Ga0163162_10392457 3300013306 Unclassified 1520
98 Ga0157372_10014374 3300013307 Bacteria 8465
99 Ga0157375_10219159 3300013308 Bacteria 2061
100 Ga0182008_10000038 3300014497 Bacteria 129386
101 Ga0182008_10000137 3300014497 Bacteria 55850
102 Ga0182008_10008156 3300014497 Bacteria 5734
103 Ga0182008_10009725 3300014497 Bacteria 5178
104 Ga0157376_10356535 3300014969 Bacteria 1401
105 Ga0182006_1000779 3300015261 Bacteria 21592
106 Ga0182006_1053835 3300015261 Unclassified 1541
107 Ga0182007_10000246 3300015262 Bacteria 36410
108 Ga0182007_10006053 3300015262 Bacteria 5230
109 Ga0182007_10039158 3300015262 Bacteria 1587
110 Ga0182005_1041329 3300015265 Bacteria 1254
111 Ga0163161_10000521 3300017792 Bacteria 31378
112 Ga0163161_10004883 3300017792 Bacteria 9341
113 Ga0213872_10059674 3300021361 Bacteria 1726
114 Ga0209435_100096 3300025206 Bacteria 38561
115 Ga0209672_102024 3300025228 Bacteria 5566
116 Ga0209147_100419 3300025229 Bacteria 27989
117 Ga0209258_100176 3300025242 Bacteria 141261
118 Ga0207425_1000133 3300025245 Bacteria 67802
119 Ga0209646_1000093 3300025246 Bacteria 183840
120 Ga0209026_1006454 3300025250 Bacteria 2859
121 Ga0209148_1000033 3300025254 Bacteria 555508
122 Ga0209759_1000248 3300025256 Bacteria 80537
123 Ga0209129_1000186 3300025258 Bacteria 85793
124 Ga0209129_1000700 3300025258 Bacteria 21883
125 Ga0209129_1002228 3300025258 Bacteria 9711
126 Ga0209565_1000190 3300025263 Bacteria 75207
127 Ga0209673_1000209 3300025273 Bacteria 117670
128 Ga0209673_1000393 3300025273 Bacteria 78531
129 Ga0209673_1002517 3300025273 Bacteria 12573
130 Ga0209673_1053782 3300025273 Bacteria 1047
131 Ga0209130_1000335 3300025284 Bacteria 53993
132 Ga0209130_1000433 3300025284 Bacteria 44915
133 Ga0209675_1000300 3300025291 Bacteria 45407
134 Ga0209675_1000330 3300025291 Bacteria 41678
135 Ga0209675_1008403 3300025291 Bacteria 3800
136 Ga0209676_1000048 3300025292 Bacteria 403716
137 Ga0209676_1000618 3300025292 Bacteria 51827
138 Ga0209676_1002336 3300025292 Bacteria 13712
139 Ga0209676_1008753 3300025292 Bacteria 4461
140 Ga0209025_1000324 3300025294 Bacteria 106257
141 Ga0209025_1000597 3300025294 Bacteria 65153
142 Ga0209025_1000947 3300025294 Bacteria 44024
143 Ga0209025_1058059 3300025294 Bacteria 1473
144 Ga0209564_1000417 3300025295 Bacteria 74808
145 Ga0209564_1000423 3300025295 Bacteria 74528
146 Ga0209758_1000092 3300025297 Bacteria 241910
147 Ga0209758_1002789 3300025297 Bacteria 17080
148 Ga0209050_1000012 3300025298 Bacteria 813717
149 Ga0209050_1002843 3300025298 Bacteria 13737
150 Ga0209050_1010544 3300025298 Bacteria 4536
151 Ga0209256_1000094 3300025299 Bacteria 208177
152 Ga0209256_1000095 3300025299 Bacteria 206120
153 Ga0207426_1000084 3300025302 Bacteria 298123
154 Ga0207426_1000161 3300025302 Bacteria 172765
155 Ga0209051_1000019 3300025303 Bacteria 511268
156 Ga0209051_1000207 3300025303 Bacteria 103683
157 Ga0209051_1000456 3300025303 Bacteria 54000
158 Ga0209051_1005182 3300025303 Bacteria 7718
159 Ga0209257_1000015 3300025304 Bacteria 908141
160 Ga0209257_1000024 3300025304 Bacteria 726068
161 Ga0209257_1000258 3300025304 Bacteria 122220
162 Ga0209257_1002906 3300025304 Bacteria 15829
163 Ga0207656_10002163 3300025321 Bacteria 6569
164 Ga0207655_1000845 3300025728 Bacteria 32859
165 Ga0207655_1001510 3300025728 Bacteria 21219
166 Ga0207655_1029780 3300025728 Bacteria 2549
167 Ga0207713_1000113 3300025735 Bacteria 132424
168 Ga0207647_10037287 3300025904 Bacteria 3083
169 Ga0207647_10086263 3300025904 Bacteria 1876
170 Ga0207645_10008543 3300025907 Bacteria 7136
171 Ga0207643_10036671 3300025908 Bacteria 2750
172 Ga0207705_10263901 3300025909 Bacteria 1315
173 Ga0207695_10078337 3300025913 Bacteria 3353
174 Ga0207695_10104095 3300025913 Bacteria 2828
175 Ga0207695_10196979 3300025913 Bacteria 1930
176 Ga0207657_10113380 3300025919 Bacteria 2237
177 Ga0207694_10049719 3300025924 Bacteria 3245
178 Ga0207650_10341764 3300025925 Bacteria 1229
179 Ga0207659_10099786 3300025926 Bacteria 2186
180 Ga0207687_10037687 3300025927 Bacteria 3300
181 Ga0207644_10043195 3300025931 Bacteria 3198
182 Ga0207690_10036876 3300025932 Bacteria 3170
183 Ga0207706_10002677 3300025933 Bacteria 17361
184 Ga0207709_10000669 3300025935 Bacteria 27749
185 Ga0207709_10003070 3300025935 Bacteria 10085
186 Ga0207709_10004163 3300025935 Bacteria 8417
187 Ga0207669_10016776 3300025937 Bacteria 3735
188 Ga0207691_10015569 3300025940 Bacteria 7230
189 Ga0207679_10074384 3300025945 Bacteria 2574
190 Ga0207679_10145466 3300025945 Bacteria 1922
191 Ga0207667_10035396 3300025949 Bacteria 5356
192 Ga0207667_10052383 3300025949 Bacteria 4298
193 Ga0207667_10100144 3300025949 Bacteria 2989
194 Ga0207651_10038120 3300025960 Bacteria 3155
195 Ga0207658_10010616 3300025986 Bacteria 6259
196 Ga0207677_10010160 3300026023 Bacteria 5318
197 Ga0207639_10006236 3300026041 Bacteria 8101
198 Ga0207639_10008790 3300026041 Bacteria 6941
199 Ga0207639_10208950 3300026041 Bacteria 1679
200 Ga0207678_10124960 3300026067 Bacteria 2195
201 Ga0207678_10236285 3300026067 Unclassified 1565
202 Ga0207702_10204558 3300026078 Bacteria 1832
203 Ga0207648_10002091 3300026089 Bacteria 21749
204 Ga0207674_10015495 3300026116 Bacteria 8372
205 Ga0207674_10071378 3300026116 Bacteria 3489
206 Ga0207683_10023474 3300026121 Bacteria 5307
207 Ga0207683_10036799 3300026121 Bacteria 4262
208 Ga0209813_10083236 3300027866 Bacteria 1062
209 Ga0209974_10028423 3300027876 Bacteria 1852
210 Ga0268265_10024312 3300028380 Bacteria 4285
211 Ga0307515_10000195 3300028794 Bacteria 148138
212 Ga0307515_10351932 3300028794 Bacteria 1119
213 Ga0307513_10000104 3300031456 Bacteria 119239
214 Ga0307513_10007645 3300031456 Bacteria 13968
215 Ga0307513_10140448 3300031456 Bacteria 2343
216 Ga0307509_10001087 3300031507 Bacteria 46534
217 Ga0307408_100002368 3300031548 Bacteria 13310
218 Ga0307408_100004935 3300031548 Bacteria 8973
219 Ga0307408_100007142 3300031548 Bacteria 7393
220 Ga0307408_100230941 3300031548 Bacteria 1515
221 Ga0307508_10000155 3300031616 Bacteria 82771
222 Ga0307508_10000278 3300031616 Bacteria 62985
223 Ga0307514_10001288 3300031649 Bacteria 32569
224 Ga0307514_10009962 3300031649 Bacteria 7965
225 Ga0307405_10090622 3300031731 Bacteria 2023
226 Ga0307410_10197783 3300031852 Bacteria 1533
227 Ga0307406_10006354 3300031901 Bacteria 6518
228 Ga0307407_10113972 3300031903 Bacteria 1702
229 Ga0307412_10014289 3300031911 Bacteria 4678
230 Ga0307412_10028388 3300031911 Bacteria 3499
231 Ga0307412_10050360 3300031911 Bacteria 2748
232 Ga0307412_10056914 3300031911 Bacteria 2608
233 Ga0307416_100005714 3300032002 Bacteria 7694
234 Ga0307416_100058233 3300032002 Bacteria 3131
235 Ga0307416_100502277 3300032002 Bacteria 1277
236 Ga0307414_10008504 3300032004 Bacteria 5825
237 Ga0307411_10000361 3300032005 Bacteria 15415
238 Ga0307411_10031826 3300032005 Bacteria 3251
239 Ga0395900_0014904 3300037418 Bacteria 7921
240 Ga0395905_0030746 3300037471 Bacteria 5057
241 Ga0395905_0055186 3300037471 Bacteria 3718
242 Ga0436361_1130701 3300039447 Bacteria 2723
243 Ga0439436_0000374 3300041404 Bacteria 11163
244 Ga0439439_0000021 3300041406 Bacteria 22666
245 Ga0439447_005582 3300041407 Bacteria 4165
246 Ga0439447_015870 3300041407 Bacteria 2080
247 Ga0439461_0005344 3300041410 Bacteria 2184
248 Ga0439466_0046632 3300041411 Bacteria 1430
249 Ga0439433_0049989 3300041999 Bacteria 985
250 Ga0439441_032416 3300042001 Bacteria 1018
251 Ga0439442_009025 3300042002 Bacteria 2016
252 Ga0439442_012341 3300042002 Bacteria 1746
253 Ga0439445_0020918 3300042004 Bacteria 1641
254 Ga0439445_0029533 3300042004 Bacteria 1417
255 Ga0439432_002487 3300042006 Bacteria 6942
256 Ga0439449_0000003 3300042007 Bacteria 94735
257 Ga0439452_001327 3300042010 Bacteria 10357
258 Ga0439452_029495 3300042010 Bacteria 1361
259 Ga0439462_0000090 3300042015 Bacteria 14033
260 Ga0439462_0001359 3300042015 Bacteria 5404
261 Ga0450911_000517 3300042115 Bacteria 12187
262 Ga0450898_010326 3300042134 Bacteria 1509
263 Ga0450906_004482 3300042145 Bacteria 2925
264 Ga0439446_0000737 3300042156 Bacteria 6864
265 Ga0439446_0031357 3300042156 Bacteria 1538
266 Ga0439446_0041666 3300042156 Bacteria 1354
267 Ga0450908_000504 3300042184 Bacteria 7529
268 Ga0450908_009529 3300042184 Bacteria 1803
269 Ga0450909_007353 3300042185 Bacteria 1593
270 Ga0439434_0001484 3300042435 Bacteria 6744
271 Ga0439434_0044535 3300042435 Bacteria 1367
272 Ga0439464_0001746 3300042439 Bacteria 5222
273 Ga0450918_000094 3300042531 Bacteria 18922
274 Ga0450893_0002044 3300042532 Bacteria 3141
275 Ga0451577_0057675 3300042876 Bacteria 3461
276 Ga0466965_0013703 3300044683 Bacteria 3828
277 Ga0466966_0119764 3300044684 Bacteria 1618
278 Ga0466957_0135931 3300044842 Bacteria 1580
279 Ga0466957_0243813 3300044842 Bacteria 1193
280 Ga0451576_0016907 3300045051 Bacteria 8034
281 Ga0495627_007646 3300046453 Bacteria 4126
282 Ga0495603_0035087 3300046455 Bacteria 3014
283 Ga0495591_000625 3300046458 Bacteria 26342
284 Ga0495591_007635 3300046458 Bacteria 4565
285 Ga0495591_016741 3300046458 Bacteria 2539
286 Ga0495629_0000364 3300046459 Bacteria 38314
287 Ga0495629_0001879 3300046459 Bacteria 16395
288 Ga0495629_0031162 3300046459 Bacteria 3777
289 Ga0495629_0177567 3300046459 Bacteria 1476
290 Ga0495638_0016669 3300046460 Bacteria 4916
291 Ga0495638_0029396 3300046460 Bacteria 3543
292 Ga0495638_0092382 3300046460 Bacteria 1822
293 Ga0495651_0001862 3300046462 Bacteria 16323
294 Ga0495653_0000862 3300046463 Bacteria 23392
295 Ga0495653_0005814 3300046463 Bacteria 10094
296 Ga0495653_0006242 3300046463 Bacteria 9779
297 Ga0495653_0015833 3300046463 Bacteria 6146
298 Ga0495650_0002566 3300046471 Bacteria 14389
299 Ga0495580_0004195 3300046472 Bacteria 12122
300 Ga0495580_0025864 3300046472 Bacteria 4286
301 Ga0495580_0040467 3300046472 Bacteria 3328
302 Ga0495605_0000011 3300046474 Bacteria 314856
303 Ga0495605_0007142 3300046474 Bacteria 6356
304 Ga0495605_0057567 3300046474 Bacteria 1870
305 Ga0495664_0011155 3300046477 Bacteria 5057
306 Ga0495664_0038433 3300046477 Bacteria 2825
307 Ga0495664_0121351 3300046477 Bacteria 1581
308 Ga0495596_0000441 3300046500 Bacteria 26588
309 Ga0495607_0005658 3300046501 Bacteria 8902
310 Ga0495583_0000607 3300046506 Bacteria 48463
311 Ga0495606_0006327 3300046507 Bacteria 10962
312 Ga0495606_0020375 3300046507 Bacteria 4891
313 Ga0495606_0073050 3300046507 Bacteria 2153
314 Ga0495608_0003956 3300046511 Bacteria 10643
315 Ga0495610_0000297 3300046512 Bacteria 52357
316 Ga0495610_0004665 3300046512 Bacteria 10025
317 Ga0495610_0009665 3300046512 Bacteria 6071
318 Ga0495610_0010907 3300046512 Bacteria 5607
319 Ga0495616_0001476 3300046513 Bacteria 16324
320 Ga0495618_0030943 3300046514 Bacteria 3345
321 Ga0495618_0048672 3300046514 Bacteria 2676
322 Ga0495620_0000161 3300046515 Bacteria 53208
323 Ga0495620_0008945 3300046515 Bacteria 5350
324 Ga0495620_0012055 3300046515 Bacteria 4485
325 Ga0495628_0000464 3300046516 Bacteria 37205
326 Ga0495628_0028075 3300046516 Bacteria 4576
327 Ga0495630_0003450 3300046517 Bacteria 10989
328 Ga0495630_0011979 3300046517 Bacteria 6287
329 Ga0495630_0072413 3300046517 Bacteria 2594
330 Ga0495631_0000537 3300046518 Bacteria 25460
331 Ga0495632_0004154 3300046519 Bacteria 9930
332 Ga0495637_0000530 3300046520 Bacteria 27494
333 Ga0495637_0011274 3300046520 Bacteria 4298
334 Ga0495637_0015098 3300046520 Bacteria 3629
335 Ga0495643_0050916 3300046522 Bacteria 2229
336 Ga0495648_0007865 3300046524 Bacteria 8474
337 Ga0495648_0008198 3300046524 Bacteria 8244
338 Ga0495648_0011938 3300046524 Bacteria 6515
339 Ga0495648_0012860 3300046524 Bacteria 6216
340 Ga0495648_0056126 3300046524 Bacteria 2371
341 Ga0495648_0056171 3300046524 Bacteria 2369
342 Ga0495652_0001163 3300046529 Bacteria 29681
343 Ga0495652_0003088 3300046529 Bacteria 16663
344 Ga0495652_0021478 3300046529 Bacteria 5737
345 Ga0495652_0095051 3300046529 Bacteria 2429
346 Ga0495654_0000517 3300046530 Bacteria 31432
347 Ga0495654_0004380 3300046530 Bacteria 8400
348 Ga0495654_0004940 3300046530 Bacteria 7842
349 Ga0495665_0000748 3300046531 Bacteria 16825
350 Ga0495665_0001965 3300046531 Bacteria 11105
351 Ga0495640_0002644 3300046533 Bacteria 14381
352 Ga0495640_0007938 3300046533 Bacteria 8345
353 Ga0495586_0099651 3300046535 Bacteria 1612
354 Ga0495587_0004163 3300046536 Bacteria 9574
355 Ga0495587_0055283 3300046536 Bacteria 2338
356 Ga0495587_0101541 3300046536 Bacteria 1657
357 Ga0495621_0004093 3300046539 Bacteria 4062
358 Ga0495597_0009527 3300046542 Bacteria 4792
359 Ga0495645_0002406 3300046543 Bacteria 12699
360 Ga0495667_0061161 3300046559 Bacteria 2470
361 Ga0495656_0047847 3300046615 Bacteria 1815
362 Ga0495668_0046831 3300046616 Bacteria 2402
363 Ga0495634_0002384 3300046642 Bacteria 15661
364 Ga0495634_0017002 3300046642 Bacteria 5195
365 Ga0495625_0007663 3300046660 Bacteria 9358
366 Ga0495625_0034520 3300046660 Bacteria 3732
367 Ga0495625_0075078 3300046660 Bacteria 2366
368 Ga0495625_0169177 3300046660 Bacteria 1460
369 Ga0495635_0000939 3300046663 Bacteria 19220
370 Ga0495635_0006958 3300046663 Bacteria 7902
371 Ga0495635_0032777 3300046663 Bacteria 3604
372 Ga0495635_0326705 3300046663 Bacteria 1026
373 Ga0495661_0007874 3300046665 Bacteria 7404
374 Ga0495661_0031139 3300046665 Bacteria 3389
375 Ga0495661_0124761 3300046665 Bacteria 1418
376 Ga0495588_0026532 3300046674 Bacteria 2893
377 Ga0495588_0030883 3300046674 Bacteria 2694
378 Ga0495599_0085894 3300046678 Bacteria 1965
379 Ga0495623_0002074 3300046679 Bacteria 13428
380 Ga0495623_0003630 3300046679 Bacteria 10197
381 Ga0495646_0000186 3300046680 Bacteria 30935
382 Ga0495646_0002342 3300046680 Bacteria 11611
383 Ga0495613_0003595 3300046689 Bacteria 11617
384 Ga0495613_0014696 3300046689 Bacteria 5809
385 Ga0495624_0005675 3300046690 Bacteria 8957
386 Ga0495624_0011721 3300046690 Bacteria 6022
387 Ga0495624_0026849 3300046690 Bacteria 3772
388 Ga0495670_0012221 3300046691 Bacteria 4221
389 Ga0495671_0001625 3300046692 Bacteria 14758
390 Ga0495671_0014598 3300046692 Bacteria 4222
391 Ga0495671_0023590 3300046692 Bacteria 3213
392 Ga0495649_0001789 3300046694 Bacteria 15819
393 Ga0495649_0014453 3300046694 Bacteria 4523
394 Ga0495589_0001856 3300046794 Bacteria 11971
395 Ga0495589_0019448 3300046794 Bacteria 3481
396 Ga0495589_0020564 3300046794 Bacteria 3375
397 Ga0495589_0046740 3300046794 Bacteria 2147
398 Ga0495600_0003946 3300046809 Bacteria 8811
399 Ga0495600_0035481 3300046809 Bacteria 3239
400 Ga0495600_0108461 3300046809 Bacteria 1808
401 Ga0495660_0000172 3300046810 Bacteria 69913
402 Ga0495660_0009861 3300046810 Bacteria 5556
403 Ga0495581_0041478 3300047315 Bacteria 2663
404 Ga0495604_0001947 3300047317 Bacteria 16691
405 Ga0495604_0002252 3300047317 Bacteria 15457
406 Ga0495604_0178512 3300047317 Bacteria 1487
407 Ga0495636_0035396 3300047318 Bacteria 2056
408 Ga0495674_0003301 3300047319 Bacteria 15673
409 Ga0495674_0047611 3300047319 Bacteria 3800
410 Ga0495674_0057910 3300047319 Bacteria 3389
411 Ga0495674_0107751 3300047319 Bacteria 2364
412 Ga0495672_0005641 3300047320 Bacteria 9877
413 Ga0495672_0034098 3300047320 Bacteria 3148
414 Ga0495672_0035440 3300047320 Bacteria 3073
415 Ga0495676_0053599 3300047321 Bacteria 3213
416 Ga0495676_0064159 3300047321 Bacteria 2859
417 Ga0495676_0084129 3300047321 Bacteria 2401
418 Ga0495680_0007073 3300047322 Bacteria 10339
419 Ga0495680_0023370 3300047322 Bacteria 5141
420 Ga0495680_0041644 3300047322 Bacteria 3650
421 Ga0495683_0000031 3300047323 Bacteria 150363
422 Ga0495683_0001016 3300047323 Bacteria 19555
423 Ga0495683_0001244 3300047323 Bacteria 17281
424 Ga0495683_0065348 3300047323 Bacteria 1794
425 Ga0495675_0002504 3300047444 Bacteria 10993
426 Ga0495675_0008463 3300047444 Bacteria 6377
427 Ga0495679_000023 3300047446 Bacteria 209366
428 Ga0495679_000074 3300047446 Bacteria 95881
429 Ga0495679_000266 3300047446 Bacteria 43582
430 Ga0495679_001275 3300047446 Bacteria 14786
431 Ga0495673_0057557 3300047469 Bacteria 1678
432 Ga0495681_0000589 3300047470 Bacteria 27752
433 Ga0495681_0002085 3300047470 Bacteria 14537
434 Ga0495681_0022827 3300047470 Bacteria 3338
435 Ga0495681_0028639 3300047470 Bacteria 2862
436 Ga0495593_0000185 3300047673 Bacteria 32413
437 Ga0495593_0005329 3300047673 Bacteria 7603
438 Ga0495593_0011078 3300047673 Bacteria 5188
439 Ga0495593_0011489 3300047673 Bacteria 5083
440 Ga0495593_0019829 3300047673 Bacteria 3768
441 Ga0495602_0000877 3300048088 Bacteria 29029
442 Ga0495602_0028667 3300048088 Bacteria 5322
443 Ga0495602_0029722 3300048088 Bacteria 5195
444 Ga0495614_0000624 3300048089 Bacteria 14828
445 Ga0495626_0030598 3300048091 Bacteria 2596
446 Ga0496101_0020189 3300048904 Bacteria 4556
447 Ga0496101_0043591 3300048904 Bacteria 3207
448 Ga0496102_0036988 3300048905 Unclassified 4401
449 Ga0496102_0127702 3300048905 Bacteria 2378
450 Ga0496102_0587400 3300048905 Bacteria 1037
451 Ga0496103_0084906 3300048906 Bacteria 1995
452 Ga0496104_0093870 3300048907 Bacteria 2870
453 Ga0496105_0010008 3300048908 Bacteria 7441
454 Ga0496107_0192173 3300048910 Bacteria 1517
455 Ga0496116_0011047 3300048919 Bacteria 7510
456 Ga0496116_0024653 3300048919 Bacteria 4442
457 Ga0496116_0025679 3300048919 Bacteria 4326
458 Ga0496116_0029801 3300048919 Bacteria 3928
459 Ga0496117_0003636 3300048920 Bacteria 17755
460 Ga0496117_0008928 3300048920 Bacteria 9438
461 Ga0496117_0015076 3300048920 Bacteria 6618
462 Ga0496117_0035699 3300048920 Bacteria 3728
463 Ga0496117_0055678 3300048920 Bacteria 2761
464 Ga0496117_0065820 3300048920 Bacteria 2461
465 Ga0496118_0009638 3300048921 Bacteria 9713
466 Ga0496118_0011360 3300048921 Bacteria 8704
467 Ga0496118_0012669 3300048921 Bacteria 8067
468 Ga0496118_0020728 3300048921 Bacteria 5820
469 Ga0496118_0021995 3300048921 Bacteria 5592
470 Ga0496119_0029001 3300048922 Bacteria 3763
471 Ga0496119_0124004 3300048922 Bacteria 1416
472 Ga0496120_0023347 3300048923 Bacteria 3872
473 Ga0496120_0089793 3300048923 Bacteria 1644
474 Ga0496121_0006328 3300048924 Bacteria 14765
475 Ga0496121_0021379 3300048924 Bacteria 6340
476 Ga0496121_0024301 3300048924 Bacteria 5802
477 Ga0496121_0070912 3300048924 Bacteria 2804
478 Ga0496121_0161120 3300048924 Bacteria 1640
479 Ga0496121_0176107 3300048924 Bacteria 1548
480 Ga0496123_0012263 3300048926 Bacteria 7325
481 Ga0496123_0123930 3300048926 Bacteria 1447
482 Ga0496123_0147506 3300048926 Bacteria 1275
483 Ga0496124_0019168 3300048927 Bacteria 6381
484 Ga0496124_0021743 3300048927 Bacteria 5903
485 Ga0496124_0246483 3300048927 Bacteria 1325
486 Ga0496125_0001750 3300048928 Bacteria 30140
487 Ga0496125_0006979 3300048928 Bacteria 12086
488 Ga0496125_0081693 3300048928 Bacteria 2467
489 Ga0496125_0105691 3300048928 Bacteria 2057
490 Ga0496126_0032644 3300048929 Bacteria 4903
491 Ga0496126_0102561 3300048929 Bacteria 2501
492 Ga0496126_0105825 3300048929 Bacteria 2456
493 Ga0496126_0179913 3300048929 Bacteria 1797
494 Ga0496126_0205691 3300048929 Bacteria 1659
495 Ga0495678_005793 3300049459 Bacteria 6708
496 Ga0495678_031255 3300049459 Bacteria 2222
497 Ga0495682_0009590 3300049460 Bacteria 3775
498 Ga0495682_0012189 3300049460 Bacteria 3299
499 Ga0495682_0030933 3300049460 Bacteria 1980
500 Ga0495682_0075366 3300049460 Bacteria 1213
501 Ga0501044_0274654 3300049823 Bacteria 1620
502 nmdc:mga03683_6612_c1 3300050489 Bacteria 3980
503 nmdc:mga0yw44_18039_c1 3300050492 Bacteria 3857
504 nmdc:mga0yw44_2563_c1 3300050492 Bacteria 7800
505 nmdc:mga0yw44_646_c1 3300050492 Bacteria 12676
506 nmdc:mga0k408_98608_c1 3300050493 Bacteria 1722
507 nmdc:mga04h51_98636_c1 3300050495 Bacteria 1062
508 nmdc:mga07m45_11607_c1 3300050496 Bacteria 4632
509 Ga0500643_002217 3300053087 Bacteria 10263
510 Ga0500651_0000594 3300053093 Bacteria 18149
511 Ga0500562_007363 3300053108 Bacteria 2775
512 Ga0500571_000166 3300053110 Bacteria 23008
513 Ga0500593_000082 3300053117 Bacteria 35375
514 Ga0500594_0004485 3300053118 Bacteria 3077
515 Ga0500607_000440 3300053121 Bacteria 39828
516 Ga0500607_009571 3300053121 Bacteria 5822
517 Ga0500608_011039 3300053122 Bacteria 3905
518 Ga0500608_012939 3300053122 Bacteria 3681
519 Ga0500655_000044 3300053133 Bacteria 34085
520 Ga0500658_0000117 3300053134 Bacteria 37704
521 Ga0500658_0000582 3300053134 Bacteria 15383
522 Ga0500559_0029644 3300053136 Bacteria 2344
523 Ga0500564_004195 3300053138 Bacteria 5733
524 Ga0500568_0006092 3300053139 Bacteria 6112
525 Ga0500574_001907 3300053141 Bacteria 3271
526 Ga0500616_0075040 3300053153 Bacteria 1712
527 Ga0500627_0034519 3300053158 Bacteria 2144
528 Ga0500634_0009122 3300053161 Bacteria 4999
529 Ga0500634_0065538 3300053161 Bacteria 1916
530 Ga0500638_004205 3300053162 Bacteria 5497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015262 Ga0182007_10039158 Ga0182007_100391582 269
2 3300046524 Ga0495648_0011938 Ga0495648_0011938_5633_6502 273
3 3300005353 Ga0070669_100044278 Ga0070669_1000442782 278
4 3300005548 Ga0070665_100206007 Ga0070665_1002060072 278
5 3300025937 Ga0207669_10016776 Ga0207669_100167764 278
6 3300026121 Ga0207683_10023474 Ga0207683_100234742 278
7 3300013102 Ga0157371_10128646 Ga0157371_101286462 281
8 3300048919 Ga0496116_0011047 Ga0496116_0011047_6057_7028 281
9 3300048922 Ga0496119_0029001 Ga0496119_0029001_76_1047 281
10 3300048923 Ga0496120_0023347 Ga0496120_0023347_2729_3700 281
11 3300048927 Ga0496124_0019168 Ga0496124_0019168_4949_5920 281
12 3300048928 Ga0496125_0081693 Ga0496125_0081693_1246_2217 281
13 3300048929 Ga0496126_0102561 Ga0496126_0102561_387_1358 281
14 3300003187 JGI25151J46595_10000319 JGI25151J46595_1000031943 283
15 3300025258 Ga0209129_1002228 Ga0209129_10022286 283
16 3300025294 Ga0209025_1000597 Ga0209025_100059742 283
17 3300005471 Ga0070698_100202952 Ga0070698_1002029522 284
18 3300014497 Ga0182008_10000137 Ga0182008_1000013735 284
19 3300025935 Ga0207709_10003070 Ga0207709_100030709 284
20 3300037471 Ga0395905_0030746 Ga0395905_0030746_4122_5024 284
21 3300037471 Ga0395905_0055186 Ga0395905_0055186_84_992 284
22 3300042876 Ga0451577_0057675 Ga0451577_0057675_2088_2999 284
23 3300044684 Ga0466966_0119764 Ga0466966_0119764_76_984 284
24 3300044842 Ga0466957_0243813 Ga0466957_0243813_102_1010 284
25 3300046615 Ga0495656_0047847 Ga0495656_0047847_94_1005 284
26 3300049823 Ga0501044_0274654 Ga0501044_0274654_473_1381 284
27 3300050492 nmdc:mga0yw44_18039_c1 nmdc:mga0yw44_18039_c1_2468_3376 284
28 iso_pu_bacteria 2511231022 2511364499 284
29 iso_pu_bacteria 2511231156 2511824023 284
30 iso_pu_bacteria 2818991450 2819621087 284
31 iso_pu_bacteria 2900634093 2900643002 284
32 iso_pu_bacteria 2901300506 2901304512 284
33 iso_pu_bacteria 8055266321 8055273527 284
34 3300006353 Ga0075370_10002231 Ga0075370_100022319 285
35 iso_pu_bacteria 2643221644 2644248112 285
36 3300002704 JGI25155J39150_1000625 JGI25155J39150_10006257 286
37 3300002705 JGI25156J39149_1018298 JGI25156J39149_10182981 286
38 3300002738 JGI25154J39366_1001194 JGI25154J39366_10011944 286
39 3300025206 Ga0209435_100096 Ga0209435_10009638 286
40 3300025246 Ga0209646_1000093 Ga0209646_10000939 286
41 3300025250 Ga0209026_1006454 Ga0209026_10064544 286
42 3300025256 Ga0209759_1000248 Ga0209759_100024815 286
43 iso_pu_bacteria 2513020051 2513229106 286
44 iso_pu_bacteria 2545555834 2545673211 286
45 iso_pu_bacteria 2599185214 2599626358 286
46 iso_pu_bacteria 2599185226 2599676318 286
47 iso_pu_bacteria 2599185227 2599682060 286
48 iso_pu_bacteria 2599185229 2599695710 286
49 iso_pu_bacteria 2643221609 2644059179 286
50 iso_pu_bacteria 2643221611 2644075779 286
51 iso_pu_bacteria 2643221658 2644328533 286
52 iso_pu_bacteria 2643221672 2644399771 286
53 iso_pu_bacteria 2738541277 2738721333 286
54 iso_pu_bacteria 2738541307 2738880677 286
55 iso_pu_bacteria 2738543012 2739240667 286
56 iso_pu_bacteria 2738543019 2739281002 286
57 iso_pu_bacteria 2816332133 2816472256 286
58 iso_pu_bacteria 2818991446 2819601641 286
59 iso_pu_bacteria 2818991446 2819601747 286
60 iso_pu_bacteria 2831265667 2831269257 286
61 iso_pu_bacteria 2838054893 2838059234 286
62 iso_pu_bacteria 2881101125 2881103788 286
63 iso_pu_bacteria 2885198086 2885203033 286
64 iso_pu_bacteria 2885211737 2885216570 286
65 iso_pu_bacteria 2899924645 2899930704 286
66 iso_pu_bacteria 2899924645 2899930814 286
67 iso_pu_bacteria 2904449895 2904449983 286
68 iso_pu_bacteria 2904456579 2904457192 286
69 iso_pu_bacteria 2904541872 2904545326 286
70 iso_pu_bacteria 2919704043 2919707778 286
71 iso_pu_bacteria 2928037797 2928040974 286
72 iso_pu_bacteria 2928044640 2928047816 286
73 iso_pu_bacteria 2928051484 2928055597 286
74 iso_pu_bacteria 2928051484 2928055708 286
75 iso_pu_bacteria 2928064002 2928069694 286
76 iso_pu_bacteria 2928064002 2928069807 286
77 iso_pu_bacteria 2928070936 2928075328 286
78 iso_pu_bacteria 2928084124 2928088510 286
79 iso_pu_bacteria 2929160207 2929165515 286
80 iso_pu_bacteria 2929520902 2929524438 286
81 iso_pu_bacteria 2945909444 2945909812 286
82 iso_pu_bacteria 2945984333 2945988213 286
83 iso_pu_bacteria 641522639 641642190 286
84 3300031456 Ga0307513_10007645 Ga0307513_100076459 287
85 3300005288 Ga0065714_10066731 Ga0065714_100667313 288
86 3300006058 Ga0075432_10018132 Ga0075432_100181321 288
87 3300009011 Ga0105251_10000044 Ga0105251_100000448 288
88 3300009036 Ga0105244_10008568 Ga0105244_100085684 288
89 3300009036 Ga0105244_10014006 Ga0105244_100140063 288
90 3300009092 Ga0105250_10009376 Ga0105250_100093762 288
91 3300009092 Ga0105250_10036987 Ga0105250_100369872 288
92 3300015262 Ga0182007_10006053 Ga0182007_100060534 288
93 3300017792 Ga0163161_10004883 Ga0163161_100048838 288
94 3300025728 Ga0207655_1029780 Ga0207655_10297802 288
95 3300025735 Ga0207713_1000113 Ga0207713_1000113100 288
96 3300027876 Ga0209974_10028423 Ga0209974_100284232 288
97 3300028794 Ga0307515_10351932 Ga0307515_103519321 288
98 3300031507 Ga0307509_10001087 Ga0307509_100010879 288
99 3300031616 Ga0307508_10000155 Ga0307508_1000015510 288
100 3300031616 Ga0307508_10000278 Ga0307508_1000027852 288
101 3300031649 Ga0307514_10009962 Ga0307514_100099625 288
102 3300042004 Ga0439445_0029533 Ga0439445_0029533_484_1398 288
103 3300042115 Ga0450911_000517 Ga0450911_000517_8987_9901 288
104 3300044683 Ga0466965_0013703 Ga0466965_0013703_372_1286 288
105 3300046458 Ga0495591_000625 Ga0495591_000625_5447_6361 288
106 3300046458 Ga0495591_007635 Ga0495591_007635_481_1395 288
107 3300046459 Ga0495629_0000364 Ga0495629_0000364_7089_8003 288
108 3300046459 Ga0495629_0001879 Ga0495629_0001879_15391_16305 288
109 3300046459 Ga0495629_0177567 Ga0495629_0177567_246_1160 288
110 3300046460 Ga0495638_0016669 Ga0495638_0016669_582_1496 288
111 3300046460 Ga0495638_0029396 Ga0495638_0029396_1535_2449 288
112 3300046460 Ga0495638_0092382 Ga0495638_0092382_680_1594 288
113 3300046462 Ga0495651_0001862 Ga0495651_0001862_13919_14833 288
114 3300046463 Ga0495653_0000862 Ga0495653_0000862_15614_16528 288
115 3300046463 Ga0495653_0005814 Ga0495653_0005814_123_1037 288
116 3300046463 Ga0495653_0015833 Ga0495653_0015833_4299_5213 288
117 3300046471 Ga0495650_0002566 Ga0495650_0002566_948_1862 288
118 3300046472 Ga0495580_0004195 Ga0495580_0004195_873_1787 288
119 3300046472 Ga0495580_0025864 Ga0495580_0025864_780_1694 288
120 3300046472 Ga0495580_0040467 Ga0495580_0040467_1885_2799 288
121 3300046474 Ga0495605_0000011 Ga0495605_0000011_72621_73535 288
122 3300046474 Ga0495605_0007142 Ga0495605_0007142_3995_4909 288
123 3300046474 Ga0495605_0057567 Ga0495605_0057567_715_1629 288
124 3300046477 Ga0495664_0011155 Ga0495664_0011155_2731_3645 288
125 3300046477 Ga0495664_0121351 Ga0495664_0121351_536_1450 288
126 3300046500 Ga0495596_0000441 Ga0495596_0000441_10119_11033 288
127 3300046501 Ga0495607_0005658 Ga0495607_0005658_2779_3693 288
128 3300046506 Ga0495583_0000607 Ga0495583_0000607_30277_31191 288
129 3300046507 Ga0495606_0006327 Ga0495606_0006327_2250_3164 288
130 3300046507 Ga0495606_0020375 Ga0495606_0020375_3230_4144 288
131 3300046507 Ga0495606_0073050 Ga0495606_0073050_821_1735 288
132 3300046511 Ga0495608_0003956 Ga0495608_0003956_9659_10573 288
133 3300046512 Ga0495610_0000297 Ga0495610_0000297_34826_35740 288
134 3300046512 Ga0495610_0004665 Ga0495610_0004665_3421_4335 288
135 3300046512 Ga0495610_0009665 Ga0495610_0009665_1957_2871 288
136 3300046514 Ga0495618_0030943 Ga0495618_0030943_1046_1960 288
137 3300046515 Ga0495620_0000161 Ga0495620_0000161_45605_46519 288
138 3300046515 Ga0495620_0012055 Ga0495620_0012055_2106_3020 288
139 3300046516 Ga0495628_0028075 Ga0495628_0028075_3529_4443 288
140 3300046517 Ga0495630_0003450 Ga0495630_0003450_8118_9032 288
141 3300046517 Ga0495630_0011979 Ga0495630_0011979_3769_4683 288
142 3300046517 Ga0495630_0072413 Ga0495630_0072413_501_1415 288
143 3300046519 Ga0495632_0004154 Ga0495632_0004154_185_1099 288
144 3300046520 Ga0495637_0000530 Ga0495637_0000530_5437_6351 288
145 3300046522 Ga0495643_0050916 Ga0495643_0050916_404_1318 288
146 3300046524 Ga0495648_0008198 Ga0495648_0008198_6480_7394 288
147 3300046524 Ga0495648_0012860 Ga0495648_0012860_2770_3684 288
148 3300046524 Ga0495648_0056126 Ga0495648_0056126_580_1494 288
149 3300046524 Ga0495648_0056171 Ga0495648_0056171_767_1681 288
150 3300046529 Ga0495652_0003088 Ga0495652_0003088_3016_3930 288
151 3300046529 Ga0495652_0021478 Ga0495652_0021478_3276_4190 288
152 3300046529 Ga0495652_0095051 Ga0495652_0095051_84_998 288
153 3300046530 Ga0495654_0000517 Ga0495654_0000517_13735_14649 288
154 3300046530 Ga0495654_0004380 Ga0495654_0004380_6614_7528 288
155 3300046530 Ga0495654_0004940 Ga0495654_0004940_1079_2068 288
156 3300046531 Ga0495665_0001965 Ga0495665_0001965_9726_10640 288
157 3300046533 Ga0495640_0002644 Ga0495640_0002644_2355_3269 288
158 3300046535 Ga0495586_0099651 Ga0495586_0099651_606_1520 288
159 3300046536 Ga0495587_0004163 Ga0495587_0004163_8540_9454 288
160 3300046536 Ga0495587_0101541 Ga0495587_0101541_49_963 288
161 3300046542 Ga0495597_0009527 Ga0495597_0009527_2535_3515 288
162 3300046543 Ga0495645_0002406 Ga0495645_0002406_9916_10830 288
163 3300046559 Ga0495667_0061161 Ga0495667_0061161_1046_1960 288
164 3300046642 Ga0495634_0017002 Ga0495634_0017002_134_1048 288
165 3300046660 Ga0495625_0007663 Ga0495625_0007663_2534_3448 288
166 3300046660 Ga0495625_0034520 Ga0495625_0034520_791_1705 288
167 3300046663 Ga0495635_0000939 Ga0495635_0000939_12323_13237 288
168 3300046663 Ga0495635_0006958 Ga0495635_0006958_134_1048 288
169 3300046663 Ga0495635_0326705 Ga0495635_0326705_89_1003 288
170 3300046665 Ga0495661_0007874 Ga0495661_0007874_133_1047 288
171 3300046665 Ga0495661_0124761 Ga0495661_0124761_76_990 288
172 3300046678 Ga0495599_0085894 Ga0495599_0085894_745_1659 288
173 3300046679 Ga0495623_0002074 Ga0495623_0002074_9611_10525 288
174 3300046679 Ga0495623_0003630 Ga0495623_0003630_4821_5735 288
175 3300046680 Ga0495646_0002342 Ga0495646_0002342_10493_11407 288
176 3300046689 Ga0495613_0014696 Ga0495613_0014696_2730_3644 288
177 3300046690 Ga0495624_0011721 Ga0495624_0011721_2017_2931 288
178 3300046690 Ga0495624_0026849 Ga0495624_0026849_288_1202 288
179 3300046691 Ga0495670_0012221 Ga0495670_0012221_2056_2970 288
180 3300046692 Ga0495671_0014598 Ga0495671_0014598_1938_2852 288
181 3300046692 Ga0495671_0023590 Ga0495671_0023590_1607_2521 288
182 3300046694 Ga0495649_0001789 Ga0495649_0001789_13945_14859 288
183 3300046694 Ga0495649_0014453 Ga0495649_0014453_319_1233 288
184 3300046794 Ga0495589_0001856 Ga0495589_0001856_10918_11832 288
185 3300046794 Ga0495589_0019448 Ga0495589_0019448_1370_2284 288
186 3300046794 Ga0495589_0046740 Ga0495589_0046740_548_1462 288
187 3300046809 Ga0495600_0003946 Ga0495600_0003946_7749_8663 288
188 3300046809 Ga0495600_0108461 Ga0495600_0108461_342_1256 288
189 3300046810 Ga0495660_0000172 Ga0495660_0000172_28248_29162 288
190 3300046810 Ga0495660_0009861 Ga0495660_0009861_880_1794 288
191 3300047317 Ga0495604_0001947 Ga0495604_0001947_15266_16180 288
192 3300047317 Ga0495604_0178512 Ga0495604_0178512_272_1186 288
193 3300047318 Ga0495636_0035396 Ga0495636_0035396_435_1349 288
194 3300047319 Ga0495674_0047611 Ga0495674_0047611_774_1688 288
195 3300047319 Ga0495674_0057910 Ga0495674_0057910_2443_3357 288
196 3300047319 Ga0495674_0107751 Ga0495674_0107751_1152_2066 288
197 3300047320 Ga0495672_0005641 Ga0495672_0005641_3557_4471 288
198 3300047320 Ga0495672_0034098 Ga0495672_0034098_871_1785 288
199 3300047320 Ga0495672_0035440 Ga0495672_0035440_1263_2177 288
200 3300047321 Ga0495676_0053599 Ga0495676_0053599_178_1092 288
201 3300047322 Ga0495680_0007073 Ga0495680_0007073_1361_2275 288
202 3300047322 Ga0495680_0041644 Ga0495680_0041644_134_1048 288
203 3300047323 Ga0495683_0000031 Ga0495683_0000031_50842_51756 288
204 3300047323 Ga0495683_0001016 Ga0495683_0001016_2880_3794 288
205 3300047323 Ga0495683_0001244 Ga0495683_0001244_2166_3080 288
206 3300047323 Ga0495683_0065348 Ga0495683_0065348_294_1208 288
207 3300047444 Ga0495675_0002504 Ga0495675_0002504_9207_10121 288
208 3300047446 Ga0495679_000023 Ga0495679_000023_45094_46008 288
209 3300047446 Ga0495679_000074 Ga0495679_000074_30136_31050 288
210 3300047446 Ga0495679_001275 Ga0495679_001275_114_1028 288
211 3300047469 Ga0495673_0057557 Ga0495673_0057557_636_1550 288
212 3300047470 Ga0495681_0000589 Ga0495681_0000589_25668_26582 288
213 3300047470 Ga0495681_0002085 Ga0495681_0002085_6595_7509 288
214 3300047470 Ga0495681_0022827 Ga0495681_0022827_1073_1987 288
215 3300047470 Ga0495681_0028639 Ga0495681_0028639_1029_1943 288
216 3300047673 Ga0495593_0005329 Ga0495593_0005329_647_1561 288
217 3300047673 Ga0495593_0011078 Ga0495593_0011078_1856_2770 288
218 3300047673 Ga0495593_0011489 Ga0495593_0011489_1173_2087 288
219 3300047673 Ga0495593_0019829 Ga0495593_0019829_474_1388 288
220 3300048088 Ga0495602_0000877 Ga0495602_0000877_79_993 288
221 3300048088 Ga0495602_0029722 Ga0495602_0029722_4148_5062 288
222 3300048089 Ga0495614_0000624 Ga0495614_0000624_3600_4514 288
223 3300048091 Ga0495626_0030598 Ga0495626_0030598_76_990 288
224 3300048904 Ga0496101_0043591 Ga0496101_0043591_41_955 288
225 3300048905 Ga0496102_0036988 Ga0496102_0036988_2859_3773 288
226 3300048905 Ga0496102_0127702 Ga0496102_0127702_942_1856 288
227 3300048905 Ga0496102_0587400 Ga0496102_0587400_19_933 288
228 3300048906 Ga0496103_0084906 Ga0496103_0084906_918_1832 288
229 3300048907 Ga0496104_0093870 Ga0496104_0093870_316_1230 288
230 3300048908 Ga0496105_0010008 Ga0496105_0010008_1520_2434 288
231 3300048910 Ga0496107_0192173 Ga0496107_0192173_510_1424 288
232 3300048920 Ga0496117_0008928 Ga0496117_0008928_5885_6799 288
233 3300048920 Ga0496117_0065820 Ga0496117_0065820_659_1573 288
234 3300048921 Ga0496118_0009638 Ga0496118_0009638_2023_2937 288
235 3300048921 Ga0496118_0020728 Ga0496118_0020728_4324_5238 288
236 3300048921 Ga0496118_0021995 Ga0496118_0021995_2673_3587 288
237 3300048922 Ga0496119_0124004 Ga0496119_0124004_483_1397 288
238 3300048924 Ga0496121_0006328 Ga0496121_0006328_7208_8122 288
239 3300048924 Ga0496121_0024301 Ga0496121_0024301_4031_4945 288
240 3300048924 Ga0496121_0070912 Ga0496121_0070912_666_1580 288
241 3300048924 Ga0496121_0161120 Ga0496121_0161120_357_1271 288
242 3300048926 Ga0496123_0123930 Ga0496123_0123930_88_1002 288
243 3300048927 Ga0496124_0021743 Ga0496124_0021743_165_1079 288
244 3300048929 Ga0496126_0032644 Ga0496126_0032644_469_1455 288
245 3300048929 Ga0496126_0179913 Ga0496126_0179913_111_1025 288
246 3300049459 Ga0495678_005793 Ga0495678_005793_3383_4297 288
247 3300049459 Ga0495678_031255 Ga0495678_031255_310_1224 288
248 3300049460 Ga0495682_0009590 Ga0495682_0009590_217_1131 288
249 3300049460 Ga0495682_0012189 Ga0495682_0012189_763_1677 288
250 3300049460 Ga0495682_0030933 Ga0495682_0030933_661_1575 288
251 3300049460 Ga0495682_0075366 Ga0495682_0075366_133_1047 288
252 3300053161 Ga0500634_0065538 Ga0500634_0065538_587_1501 288
253 3300006038 Ga0075365_10000475 Ga0075365_1000047514 289
254 3300009093 Ga0105240_10105838 Ga0105240_101058384 289
255 3300021361 Ga0213872_10059674 Ga0213872_100596741 289
256 3300025273 Ga0209673_1002517 Ga0209673_10025172 289
257 3300025913 Ga0207695_10078337 Ga0207695_100783374 289
258 3300031548 Ga0307408_100007142 Ga0307408_1000071423 289
259 3300031852 Ga0307410_10197783 Ga0307410_101977832 289
260 3300031903 Ga0307407_10113972 Ga0307407_101139722 289
261 3300031911 Ga0307412_10014289 Ga0307412_100142894 289
262 3300032004 Ga0307414_10008504 Ga0307414_100085042 289
263 3300032005 Ga0307411_10031826 Ga0307411_100318262 289
264 3300039447 Ga0436361_1130701 Ga0436361_1130701_1082_1999 289
265 3300046660 Ga0495625_0075078 Ga0495625_0075078_36_980 289
266 3300048924 Ga0496121_0021379 Ga0496121_0021379_2743_3711 289
267 3300050492 nmdc:mga0yw44_646_c1 nmdc:mga0yw44_646_c1_188_1201 289
268 3300001979 JGI24740J21852_10010609 JGI24740J21852_100106094 290
269 3300002773 JGI25152J39213_1002509 JGI25152J39213_10025094 290
270 3300002774 JGI25150J39212_1001450 JGI25150J39212_10014503 290
271 3300002987 JGI25159J45721_1008409 JGI25159J45721_10084093 290
272 3300002987 JGI25159J45721_1013293 JGI25159J45721_10132932 290
273 3300003187 JGI25151J46595_10000748 JGI25151J46595_100007482 290
274 3300003761 Ga0055535_1000422 Ga0055535_10004225 290
275 3300003762 Ga0055542_1000074 Ga0055542_100007468 290
276 3300003773 Ga0055537_1000769 Ga0055537_10007692 290
277 3300003773 Ga0055537_1001115 Ga0055537_100111511 290
278 3300003781 Ga0055536_1003824 Ga0055536_10038245 290
279 3300003781 Ga0055536_1010095 Ga0055536_10100952 290
280 3300003784 Ga0055534_1003902 Ga0055534_10039022 290
281 3300003790 Ga0055528_1001962 Ga0055528_100196211 290
282 3300003790 Ga0055528_1003567 Ga0055528_10035679 290
283 3300003791 Ga0055530_10000860 Ga0055530_1000086011 290
284 3300003791 Ga0055530_10005096 Ga0055530_100050964 290
285 3300003792 Ga0055540_1001520 Ga0055540_10015205 290
286 3300003792 Ga0055540_1002037 Ga0055540_10020375 290
287 3300003792 Ga0055540_1003472 Ga0055540_10034721 290
288 3300003794 Ga0055531_10000941 Ga0055531_1000094118 290
289 3300003794 Ga0055531_10001221 Ga0055531_100012218 290
290 3300003794 Ga0055531_10002104 Ga0055531_1000210411 290
291 3300003794 Ga0055531_10006372 Ga0055531_100063724 290
292 3300004625 Ga0055543_1001117 Ga0055543_10011178 290
293 3300005262 Ga0065165_1003053 Ga0065165_100305311 290
294 3300005262 Ga0065165_1009839 Ga0065165_10098392 290
295 3300005328 Ga0070676_10003210 Ga0070676_100032109 290
296 3300005331 Ga0070670_100076493 Ga0070670_1000764932 290
297 3300005338 Ga0068868_100099710 Ga0068868_1000997101 290
298 3300005354 Ga0070675_100007910 Ga0070675_1000079104 290
299 3300005355 Ga0070671_100071631 Ga0070671_1000716313 290
300 3300005364 Ga0070673_100025508 Ga0070673_1000255082 290
301 3300005366 Ga0070659_100033731 Ga0070659_1000337313 290
302 3300005366 Ga0070659_100064296 Ga0070659_1000642962 290
303 3300005455 Ga0070663_100206474 Ga0070663_1002064742 290
304 3300005456 Ga0070678_100022140 Ga0070678_1000221403 290
305 3300005459 Ga0068867_100001085 Ga0068867_10000108512 290
306 3300005539 Ga0068853_100002357 Ga0068853_1000023571 290
307 3300005539 Ga0068853_100193237 Ga0068853_1001932371 290
308 3300005543 Ga0070672_100001313 Ga0070672_10000131311 290
309 3300005563 Ga0068855_100108408 Ga0068855_1001084083 290
310 3300005564 Ga0070664_100122172 Ga0070664_1001221722 290
311 3300005564 Ga0070664_100129733 Ga0070664_1001297333 290
312 3300005577 Ga0068857_100105824 Ga0068857_1001058243 290
313 3300005578 Ga0068854_100247983 Ga0068854_1002479832 290
314 3300005616 Ga0068852_100045747 Ga0068852_1000457474 290
315 3300005834 Ga0068851_10004140 Ga0068851_100041404 290
316 3300005834 Ga0068851_10009751 Ga0068851_100097514 290
317 3300005840 Ga0068870_10023339 Ga0068870_100233393 290
318 3300005844 Ga0068862_100022808 Ga0068862_1000228084 290
319 3300006038 Ga0075365_10001106 Ga0075365_1000110611 290
320 3300006038 Ga0075365_10068915 Ga0075365_100689152 290
321 3300006048 Ga0075363_100056622 Ga0075363_1000566222 290
322 3300006058 Ga0075432_10037719 Ga0075432_100377191 290
323 3300006177 Ga0075362_10022570 Ga0075362_100225703 290
324 3300006178 Ga0075367_10097831 Ga0075367_100978312 290
325 3300006195 Ga0075366_10024357 Ga0075366_100243572 290
326 3300006237 Ga0097621_100209974 Ga0097621_1002099742 290
327 3300006353 Ga0075370_10008143 Ga0075370_100081435 290
328 3300006353 Ga0075370_10064162 Ga0075370_100641622 290
329 3300006358 Ga0068871_100103223 Ga0068871_1001032232 290
330 3300009036 Ga0105244_10005708 Ga0105244_100057085 290
331 3300009036 Ga0105244_10095277 Ga0105244_100952771 290
332 3300009093 Ga0105240_10076623 Ga0105240_100766234 290
333 3300009098 Ga0105245_10153704 Ga0105245_101537042 290
334 3300009098 Ga0105245_10200274 Ga0105245_102002742 290
335 3300009148 Ga0105243_10002680 Ga0105243_1000268011 290
336 3300009148 Ga0105243_10404212 Ga0105243_104042122 290
337 3300009174 Ga0105241_10101770 Ga0105241_101017702 290
338 3300009176 Ga0105242_10396528 Ga0105242_103965282 290
339 3300009545 Ga0105237_10116320 Ga0105237_101163203 290
340 3300009545 Ga0105237_10172918 Ga0105237_101729183 290
341 3300011119 Ga0105246_10008048 Ga0105246_100080484 290
342 3300011119 Ga0105246_10090628 Ga0105246_100906282 290
343 3300013102 Ga0157371_10013731 Ga0157371_100137311 290
344 3300013104 Ga0157370_10007277 Ga0157370_1000727711 290
345 3300013105 Ga0157369_10004076 Ga0157369_100040768 290
346 3300013306 Ga0163162_10392457 Ga0163162_103924572 290
347 3300013307 Ga0157372_10014374 Ga0157372_100143747 290
348 3300013308 Ga0157375_10219159 Ga0157375_102191594 290
349 3300014497 Ga0182008_10000038 Ga0182008_1000003891 290
350 3300014497 Ga0182008_10008156 Ga0182008_100081563 290
351 3300014497 Ga0182008_10009725 Ga0182008_100097255 290
352 3300014969 Ga0157376_10356535 Ga0157376_103565352 290
353 3300015261 Ga0182006_1000779 Ga0182006_100077916 290
354 3300015261 Ga0182006_1053835 Ga0182006_10538352 290
355 3300015262 Ga0182007_10000246 Ga0182007_1000024625 290
356 3300015265 Ga0182005_1041329 Ga0182005_10413291 290
357 3300017792 Ga0163161_10000521 Ga0163161_1000052134 290
358 3300025228 Ga0209672_102024 Ga0209672_1020246 290
359 3300025229 Ga0209147_100419 Ga0209147_10041925 290
360 3300025242 Ga0209258_100176 Ga0209258_10017673 290
361 3300025245 Ga0207425_1000133 Ga0207425_100013311 290
362 3300025254 Ga0209148_1000033 Ga0209148_1000033204 290
363 3300025258 Ga0209129_1000186 Ga0209129_100018674 290
364 3300025258 Ga0209129_1000700 Ga0209129_100070017 290
365 3300025263 Ga0209565_1000190 Ga0209565_100019065 290
366 3300025273 Ga0209673_1000209 Ga0209673_100020968 290
367 3300025273 Ga0209673_1000393 Ga0209673_100039365 290
368 3300025273 Ga0209673_1053782 Ga0209673_10537821 290
369 3300025284 Ga0209130_1000335 Ga0209130_100033520 290
370 3300025284 Ga0209130_1000433 Ga0209130_100043311 290
371 3300025291 Ga0209675_1000300 Ga0209675_100030039 290
372 3300025291 Ga0209675_1000330 Ga0209675_100033020 290
373 3300025291 Ga0209675_1008403 Ga0209675_10084035 290
374 3300025292 Ga0209676_1000048 Ga0209676_1000048120 290
375 3300025292 Ga0209676_1000618 Ga0209676_100061824 290
376 3300025292 Ga0209676_1002336 Ga0209676_10023365 290
377 3300025292 Ga0209676_1008753 Ga0209676_10087534 290
378 3300025294 Ga0209025_1000324 Ga0209025_100032477 290
379 3300025294 Ga0209025_1000947 Ga0209025_100094738 290
380 3300025294 Ga0209025_1058059 Ga0209025_10580592 290
381 3300025295 Ga0209564_1000417 Ga0209564_100041711 290
382 3300025295 Ga0209564_1000423 Ga0209564_100042348 290
383 3300025297 Ga0209758_1000092 Ga0209758_1000092222 290
384 3300025297 Ga0209758_1002789 Ga0209758_100278916 290
385 3300025298 Ga0209050_1000012 Ga0209050_1000012120 290
386 3300025298 Ga0209050_1002843 Ga0209050_10028435 290
387 3300025298 Ga0209050_1010544 Ga0209050_10105444 290
388 3300025299 Ga0209256_1000094 Ga0209256_1000094192 290
389 3300025299 Ga0209256_1000095 Ga0209256_1000095167 290
390 3300025302 Ga0207426_1000084 Ga0207426_100008411 290
391 3300025302 Ga0207426_1000161 Ga0207426_100016152 290
392 3300025303 Ga0209051_1000019 Ga0209051_100001939 290
393 3300025303 Ga0209051_1000207 Ga0209051_100020766 290
394 3300025303 Ga0209051_1000456 Ga0209051_100045661 290
395 3300025303 Ga0209051_1005182 Ga0209051_10051827 290
396 3300025304 Ga0209257_1000015 Ga0209257_1000015779 290
397 3300025304 Ga0209257_1000024 Ga0209257_100002466 290
398 3300025304 Ga0209257_1000258 Ga0209257_100025812 290
399 3300025304 Ga0209257_1002906 Ga0209257_10029067 290
400 3300025321 Ga0207656_10002163 Ga0207656_100021634 290
401 3300025728 Ga0207655_1000845 Ga0207655_100084523 290
402 3300025728 Ga0207655_1001510 Ga0207655_10015103 290
403 3300025904 Ga0207647_10037287 Ga0207647_100372872 290
404 3300025904 Ga0207647_10086263 Ga0207647_100862633 290
405 3300025907 Ga0207645_10008543 Ga0207645_100085433 290
406 3300025908 Ga0207643_10036671 Ga0207643_100366713 290
407 3300025909 Ga0207705_10263901 Ga0207705_102639012 290
408 3300025913 Ga0207695_10104095 Ga0207695_101040952 290
409 3300025913 Ga0207695_10196979 Ga0207695_101969792 290
410 3300025919 Ga0207657_10113380 Ga0207657_101133802 290
411 3300025924 Ga0207694_10049719 Ga0207694_100497193 290
412 3300025925 Ga0207650_10341764 Ga0207650_103417642 290
413 3300025926 Ga0207659_10099786 Ga0207659_100997864 290
414 3300025927 Ga0207687_10037687 Ga0207687_100376874 290
415 3300025931 Ga0207644_10043195 Ga0207644_100431952 290
416 3300025932 Ga0207690_10036876 Ga0207690_100368763 290
417 3300025933 Ga0207706_10002677 Ga0207706_1000267712 290
418 3300025935 Ga0207709_10000669 Ga0207709_1000066925 290
419 3300025935 Ga0207709_10004163 Ga0207709_100041636 290
420 3300025940 Ga0207691_10015569 Ga0207691_100155695 290
421 3300025945 Ga0207679_10074384 Ga0207679_100743842 290
422 3300025945 Ga0207679_10145466 Ga0207679_101454662 290
423 3300025949 Ga0207667_10035396 Ga0207667_100353962 290
424 3300025949 Ga0207667_10052383 Ga0207667_100523834 290
425 3300025949 Ga0207667_10100144 Ga0207667_101001441 290
426 3300025960 Ga0207651_10038120 Ga0207651_100381204 290
427 3300025986 Ga0207658_10010616 Ga0207658_100106163 290
428 3300026023 Ga0207677_10010160 Ga0207677_100101604 290
429 3300026041 Ga0207639_10006236 Ga0207639_100062361 290
430 3300026041 Ga0207639_10008790 Ga0207639_100087904 290
431 3300026041 Ga0207639_10208950 Ga0207639_102089502 290
432 3300026067 Ga0207678_10124960 Ga0207678_101249602 290
433 3300026067 Ga0207678_10236285 Ga0207678_102362852 290
434 3300026078 Ga0207702_10204558 Ga0207702_102045581 290
435 3300026089 Ga0207648_10002091 Ga0207648_100020915 290
436 3300026116 Ga0207674_10015495 Ga0207674_100154954 290
437 3300026116 Ga0207674_10071378 Ga0207674_100713782 290
438 3300026121 Ga0207683_10036799 Ga0207683_100367994 290
439 3300027866 Ga0209813_10083236 Ga0209813_100832361 290
440 3300028380 Ga0268265_10024312 Ga0268265_100243122 290
441 3300028794 Ga0307515_10000195 Ga0307515_1000019542 290
442 3300031456 Ga0307513_10000104 Ga0307513_1000010464 290
443 3300031456 Ga0307513_10140448 Ga0307513_101404482 290
444 3300031548 Ga0307408_100002368 Ga0307408_1000023688 290
445 3300031548 Ga0307408_100004935 Ga0307408_1000049357 290
446 3300031548 Ga0307408_100230941 Ga0307408_1002309412 290
447 3300031649 Ga0307514_10001288 Ga0307514_1000128813 290
448 3300031731 Ga0307405_10090622 Ga0307405_100906222 290
449 3300031901 Ga0307406_10006354 Ga0307406_100063547 290
450 3300031911 Ga0307412_10028388 Ga0307412_100283884 290
451 3300031911 Ga0307412_10050360 Ga0307412_100503602 290
452 3300031911 Ga0307412_10056914 Ga0307412_100569143 290
453 3300032002 Ga0307416_100005714 Ga0307416_1000057146 290
454 3300032002 Ga0307416_100058233 Ga0307416_1000582333 290
455 3300032002 Ga0307416_100502277 Ga0307416_1005022772 290
456 3300032005 Ga0307411_10000361 Ga0307411_1000036114 290
457 3300037418 Ga0395900_0014904 Ga0395900_0014904_4864_5829 290
458 3300041404 Ga0439436_0000374 Ga0439436_0000374_1417_2337 290
459 3300041406 Ga0439439_0000021 Ga0439439_0000021_18082_19002 290
460 3300041407 Ga0439447_005582 Ga0439447_005582_1267_2187 290
461 3300041407 Ga0439447_015870 Ga0439447_015870_342_1313 290
462 3300041410 Ga0439461_0005344 Ga0439461_0005344_648_1568 290
463 3300041411 Ga0439466_0046632 Ga0439466_0046632_93_1064 290
464 3300041999 Ga0439433_0049989 Ga0439433_0049989_34_954 290
465 3300042001 Ga0439441_032416 Ga0439441_032416_67_993 290
466 3300042002 Ga0439442_009025 Ga0439442_009025_956_1876 290
467 3300042002 Ga0439442_012341 Ga0439442_012341_87_1007 290
468 3300042004 Ga0439445_0020918 Ga0439445_0020918_284_1213 290
469 3300042006 Ga0439432_002487 Ga0439432_002487_4109_5029 290
470 3300042007 Ga0439449_0000003 Ga0439449_0000003_37235_38155 290
471 3300042010 Ga0439452_001327 Ga0439452_001327_8460_9380 290
472 3300042010 Ga0439452_029495 Ga0439452_029495_311_1282 290
473 3300042015 Ga0439462_0000090 Ga0439462_0000090_12666_13586 290
474 3300042015 Ga0439462_0001359 Ga0439462_0001359_3405_4376 290
475 3300042134 Ga0450898_010326 Ga0450898_010326_429_1400 290
476 3300042145 Ga0450906_004482 Ga0450906_004482_1572_2492 290
477 3300042156 Ga0439446_0000737 Ga0439446_0000737_4193_5113 290
478 3300042156 Ga0439446_0031357 Ga0439446_0031357_99_1070 290
479 3300042156 Ga0439446_0041666 Ga0439446_0041666_65_1033 290
480 3300042184 Ga0450908_000504 Ga0450908_000504_3225_4145 290
481 3300042184 Ga0450908_009529 Ga0450908_009529_253_1173 290
482 3300042185 Ga0450909_007353 Ga0450909_007353_330_1250 290
483 3300042435 Ga0439434_0001484 Ga0439434_0001484_1176_2096 290
484 3300042435 Ga0439434_0044535 Ga0439434_0044535_281_1201 290
485 3300042439 Ga0439464_0001746 Ga0439464_0001746_1658_2632 290
486 3300042531 Ga0450918_000094 Ga0450918_000094_14770_15690 290
487 3300042532 Ga0450893_0002044 Ga0450893_0002044_2113_3042 290
488 3300044842 Ga0466957_0135931 Ga0466957_0135931_216_1148 290
489 3300045051 Ga0451576_0016907 Ga0451576_0016907_3153_4124 290
490 3300046453 Ga0495627_007646 Ga0495627_007646_2705_3634 290
491 3300046455 Ga0495603_0035087 Ga0495603_0035087_1583_2515 290
492 3300046458 Ga0495591_016741 Ga0495591_016741_695_1627 290
493 3300046459 Ga0495629_0031162 Ga0495629_0031162_1878_2810 290
494 3300046463 Ga0495653_0006242 Ga0495653_0006242_947_1879 290
495 3300046477 Ga0495664_0038433 Ga0495664_0038433_585_1517 290
496 3300046512 Ga0495610_0010907 Ga0495610_0010907_4590_5519 290
497 3300046513 Ga0495616_0001476 Ga0495616_0001476_2931_3860 290
498 3300046514 Ga0495618_0048672 Ga0495618_0048672_1359_2291 290
499 3300046515 Ga0495620_0008945 Ga0495620_0008945_3259_4188 290
500 3300046516 Ga0495628_0000464 Ga0495628_0000464_30522_31454 290
501 3300046518 Ga0495631_0000537 Ga0495631_0000537_4664_5593 290
502 3300046520 Ga0495637_0011274 Ga0495637_0011274_255_1184 290
503 3300046520 Ga0495637_0015098 Ga0495637_0015098_1541_2470 290
504 3300046524 Ga0495648_0007865 Ga0495648_0007865_7050_7982 290
505 3300046529 Ga0495652_0001163 Ga0495652_0001163_28445_29377 290
506 3300046531 Ga0495665_0000748 Ga0495665_0000748_12633_13565 290
507 3300046533 Ga0495640_0007938 Ga0495640_0007938_1683_2615 290
508 3300046536 Ga0495587_0055283 Ga0495587_0055283_1098_2030 290
509 3300046539 Ga0495621_0004093 Ga0495621_0004093_3102_4031 290
510 3300046616 Ga0495668_0046831 Ga0495668_0046831_273_1202 290
511 3300046642 Ga0495634_0002384 Ga0495634_0002384_964_1896 290
512 3300046660 Ga0495625_0169177 Ga0495625_0169177_332_1261 290
513 3300046663 Ga0495635_0032777 Ga0495635_0032777_1680_2612 290
514 3300046665 Ga0495661_0031139 Ga0495661_0031139_946_1878 290
515 3300046674 Ga0495588_0026532 Ga0495588_0026532_1646_2575 290
516 3300046674 Ga0495588_0030883 Ga0495588_0030883_1625_2554 290
517 3300046680 Ga0495646_0000186 Ga0495646_0000186_29029_29961 290
518 3300046689 Ga0495613_0003595 Ga0495613_0003595_976_1908 290
519 3300046690 Ga0495624_0005675 Ga0495624_0005675_976_1908 290
520 3300046692 Ga0495671_0001625 Ga0495671_0001625_814_1743 290
521 3300046794 Ga0495589_0020564 Ga0495589_0020564_780_1712 290
522 3300046809 Ga0495600_0035481 Ga0495600_0035481_1664_2596 290
523 3300047315 Ga0495581_0041478 Ga0495581_0041478_652_1584 290
524 3300047317 Ga0495604_0002252 Ga0495604_0002252_962_1894 290
525 3300047319 Ga0495674_0003301 Ga0495674_0003301_13766_14698 290
526 3300047321 Ga0495676_0064159 Ga0495676_0064159_340_1272 290
527 3300047321 Ga0495676_0084129 Ga0495676_0084129_191_1120 290
528 3300047322 Ga0495680_0023370 Ga0495680_0023370_855_1787 290
529 3300047444 Ga0495675_0008463 Ga0495675_0008463_76_1008 290
530 3300047446 Ga0495679_000266 Ga0495679_000266_30536_31468 290
531 3300047673 Ga0495593_0000185 Ga0495593_0000185_940_1872 290
532 3300048088 Ga0495602_0028667 Ga0495602_0028667_3910_4842 290
533 3300048904 Ga0496101_0020189 Ga0496101_0020189_705_1634 290
534 3300048919 Ga0496116_0024653 Ga0496116_0024653_1168_2097 290
535 3300048919 Ga0496116_0025679 Ga0496116_0025679_908_1828 290
536 3300048919 Ga0496116_0029801 Ga0496116_0029801_155_1075 290
537 3300048920 Ga0496117_0003636 Ga0496117_0003636_11460_12380 290
538 3300048920 Ga0496117_0015076 Ga0496117_0015076_808_1728 290
539 3300048920 Ga0496117_0035699 Ga0496117_0035699_2671_3600 290
540 3300048920 Ga0496117_0055678 Ga0496117_0055678_590_1519 290
541 3300048921 Ga0496118_0011360 Ga0496118_0011360_2081_3001 290
542 3300048921 Ga0496118_0012669 Ga0496118_0012669_3989_4918 290
543 3300048923 Ga0496120_0089793 Ga0496120_0089793_498_1427 290
544 3300048924 Ga0496121_0176107 Ga0496121_0176107_475_1395 290
545 3300048926 Ga0496123_0012263 Ga0496123_0012263_1632_2690 290
546 3300048926 Ga0496123_0147506 Ga0496123_0147506_219_1139 290
547 3300048927 Ga0496124_0246483 Ga0496124_0246483_87_1046 290
548 3300048928 Ga0496125_0001750 Ga0496125_0001750_17732_18652 290
549 3300048928 Ga0496125_0006979 Ga0496125_0006979_3149_4069 290
550 3300048928 Ga0496125_0105691 Ga0496125_0105691_44_976 290
551 3300048929 Ga0496126_0105825 Ga0496126_0105825_696_1625 290
552 3300048929 Ga0496126_0205691 Ga0496126_0205691_189_1109 290
553 3300050489 nmdc:mga03683_6612_c1 nmdc:mga03683_6612_c1_74_1045 290
554 3300050492 nmdc:mga0yw44_2563_c1 nmdc:mga0yw44_2563_c1_4353_5282 290
555 3300050493 nmdc:mga0k408_98608_c1 nmdc:mga0k408_98608_c1_451_1395 290
556 3300050495 nmdc:mga04h51_98636_c1 nmdc:mga04h51_98636_c1_15_944 290
557 3300050496 nmdc:mga07m45_11607_c1 nmdc:mga07m45_11607_c1_1343_2272 290
558 3300053087 Ga0500643_002217 Ga0500643_002217_4518_5447 290
559 3300053093 Ga0500651_0000594 Ga0500651_0000594_12591_13520 290
560 3300053108 Ga0500562_007363 Ga0500562_007363_1489_2418 290
561 3300053110 Ga0500571_000166 Ga0500571_000166_19711_20640 290
562 3300053117 Ga0500593_000082 Ga0500593_000082_10987_11916 290
563 3300053118 Ga0500594_0004485 Ga0500594_0004485_714_1643 290
564 3300053121 Ga0500607_000440 Ga0500607_000440_22232_23161 290
565 3300053121 Ga0500607_009571 Ga0500607_009571_3350_4279 290
566 3300053122 Ga0500608_011039 Ga0500608_011039_2217_3137 290
567 3300053122 Ga0500608_012939 Ga0500608_012939_2180_3109 290
568 3300053133 Ga0500655_000044 Ga0500655_000044_4815_5744 290
569 3300053134 Ga0500658_0000117 Ga0500658_0000117_26984_27913 290
570 3300053134 Ga0500658_0000582 Ga0500658_0000582_9834_10763 290
571 3300053136 Ga0500559_0029644 Ga0500559_0029644_560_1489 290
572 3300053138 Ga0500564_004195 Ga0500564_004195_943_1872 290
573 3300053139 Ga0500568_0006092 Ga0500568_0006092_2440_3369 290
574 3300053141 Ga0500574_001907 Ga0500574_001907_163_1092 290
575 3300053153 Ga0500616_0075040 Ga0500616_0075040_725_1654 290
576 3300053158 Ga0500627_0034519 Ga0500627_0034519_333_1262 290
577 3300053161 Ga0500634_0009122 Ga0500634_0009122_1304_2233 290
578 3300053162 Ga0500638_004205 Ga0500638_004205_82_1011 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

32

91

0.97

PF03466

LysR_substrate

LysR substrate binding domain

116

322

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhf-assembly1.cif.gz_A structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.904 74 277
3hhf-assembly1.cif.gz_B structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.8982 74 277
3hhf-assembly1.cif.gz_A structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.8956 74 277
3hhf-assembly1.cif.gz_B structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.8898 74 277
7trw-assembly1.cif.gz_A-2 crystal structure of the c-terminal ligand-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.884 74 281
ID Description Score Start End Superfamily
af_P76369_5_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9168 24 67 1.10.10.10
af_P37641_88_293_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9161 75 275 3.40.190.290
5mmhB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9015 76 143 3.40.190.10
af_P76250_91_296_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8958 74 277 3.40.190.290
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8917 4 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5F0LPX3-F1-model_v4 LysR family transcriptional regulator 0.9415 146 278
AF-A0A1G8S0J2-F1-model_v4 LysR substrate binding domain-containing protein 0.9382 74 287 GO:0003700
GO:0006351
GO:0043565
AF-U6ZXM9-F1-model_v4 deleted 0.9379 106 277
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.9372 93 285 GO:0003700
GO:0006351
GO:0043565
AF-A0A7Z2VCT1-F1-model_v4 LysR family transcriptional regulator 0.931 161 276 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
86.77 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map