F465723

General Info

Members Datasets Scaffolds Average Seq Length
578 381 492 303

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10250765|Ga0105238_102507652
Length 352
Sequence MGPNCGLILRDAAGAAPQDEGFADNKRNDPMKAYVYGANGAAITDVPKPAPKGTQVLVKVHACGLNRADLGMTKGHAHGAAGGVGTVLGMEWAGEVAELGPDAKGVKVGDKIMGSGGSAFAEYTLADHGRLFRAPSNMNFDEAATLPVALATMHNAVVTNGALQPGQSVMIQGASSGVGLMAMQIAKLKGAKLVVGSSTDPYRRGRLKEFGADLAVDSSDPGWVDEVLKATNGEGVDLIVDQVSGKVMNQNLAATKIKGRIVNVGRLGGTRAEFNFDLHAARRISYIGVTFRTRSIEEVREIFDEVRRDIWGAVESRKLQLPIDKVYKFEDIGKAFEHMEANKHLGKIVVTL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
12 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
16 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
27 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
28 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
29 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
30 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
31 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
32 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
33 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
34 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
35 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
36 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
37 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
38 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
39 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
40 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
41 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
42 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
43 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
44 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
45 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
46 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
47 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
48 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
49 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
50 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
51 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
52 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
53 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
54 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
55 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
56 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
57 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
58 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
59 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
60 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
61 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
62 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
63 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
64 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
65 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
66 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
67 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
68 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
69 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
70 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
71 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
72 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
79 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
127 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
195 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
196 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
203 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
343 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
344 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
345 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
346 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
347 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
350 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
351 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
352 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
353 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
358 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
361 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
362 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
363 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
364 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
367 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
371 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
372 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
373 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
374 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
375 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
376 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
377 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
378 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
379 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
380 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
381 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.57
Metatranscriptomes 0
Isolates 14.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 10.55
Rhizoplane 6.06
Rhizosphere 58.82
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000021 3300003203 Bacteria 84514
2 JGI25406J46586_10016723 3300003203 Bacteria 3051
3 JGI25160J50197_1006462 3300003354 Bacteria 4742
4 JGI25404J52841_10023995 3300003659 Bacteria 1315
5 Ga0065165_1001283 3300005262 Bacteria 28362
6 Ga0070658_10443915 3300005327 Bacteria 1117
7 Ga0070683_100020392 3300005329 Bacteria 5899
8 Ga0070683_100091955 3300005329 Bacteria 2849
9 Ga0070683_100142442 3300005329 Bacteria 2271
10 Ga0070680_100062296 3300005336 Bacteria 3054
11 Ga0070680_100066425 3300005336 Bacteria 2957
12 Ga0070680_100106009 3300005336 Bacteria 2337
13 Ga0070682_100018684 3300005337 Bacteria 4056
14 Ga0070660_100016099 3300005339 Bacteria 5420
15 Ga0070660_100188978 3300005339 Bacteria 1668
16 Ga0070674_100052465 3300005356 Bacteria 2813
17 Ga0070709_10017401 3300005434 Bacteria 4122
18 Ga0070714_100008845 3300005435 Bacteria 7876
19 Ga0070714_100011360 3300005435 Bacteria 7065
20 Ga0070714_100088105 3300005435 Bacteria 2715
21 Ga0070714_100219322 3300005435 Bacteria 1747
22 Ga0070713_100003607 3300005436 Bacteria 10231
23 Ga0070713_100007249 3300005436 Bacteria 7765
24 Ga0070713_100112787 3300005436 Bacteria 2373
25 Ga0070713_100121064 3300005436 Bacteria 2295
26 Ga0070710_10000708 3300005437 Bacteria 15866
27 Ga0070710_10003983 3300005437 Bacteria 7002
28 Ga0070710_10007420 3300005437 Bacteria 5310
29 Ga0070711_100010293 3300005439 Bacteria 5784
30 Ga0070711_100067656 3300005439 Bacteria 2507
31 Ga0070711_100070979 3300005439 Bacteria 2453
32 Ga0070708_100092186 3300005445 Bacteria 2760
33 Ga0070663_100053860 3300005455 Bacteria 2873
34 Ga0070663_100253703 3300005455 Bacteria 1393
35 Ga0070678_100179583 3300005456 Bacteria 1731
36 Ga0070681_10145484 3300005458 Bacteria 2299
37 Ga0068867_100026289 3300005459 Bacteria 4179
38 Ga0070706_100060174 3300005467 Bacteria 3506
39 Ga0070707_100106031 3300005468 Bacteria 2725
40 Ga0070698_100163268 3300005471 Bacteria 2171
41 Ga0070679_100043461 3300005530 Bacteria 4476
42 Ga0070679_100055274 3300005530 Bacteria 3953
43 Ga0070679_100222919 3300005530 Bacteria 1846
44 Ga0070679_100379164 3300005530 Bacteria 1361
45 Ga0070684_100011602 3300005535 Bacteria 7022
46 Ga0068853_100055695 3300005539 Bacteria 3408
47 Ga0068853_100227659 3300005539 Bacteria 1705
48 Ga0070665_100386310 3300005548 Bacteria 1407
49 Ga0068855_100109884 3300005563 Bacteria 3165
50 Ga0068855_100125665 3300005563 Bacteria 2933
51 Ga0068855_100259195 3300005563 Bacteria 1938
52 Ga0068855_100357908 3300005563 Bacteria 1606
53 Ga0068854_100156385 3300005578 Bacteria 1762
54 Ga0068856_100023694 3300005614 Bacteria 5969
55 Ga0068852_100109398 3300005616 Bacteria 2510
56 Ga0068864_100352679 3300005618 Bacteria 1388
57 Ga0068866_10053236 3300005718 Bacteria 2069
58 Ga0068861_100252161 3300005719 Bacteria 1506
59 Ga0068851_10017694 3300005834 Bacteria 3427
60 Ga0068863_100281933 3300005841 Bacteria 1610
61 Ga0068858_100160769 3300005842 Bacteria 2115
62 Ga0068858_100242536 3300005842 Bacteria 1710
63 Ga0068860_100000471 3300005843 Bacteria 50128
64 Ga0068862_100058558 3300005844 Bacteria 3304
65 Ga0081455_10069621 3300005937 Bacteria 2925
66 Ga0081455_10119730 3300005937 Bacteria 2076
67 Ga0081455_10160945 3300005937 Bacteria 1721
68 Ga0081540_1004707 3300005983 Bacteria 10325
69 Ga0081540_1005778 3300005983 Bacteria 9157
70 Ga0081540_1016036 3300005983 Bacteria 4715
71 Ga0081540_1023016 3300005983 Bacteria 3661
72 Ga0081540_1089534 3300005983 Bacteria 1357
73 Ga0081539_10000051 3300005985 Bacteria 268337
74 Ga0081539_10000148 3300005985 Bacteria 163442
75 Ga0081539_10009620 3300005985 Bacteria 8026
76 Ga0081539_10027637 3300005985 Bacteria 3588
77 Ga0070717_10000402 3300006028 Bacteria 27731
78 Ga0070717_10077668 3300006028 Bacteria 2781
79 Ga0075365_10089588 3300006038 Bacteria 2094
80 Ga0075363_100063425 3300006048 Bacteria 1994
81 Ga0075363_100139562 3300006048 Bacteria 1364
82 Ga0075364_10045080 3300006051 Bacteria 2870
83 Ga0070715_10045714 3300006163 Bacteria 1858
84 Ga0070716_100006048 3300006173 Bacteria 5897
85 Ga0070716_100101461 3300006173 Bacteria 1765
86 Ga0070716_100112940 3300006173 Bacteria 1687
87 Ga0070712_100008186 3300006175 Bacteria 6567
88 Ga0070712_100037180 3300006175 Bacteria 3317
89 Ga0075362_10078256 3300006177 Bacteria 1521
90 Ga0075367_10057509 3300006178 Bacteria 2312
91 Ga0075369_10024782 3300006186 Bacteria 2489
92 Ga0075370_10032834 3300006353 Bacteria 2903
93 Ga0075434_100024593 3300006871 Bacteria 5889
94 Ga0075434_100122913 3300006871 Bacteria 2612
95 Ga0099824_1031084 3300006942 Bacteria 2066
96 Ga0099822_1001873 3300006943 Bacteria 25386
97 Ga0075435_100021468 3300007076 Bacteria 4967
98 Ga0099794_10125561 3300007265 Bacteria 1294
99 Ga0105240_10177078 3300009093 Bacteria 2521
100 Ga0105240_10436842 3300009093 Bacteria 1467
101 Ga0105247_10005426 3300009101 Bacteria 8033
102 Ga0105241_10508225 3300009174 Bacteria 1076
103 Ga0105248_10101265 3300009177 Bacteria 3247
104 Ga0105237_10056507 3300009545 Bacteria 3929
105 Ga0105237_10136799 3300009545 Bacteria 2444
106 Ga0105238_10024830 3300009551 Bacteria 6108
107 Ga0105238_10250583 3300009551 Bacteria 1749
108 Ga0105238_10250765 3300009551 Bacteria 1748
109 Ga0105239_10043806 3300010375 Bacteria 4907
110 Ga0157335_1000871 3300012492 Bacteria 1514
111 Ga0157370_10043441 3300013104 Bacteria 4325
112 Ga0157370_10148417 3300013104 Bacteria 2183
113 Ga0157369_10011746 3300013105 Bacteria 9942
114 Ga0157369_10024696 3300013105 Bacteria 6679
115 Ga0157369_10466917 3300013105 Bacteria 1307
116 Ga0157374_10034436 3300013296 Bacteria 4626
117 Ga0157374_10100276 3300013296 Bacteria 2776
118 Ga0157378_10025057 3300013297 Bacteria 5255
119 Ga0163162_10417115 3300013306 Bacteria 1475
120 Ga0157372_10428630 3300013307 Bacteria 1541
121 Ga0157375_10164872 3300013308 Bacteria 2360
122 Ga0163163_10581492 3300014325 Bacteria 1183
123 Ga0213876_10000670 3300021384 Bacteria 24379
124 Ga0209233_1020676 3300025261 Bacteria 1719
125 Ga0209564_1000390 3300025295 Bacteria 78822
126 Ga0209758_1003610 3300025297 Bacteria 13850
127 Ga0209758_1004758 3300025297 Bacteria 11016
128 Ga0209758_1007379 3300025297 Bacteria 7515
129 Ga0209758_1008034 3300025297 Bacteria 6970
130 Ga0209758_1014022 3300025297 Bacteria 4308
131 Ga0209758_1038002 3300025297 Bacteria 1852
132 Ga0207426_1000574 3300025302 Bacteria 49411
133 Ga0207426_1000837 3300025302 Bacteria 32586
134 Ga0207692_10007642 3300025898 Bacteria 4435
135 Ga0207692_10013743 3300025898 Bacteria 3520
136 Ga0207642_10048609 3300025899 Bacteria 1902
137 Ga0207710_10008835 3300025900 Bacteria 4242
138 Ga0207710_10052194 3300025900 Bacteria 1838
139 Ga0207688_10059228 3300025901 Bacteria 2157
140 Ga0207680_10153454 3300025903 Bacteria 1537
141 Ga0207647_10112567 3300025904 Bacteria 1608
142 Ga0207685_10047408 3300025905 Bacteria 1640
143 Ga0207699_10040745 3300025906 Bacteria 2678
144 Ga0207684_10052020 3300025910 Bacteria 3475
145 Ga0207654_10115909 3300025911 Bacteria 1674
146 Ga0207707_10007987 3300025912 Bacteria 9192
147 Ga0207707_10049332 3300025912 Bacteria 3667
148 Ga0207707_10370869 3300025912 Bacteria 1231
149 Ga0207695_10062924 3300025913 Bacteria 3827
150 Ga0207695_10255184 3300025913 Bacteria 1652
151 Ga0207695_10432675 3300025913 Bacteria 1199
152 Ga0207671_10089913 3300025914 Bacteria 2312
153 Ga0207671_10246522 3300025914 Bacteria 1404
154 Ga0207693_10001058 3300025915 Bacteria 24605
155 Ga0207693_10002843 3300025915 Bacteria 15000
156 Ga0207693_10022562 3300025915 Bacteria 5001
157 Ga0207693_10105736 3300025915 Bacteria 2207
158 Ga0207693_10152974 3300025915 Bacteria 1815
159 Ga0207663_10002609 3300025916 Bacteria 8675
160 Ga0207663_10002786 3300025916 Bacteria 8431
161 Ga0207663_10115576 3300025916 Bacteria 1828
162 Ga0207663_10137978 3300025916 Bacteria 1695
163 Ga0207663_10254420 3300025916 Bacteria 1294
164 Ga0207660_10019450 3300025917 Bacteria 4540
165 Ga0207660_10419381 3300025917 Bacteria 1079
166 Ga0207662_10158406 3300025918 Bacteria 1445
167 Ga0207657_10013488 3300025919 Bacteria 8014
168 Ga0207652_10019069 3300025921 Bacteria 5635
169 Ga0207652_10050398 3300025921 Bacteria 3567
170 Ga0207652_10412294 3300025921 Bacteria 1219
171 Ga0207646_10088457 3300025922 Bacteria 2772
172 Ga0207694_10046849 3300025924 Bacteria 3342
173 Ga0207687_10174475 3300025927 Bacteria 1661
174 Ga0207700_10012252 3300025928 Bacteria 5521
175 Ga0207700_10014889 3300025928 Bacteria 5110
176 Ga0207700_10044345 3300025928 Bacteria 3273
177 Ga0207700_10048261 3300025928 Bacteria 3160
178 Ga0207664_10023663 3300025929 Bacteria 4605
179 Ga0207664_10025806 3300025929 Bacteria 4433
180 Ga0207664_10162118 3300025929 Bacteria 1908
181 Ga0207664_10369767 3300025929 Bacteria 1271
182 Ga0207644_10218011 3300025931 Bacteria 1511
183 Ga0207690_10280649 3300025932 Bacteria 1297
184 Ga0207706_10016927 3300025933 Bacteria 6576
185 Ga0207669_10059747 3300025937 Bacteria 2333
186 Ga0207665_10005334 3300025939 Bacteria 8591
187 Ga0207665_10010410 3300025939 Bacteria 6108
188 Ga0207665_10100792 3300025939 Bacteria 2016
189 Ga0207691_10090453 3300025940 Bacteria 2743
190 Ga0207661_10009413 3300025944 Bacteria 7006
191 Ga0207667_10045963 3300025949 Bacteria 4623
192 Ga0207667_10223048 3300025949 Bacteria 1931
193 Ga0207667_10422432 3300025949 Bacteria 1356
194 Ga0207668_10056602 3300025972 Bacteria 2731
195 Ga0207658_10232301 3300025986 Bacteria 1558
196 Ga0207703_10280566 3300026035 Bacteria 1513
197 Ga0207639_10061108 3300026041 Bacteria 2908
198 Ga0207639_10394740 3300026041 Bacteria 1245
199 Ga0207678_10007212 3300026067 Bacteria 9854
200 Ga0207678_10085267 3300026067 Bacteria 2701
201 Ga0207678_10130926 3300026067 Bacteria 2140
202 Ga0207702_10003237 3300026078 Bacteria 15044
203 Ga0207641_10479857 3300026088 Bacteria 1205
204 Ga0207648_10163419 3300026089 Bacteria 1967
205 Ga0207674_10393525 3300026116 Bacteria 1339
206 Ga0207674_10547330 3300026116 Bacteria 1118
207 Ga0207683_10011530 3300026121 Bacteria 7545
208 Ga0207698_10126059 3300026142 Bacteria 2178
209 Ga0207698_10300397 3300026142 Bacteria 1494
210 Ga0209589_1000001 3300027357 Bacteria 794224
211 Ga0209489_100001 3300027361 Bacteria 794224
212 Ga0209700_100001 3300027363 Bacteria 794224
213 Ga0209588_1015010 3300027671 Bacteria 2379
214 Ga0207428_10088058 3300027907 Bacteria 2415
215 Ga0268266_10019183 3300028379 Bacteria 5823
216 Ga0268266_10227592 3300028379 Bacteria 1716
217 Ga0268265_10120862 3300028380 Bacteria 2157
218 Ga0268265_10297071 3300028380 Bacteria 1452
219 Ga0268264_10000048 3300028381 Bacteria 334457
220 Ga0265323_10027004 3300028653 Bacteria 2159
221 Ga0265336_10002023 3300028666 Bacteria 8653
222 Ga0265338_10000034 3300028800 Bacteria 244623
223 Ga0265328_10037150 3300031239 Bacteria 1799
224 Ga0265329_10052548 3300031242 Bacteria 1296
225 Ga0265340_10002448 3300031247 Bacteria 10562
226 Ga0265339_10019603 3300031249 Bacteria 3968
227 Ga0265339_10052502 3300031249 Bacteria 2220
228 Ga0265339_10119678 3300031249 Bacteria 1355
229 Ga0265316_10175752 3300031344 Bacteria 1596
230 Ga0307509_10017893 3300031507 Bacteria 8139
231 Ga0307509_10057532 3300031507 Bacteria 4122
232 Ga0307509_10074154 3300031507 Bacteria 3540
233 Ga0307509_10089606 3300031507 Bacteria 3154
234 Ga0307508_10000003 3300031616 Bacteria 321602
235 Ga0307508_10158265 3300031616 Bacteria 1868
236 Ga0265314_10000412 3300031711 Bacteria 57508
237 Ga0265314_10031282 3300031711 Bacteria 3932
238 Ga0265314_10169392 3300031711 Bacteria 1320
239 Ga0307516_10029440 3300031730 Bacteria 5553
240 Ga0307516_10050482 3300031730 Bacteria 4081
241 Ga0307516_10079612 3300031730 Bacteria 3121
242 Ga0307516_10091060 3300031730 Bacteria 2878
243 Ga0307516_10113310 3300031730 Bacteria 2510
244 Ga0307413_10006633 3300031824 Bacteria 5308
245 Ga0307410_10183178 3300031852 Bacteria 1587
246 Ga0307409_100143463 3300031995 Bacteria 2061
247 Ga0307416_100194684 3300032002 Bacteria 1916
248 Ga0307411_10110610 3300032005 Bacteria 1965
249 Ga0307415_100089816 3300032126 Bacteria 2220
250 Ga0307507_10030513 3300033179 Bacteria 5686
251 Ga0307510_10020754 3300033180 Bacteria 7670
252 Ga0307510_10041569 3300033180 Bacteria 5023
253 Ga0307510_10150176 3300033180 Bacteria 1951
254 Ga0315911_1000002 3300033442 Bacteria 926833
255 Ga0373923_0042435 3300035111 Bacteria 1879
256 Ga0373936_0050404 3300035113 Bacteria 1684
257 Ga0373943_0074817 3300035170 Bacteria 1723
258 Ga0373931_0023120 3300035691 Bacteria 3136
259 Ga0373935_0091029 3300035692 Bacteria 1997
260 Ga0373927_0004705 3300035695 Bacteria 9513
261 Ga0373927_0006809 3300035695 Bacteria 7774
262 Ga0373927_0030173 3300035695 Bacteria 3538
263 Ga0373933_0000062 3300035724 Bacteria 64991
264 Ga0373933_0155585 3300035724 Bacteria 1450
265 Ga0373947_0053958 3300035725 Bacteria 2425
266 Ga0373947_0114144 3300035725 Bacteria 1710
267 Ga0373937_0094825 3300036401 Bacteria 2767
268 Ga0373937_0113241 3300036401 Bacteria 2524
269 Ga0373937_0116659 3300036401 Bacteria 2486
270 Ga0373925_0011279 3300037068 Bacteria 6482
271 Ga0373925_0046835 3300037068 Bacteria 3216
272 Ga0373925_0057037 3300037068 Bacteria 2926
273 Ga0373925_0074965 3300037068 Bacteria 2563
274 Ga0373925_0334022 3300037068 Bacteria 1228
275 Ga0395898_0039271 3300037466 Bacteria 4686
276 Ga0395898_0553571 3300037466 Bacteria 1092
277 Ga0436364_0043851 3300037853 Bacteria 2654
278 Ga0436364_0563114 3300037853 Bacteria 3856
279 Ga0395901_0190471 3300038443 Bacteria 2151
280 Ga0395901_0195365 3300038443 Bacteria 2122
281 Ga0436365_1128219 3300039437 Bacteria 41762
282 Ga0436363_1161902 3300039450 Bacteria 3363
283 Ga0436363_1526803 3300039450 Bacteria 2254
284 Ga0436362_1099153 3300039453 Bacteria 4320
285 Ga0451833_0238202 3300041491 Bacteria 1281
286 Ga0466969_0097593 3300044656 Bacteria 1386
287 Ga0466966_0082034 3300044684 Bacteria 2007
288 Ga0466961_0213404 3300044693 Bacteria 1191
289 Ga0466963_0235375 3300044694 Bacteria 1284
290 Ga0466957_0025693 3300044842 Bacteria 3492
291 Ga0466959_0104437 3300045049 Bacteria 2027
292 Ga0466959_0214765 3300045049 Bacteria 1336
293 Ga0466967_0061760 3300045976 Bacteria 3325
294 Ga0495603_0005525 3300046455 Bacteria 7543
295 Ga0495603_0012346 3300046455 Bacteria 5171
296 Ga0495603_0105380 3300046455 Bacteria 1645
297 Ga0495590_0048919 3300046457 Bacteria 1475
298 Ga0495629_0271696 3300046459 Bacteria 1164
299 Ga0495638_0163295 3300046460 Bacteria 1283
300 Ga0495580_0038757 3300046472 Bacteria 3412
301 Ga0495580_0104752 3300046472 Bacteria 1966
302 Ga0495664_0073584 3300046477 Bacteria 2043
303 Ga0495594_0129948 3300046499 Bacteria 1426
304 Ga0495596_0075723 3300046500 Bacteria 1307
305 Ga0495606_0010333 3300046507 Bacteria 7762
306 Ga0495606_0031814 3300046507 Bacteria 3663
307 Ga0495606_0127059 3300046507 Bacteria 1519
308 Ga0495608_0014261 3300046511 Bacteria 5514
309 Ga0495618_0066493 3300046514 Bacteria 2291
310 Ga0495630_0045415 3300046517 Bacteria 3283
311 Ga0495631_0091022 3300046518 Bacteria 1313
312 Ga0495631_0109839 3300046518 Bacteria 1186
313 Ga0495632_0043498 3300046519 Bacteria 2244
314 Ga0495632_0092587 3300046519 Bacteria 1431
315 Ga0495644_0040630 3300046523 Bacteria 1753
316 Ga0495586_0146333 3300046535 Bacteria 1328
317 Ga0495622_0011122 3300046557 Bacteria 4154
318 Ga0495622_0060991 3300046557 Bacteria 1747
319 Ga0495633_0068849 3300046558 Bacteria 1652
320 Ga0495656_0001312 3300046615 Bacteria 8094
321 Ga0495625_0229996 3300046660 Bacteria 1211
322 Ga0495635_0007949 3300046663 Bacteria 7410
323 Ga0495635_0029732 3300046663 Bacteria 3800
324 Ga0495599_0040564 3300046678 Bacteria 2923
325 Ga0495623_0083349 3300046679 Bacteria 1975
326 Ga0495624_0034259 3300046690 Bacteria 3285
327 Ga0495600_0015512 3300046809 Bacteria 4817
328 Ga0495581_0080602 3300047315 Bacteria 1884
329 Ga0495581_0093146 3300047315 Bacteria 1749
330 Ga0495604_0159387 3300047317 Bacteria 1596
331 Ga0495674_0300154 3300047319 Bacteria 1312
332 Ga0495675_0067179 3300047444 Bacteria 2265
333 Ga0495673_0019752 3300047469 Bacteria 3371
334 Ga0495684_0011020 3300047471 Bacteria 6991
335 Ga0495684_0054971 3300047471 Bacteria 3036
336 Ga0495602_0053387 3300048088 Bacteria 3580
337 Ga0495602_0062293 3300048088 Bacteria 3236
338 Ga0496100_0041289 3300048903 Bacteria 2940
339 Ga0496100_0051585 3300048903 Bacteria 2671
340 Ga0496101_0067965 3300048904 Bacteria 2604
341 Ga0496101_0273747 3300048904 Bacteria 1318
342 Ga0496102_0029057 3300048905 Bacteria 4943
343 Ga0496102_0048191 3300048905 Bacteria 3874
344 Ga0496104_0189719 3300048907 Bacteria 1966
345 Ga0496105_0000208 3300048908 Bacteria 39305
346 Ga0496106_0001007 3300048909 Bacteria 20622
347 Ga0496106_0001121 3300048909 Bacteria 19807
348 Ga0496106_0095549 3300048909 Bacteria 2299
349 Ga0496107_0044783 3300048910 Bacteria 3182
350 Ga0496107_0080650 3300048910 Bacteria 2373
351 Ga0496108_0000415 3300048911 Bacteria 34866
352 Ga0496108_0062625 3300048911 Bacteria 3132
353 Ga0496108_0312184 3300048911 Bacteria 1370
354 Ga0496109_0061834 3300048912 Bacteria 3424
355 Ga0496109_0298254 3300048912 Bacteria 1519
356 Ga0496110_0021125 3300048913 Bacteria 5503
357 Ga0496111_0005833 3300048914 Bacteria 7941
358 Ga0496112_0000004 3300048915 Bacteria 553294
359 Ga0496112_0012818 3300048915 Bacteria 7716
360 Ga0496112_0026322 3300048915 Bacteria 5595
361 Ga0496112_0037479 3300048915 Bacteria 4732
362 Ga0496112_0044181 3300048915 Bacteria 4365
363 Ga0496112_0241052 3300048915 Bacteria 1761
364 Ga0496113_0042178 3300048916 Bacteria 3370
365 Ga0496113_0075426 3300048916 Bacteria 2574
366 Ga0496114_0132994 3300048917 Bacteria 2149
367 Ga0496115_0029851 3300048918 Bacteria 4287
368 Ga0496115_0049377 3300048918 Bacteria 3368
369 Ga0496115_0159449 3300048918 Bacteria 1864
370 Ga0496115_0299601 3300048918 Bacteria 1317
371 Ga0496115_0390914 3300048918 Bacteria 1130
372 Ga0496117_0091713 3300048920 Bacteria 1953
373 Ga0496118_0006738 3300048921 Bacteria 12512
374 Ga0496119_0030642 3300048922 Bacteria 3622
375 Ga0496119_0056162 3300048922 Bacteria 2386
376 Ga0496120_0027428 3300048923 Bacteria 3502
377 Ga0496121_0005409 3300048924 Bacteria 16397
378 Ga0496121_0014219 3300048924 Bacteria 8466
379 Ga0496121_0018372 3300048924 Bacteria 7055
380 Ga0496121_0026682 3300048924 Bacteria 5431
381 Ga0496121_0029827 3300048924 Bacteria 5028
382 Ga0496121_0094400 3300048924 Bacteria 2327
383 Ga0496124_0052593 3300048927 Bacteria 3459
384 Ga0496124_0181117 3300048927 Bacteria 1621
385 Ga0496125_0000040 3300048928 Bacteria 314478
386 Ga0496125_0001260 3300048928 Bacteria 37764
387 Ga0496125_0023458 3300048928 Bacteria 5694
388 Ga0496126_0005981 3300048929 Bacteria 13673
389 Ga0496126_0006080 3300048929 Bacteria 13539
390 Ga0496126_0008347 3300048929 Bacteria 11179
391 Ga0496126_0049358 3300048929 Bacteria 3842
392 Ga0496126_0083208 3300048929 Bacteria 2825
393 Ga0496126_0114010 3300048929 Bacteria 2352
394 Ga0496126_0135884 3300048929 Bacteria 2121
395 Ga0496126_0194465 3300048929 Bacteria 1716
396 Ga0496126_0354999 3300048929 Bacteria 1198
397 Ga0496126_0431532 3300048929 Bacteria 1063
398 Ga0501031_0013260 3300049568 Bacteria 5378
399 Ga0501031_0200539 3300049568 Bacteria 1302
400 Ga0501032_0000038 3300049569 Bacteria 115810
401 Ga0501033_0000089 3300049570 Bacteria 86782
402 Ga0501033_0041227 3300049570 Bacteria 3445
403 Ga0501033_0106426 3300049570 Bacteria 2043
404 Ga0501034_0000228 3300049571 Bacteria 106111
405 Ga0501034_0179401 3300049571 Bacteria 2083
406 Ga0501036_0000010 3300049572 Bacteria 163304
407 Ga0501036_0165755 3300049572 Bacteria 1862
408 Ga0501037_0000135 3300049573 Bacteria 68925
409 Ga0501038_0000054 3300049574 Bacteria 94123
410 Ga0501039_0013587 3300049575 Bacteria 6227
411 Ga0501039_0361440 3300049575 Bacteria 1140
412 Ga0501041_0052655 3300049577 Bacteria 2482
413 Ga0501043_0000021 3300049579 Bacteria 155025
414 Ga0501043_0065543 3300049579 Bacteria 2852
415 Ga0501043_0178711 3300049579 Bacteria 1654
416 Ga0501046_0000341 3300049580 Bacteria 47097
417 Ga0501046_0032068 3300049580 Bacteria 4256
418 Ga0501047_0000041 3300049581 Bacteria 184355
419 Ga0501047_0132080 3300049581 Bacteria 2377
420 Ga0501047_0135509 3300049581 Bacteria 2343
421 Ga0501048_0000022 3300049582 Bacteria 68365
422 Ga0501067_0000206 3300049583 Bacteria 33049
423 Ga0501069_0160172 3300049585 Bacteria 1296
424 Ga0501070_0101273 3300049586 Bacteria 2383
425 Ga0501071_0057194 3300049587 Bacteria 2818
426 Ga0501071_0250546 3300049587 Bacteria 1337
427 Ga0501072_0007562 3300049588 Bacteria 8245
428 Ga0501073_0000082 3300049589 Bacteria 59745
429 Ga0501074_0000415 3300049590 Bacteria 25490
430 Ga0501079_0006095 3300049741 Bacteria 9037
431 Ga0501080_0000506 3300049742 Bacteria 30607
432 Ga0501080_0384947 3300049742 Bacteria 1263
433 Ga0501083_0023204 3300049744 Bacteria 4303
434 Ga0501035_0000146 3300049822 Bacteria 86011
435 Ga0501035_0172819 3300049822 Bacteria 1866
436 Ga0501044_0001064 3300049823 Bacteria 32992
437 Ga0501044_0002044 3300049823 Bacteria 23277
438 Ga0501044_0111045 3300049823 Bacteria 2750
439 Ga0501045_0067513 3300049824 Bacteria 2626
440 nmdc:mga0yw44_20422_c1 3300050492 Bacteria 3676
441 nmdc:mga0yw44_243758_c1 3300050492 Bacteria 1195
442 nmdc:mga0yw44_35246_c1 3300050492 Bacteria 2939
443 nmdc:mga0k408_157891_c1 3300050493 Bacteria 1351
444 nmdc:mga06z11_155976_c1 3300050494 Bacteria 1301
445 nmdc:mga07m45_215527_c1 3300050496 Bacteria 1117
446 nmdc:mga08y16_137652_c1 3300050511 Bacteria 2538
447 nmdc:mga0n895_228832_c1 3300050512 Bacteria 1887
448 nmdc:mga0n895_6543_c1 3300050512 Bacteria 9913
449 nmdc:mga0sz30_26893_c1 3300050516 Bacteria 2360
450 Ga0495601_0186288 3300053077 Bacteria 1357
451 Ga0500635_0038327 3300053080 Bacteria 1589
452 Ga0495595_0074248 3300053084 Bacteria 1612
453 Ga0495619_0038800 3300053085 Bacteria 3107
454 Ga0500578_0142492 3300053086 Bacteria 1498
455 Ga0500643_000046 3300053087 Bacteria 150388
456 Ga0500644_0028886 3300053088 Bacteria 1739
457 Ga0500647_0016078 3300053091 Bacteria 3432
458 Ga0500647_0079381 3300053091 Bacteria 1574
459 Ga0500583_0037675 3300053092 Bacteria 2173
460 Ga0500651_0003779 3300053093 Bacteria 8346
461 Ga0500566_0001776 3300053094 Bacteria 12676
462 Ga0500641_0025728 3300053096 Bacteria 2279
463 Ga0500555_012563 3300053103 Bacteria 2438
464 Ga0500556_0000002 3300053104 Bacteria 773626
465 Ga0500557_000020 3300053105 Bacteria 91933
466 Ga0500572_000151 3300053111 Bacteria 24045
467 Ga0500591_040856 3300053115 Bacteria 2208
468 Ga0500595_002109 3300053119 Bacteria 10154
469 Ga0500595_006280 3300053119 Bacteria 5063
470 Ga0500595_015185 3300053119 Bacteria 2894
471 Ga0500608_023013 3300053122 Bacteria 2895
472 Ga0500608_095632 3300053122 Bacteria 1382
473 Ga0500559_0001510 3300053136 Bacteria 13085
474 Ga0500568_0008904 3300053139 Bacteria 4801
475 Ga0500573_0122294 3300053140 Bacteria 1447
476 Ga0500590_075300 3300053148 Bacteria 1669
477 Ga0500590_118112 3300053148 Bacteria 1247
478 Ga0500603_000816 3300053150 Bacteria 7434
479 Ga0500616_0000034 3300053153 Bacteria 396651
480 Ga0500619_049611 3300053154 Bacteria 1354
481 Ga0500630_000657 3300053159 Bacteria 15701
482 Ga0500634_0104618 3300053161 Bacteria 1410
483 Ga0500638_055089 3300053162 Bacteria 1917
484 Ga0500638_107593 3300053162 Bacteria 1292
485 Ga0500639_000002 3300053163 Bacteria 233548
486 Ga0500636_0000436 3300053177 Bacteria 22986
487 Ga0500636_0163531 3300053177 Bacteria 1210
488 Ga0500637_0000328 3300053178 Bacteria 17873
489 Ga0500596_003112 3300053735 Bacteria 3190
490 Ga0500596_008375 3300053735 Bacteria 1651
491 Ga0501084_0001986 3300054114 Bacteria 16326
492 Ga0501082_0016806 3300060353 Bacteria 6301

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10025057 Ga0157378_100250575 241
2 3300050492 nmdc:mga0yw44_35246_c1 nmdc:mga0yw44_35246_c1_14_859 243
3 3300025939 Ga0207665_10100792 Ga0207665_101007923 254
4 3300012492 Ga0157335_1000871 Ga0157335_10008711 281
5 3300025940 Ga0207691_10090453 Ga0207691_100904532 281
6 3300037068 Ga0373925_0334022 Ga0373925_0334022_22_993 282
7 3300005356 Ga0070674_100052465 Ga0070674_1000524652 283
8 3300005436 Ga0070713_100003607 Ga0070713_1000036076 283
9 3300005436 Ga0070713_100112787 Ga0070713_1001127872 283
10 3300005437 Ga0070710_10003983 Ga0070710_100039833 283
11 3300005439 Ga0070711_100010293 Ga0070711_1000102933 283
12 3300005455 Ga0070663_100053860 Ga0070663_1000538602 283
13 3300005459 Ga0068867_100026289 Ga0068867_1000262896 283
14 3300005844 Ga0068862_100058558 Ga0068862_1000585582 283
15 3300006028 Ga0070717_10000402 Ga0070717_100004025 283
16 3300006163 Ga0070715_10045714 Ga0070715_100457142 283
17 3300006173 Ga0070716_100112940 Ga0070716_1001129402 283
18 3300025297 Ga0209758_1008034 Ga0209758_10080343 283
19 3300025903 Ga0207680_10153454 Ga0207680_101534542 283
20 3300025905 Ga0207685_10047408 Ga0207685_100474082 283
21 3300025916 Ga0207663_10137978 Ga0207663_101379782 283
22 3300025928 Ga0207700_10012252 Ga0207700_100122523 283
23 3300025933 Ga0207706_10016927 Ga0207706_100169272 283
24 3300025937 Ga0207669_10059747 Ga0207669_100597472 283
25 3300025939 Ga0207665_10010410 Ga0207665_100104102 283
26 3300028380 Ga0268265_10297071 Ga0268265_102970712 283
27 3300031507 Ga0307509_10089606 Ga0307509_100896062 283
28 3300031824 Ga0307413_10006633 Ga0307413_100066334 283
29 3300032005 Ga0307411_10110610 Ga0307411_101106102 283
30 3300033180 Ga0307510_10041569 Ga0307510_100415694 283
31 3300046457 Ga0495590_0048919 Ga0495590_0048919_309_1277 283
32 3300046460 Ga0495638_0163295 Ga0495638_0163295_49_1017 283
33 3300046499 Ga0495594_0129948 Ga0495594_0129948_173_1141 283
34 3300046500 Ga0495596_0075723 Ga0495596_0075723_50_1018 283
35 3300046518 Ga0495631_0091022 Ga0495631_0091022_14_982 283
36 3300046519 Ga0495632_0092587 Ga0495632_0092587_128_1096 283
37 3300046523 Ga0495644_0040630 Ga0495644_0040630_497_1465 283
38 3300046535 Ga0495586_0146333 Ga0495586_0146333_48_1016 283
39 3300046557 Ga0495622_0011122 Ga0495622_0011122_2508_3476 283
40 3300046615 Ga0495656_0001312 Ga0495656_0001312_1778_2746 283
41 3300047315 Ga0495581_0093146 Ga0495581_0093146_389_1357 283
42 3300047319 Ga0495674_0300154 Ga0495674_0300154_222_1190 283
43 3300053084 Ga0495595_0074248 Ga0495595_0074248_327_1295 283
44 3300053122 Ga0500608_095632 Ga0500608_095632_67_1035 283
45 3300053148 Ga0500590_075300 Ga0500590_075300_67_1035 283
46 3300053154 Ga0500619_049611 Ga0500619_049611_312_1280 283
47 3300003354 JGI25160J50197_1006462 JGI25160J50197_10064623 284
48 3300005327 Ga0070658_10443915 Ga0070658_104439151 284
49 3300006038 Ga0075365_10089588 Ga0075365_100895882 284
50 3300006048 Ga0075363_100139562 Ga0075363_1001395623 284
51 3300006051 Ga0075364_10045080 Ga0075364_100450802 284
52 3300006177 Ga0075362_10078256 Ga0075362_100782562 284
53 3300006186 Ga0075369_10024782 Ga0075369_100247822 284
54 3300025302 Ga0207426_1000837 Ga0207426_10008377 284
55 3300025916 Ga0207663_10115576 Ga0207663_101155761 284
56 3300031239 Ga0265328_10037150 Ga0265328_100371502 284
57 3300036401 Ga0373937_0113241 Ga0373937_0113241_321_1289 284
58 3300045049 Ga0466959_0214765 Ga0466959_0214765_186_1154 284
59 3300046507 Ga0495606_0127059 Ga0495606_0127059_117_1085 284
60 3300046679 Ga0495623_0083349 Ga0495623_0083349_723_1691 284
61 3300048088 Ga0495602_0053387 Ga0495602_0053387_1621_2589 284
62 3300048928 Ga0496125_0001260 Ga0496125_0001260_9899_10873 284
63 3300048928 Ga0496125_0023458 Ga0496125_0023458_3623_4591 284
64 3300048929 Ga0496126_0354999 Ga0496126_0354999_35_1006 284
65 3300050492 nmdc:mga0yw44_20422_c1 nmdc:mga0yw44_20422_c1_832_1800 284
66 3300050494 nmdc:mga06z11_155976_c1 nmdc:mga06z11_155976_c1_74_1042 284
67 3300053080 Ga0500635_0038327 Ga0500635_0038327_508_1476 284
68 3300053162 Ga0500638_055089 Ga0500638_055089_500_1468 284
69 3300053177 Ga0500636_0000436 Ga0500636_0000436_8361_9329 284
70 3300005434 Ga0070709_10017401 Ga0070709_100174012 285
71 3300005435 Ga0070714_100011360 Ga0070714_1000113602 285
72 3300005614 Ga0068856_100023694 Ga0068856_1000236943 285
73 3300005937 Ga0081455_10069621 Ga0081455_100696212 285
74 3300005985 Ga0081539_10027637 Ga0081539_100276374 285
75 3300006175 Ga0070712_100037180 Ga0070712_1000371802 285
76 3300025915 Ga0207693_10022562 Ga0207693_100225622 285
77 3300025929 Ga0207664_10162118 Ga0207664_101621182 285
78 3300026078 Ga0207702_10003237 Ga0207702_1000323711 285
79 3300031730 Ga0307516_10091060 Ga0307516_100910603 285
80 3300035111 Ga0373923_0042435 Ga0373923_0042435_236_1204 285
81 3300046507 Ga0495606_0031814 Ga0495606_0031814_2014_2982 285
82 3300046660 Ga0495625_0229996 Ga0495625_0229996_225_1193 285
83 3300048918 Ga0496115_0049377 Ga0496115_0049377_1847_2815 285
84 3300005436 Ga0070713_100007249 Ga0070713_1000072492 286
85 3300005437 Ga0070710_10007420 Ga0070710_100074202 286
86 3300005439 Ga0070711_100067656 Ga0070711_1000676562 286
87 3300005471 Ga0070698_100163268 Ga0070698_1001632682 286
88 3300005718 Ga0068866_10053236 Ga0068866_100532362 286
89 3300006048 Ga0075363_100063425 Ga0075363_1000634252 286
90 3300006173 Ga0070716_100101461 Ga0070716_1001014612 286
91 3300006175 Ga0070712_100008186 Ga0070712_1000081864 286
92 3300009174 Ga0105241_10508225 Ga0105241_105082252 286
93 3300013306 Ga0163162_10417115 Ga0163162_104171152 286
94 3300025297 Ga0209758_1038002 Ga0209758_10380022 286
95 3300025898 Ga0207692_10013743 Ga0207692_100137432 286
96 3300025899 Ga0207642_10048609 Ga0207642_100486092 286
97 3300025906 Ga0207699_10040745 Ga0207699_100407453 286
98 3300025915 Ga0207693_10001058 Ga0207693_1000105817 286
99 3300025916 Ga0207663_10002609 Ga0207663_100026097 286
100 3300025927 Ga0207687_10174475 Ga0207687_101744752 286
101 3300025928 Ga0207700_10014889 Ga0207700_100148895 286
102 3300025972 Ga0207668_10056602 Ga0207668_100566023 286
103 3300026067 Ga0207678_10085267 Ga0207678_100852671 286
104 3300031507 Ga0307509_10057532 Ga0307509_100575324 286
105 3300031711 Ga0265314_10169392 Ga0265314_101693921 286
106 3300033180 Ga0307510_10020754 Ga0307510_100207543 286
107 3300035113 Ga0373936_0050404 Ga0373936_0050404_17_985 286
108 3300035691 Ga0373931_0023120 Ga0373931_0023120_259_1227 286
109 3300037853 Ga0436364_0043851 Ga0436364_0043851_1439_2407 286
110 3300046455 Ga0495603_0005525 Ga0495603_0005525_2597_3571 286
111 3300046809 Ga0495600_0015512 Ga0495600_0015512_2222_3190 286
112 3300048903 Ga0496100_0041289 Ga0496100_0041289_1840_2808 286
113 3300048915 Ga0496112_0044181 Ga0496112_0044181_1180_2148 286
114 3300048916 Ga0496113_0042178 Ga0496113_0042178_419_1387 286
115 3300048917 Ga0496114_0132994 Ga0496114_0132994_1152_2120 286
116 3300048929 Ga0496126_0083208 Ga0496126_0083208_783_1751 286
117 3300050492 nmdc:mga0yw44_243758_c1 nmdc:mga0yw44_243758_c1_197_1165 286
118 3300053088 Ga0500644_0028886 Ga0500644_0028886_748_1719 286
119 3300053091 Ga0500647_0079381 Ga0500647_0079381_468_1436 286
120 3300053094 Ga0500566_0001776 Ga0500566_0001776_701_1669 286
121 3300053111 Ga0500572_000151 Ga0500572_000151_10707_11675 286
122 3300053115 Ga0500591_040856 Ga0500591_040856_867_1835 286
123 3300053119 Ga0500595_006280 Ga0500595_006280_2687_3655 286
124 3300053119 Ga0500595_015185 Ga0500595_015185_434_1405 286
125 3300053122 Ga0500608_023013 Ga0500608_023013_1474_2442 286
126 3300053136 Ga0500559_0001510 Ga0500559_0001510_6556_7524 286
127 3300053150 Ga0500603_000816 Ga0500603_000816_904_1878 286
128 3300053159 Ga0500630_000657 Ga0500630_000657_12362_13330 286
129 3300053163 Ga0500639_000002 Ga0500639_000002_3354_4322 286
130 3300053178 Ga0500637_0000328 Ga0500637_0000328_10068_11042 286
131 3300053735 Ga0500596_003112 Ga0500596_003112_522_1490 286
132 3300003659 JGI25404J52841_10023995 JGI25404J52841_100239951 287
133 3300005329 Ga0070683_100142442 Ga0070683_1001424422 287
134 3300005336 Ga0070680_100062296 Ga0070680_1000622963 287
135 3300005445 Ga0070708_100092186 Ga0070708_1000921863 287
136 3300005719 Ga0068861_100252161 Ga0068861_1002521612 287
137 3300005937 Ga0081455_10160945 Ga0081455_101609452 287
138 3300005983 Ga0081540_1005778 Ga0081540_10057787 287
139 3300005985 Ga0081539_10009620 Ga0081539_100096203 287
140 3300006353 Ga0075370_10032834 Ga0075370_100328343 287
141 3300013104 Ga0157370_10148417 Ga0157370_101484172 287
142 3300013105 Ga0157369_10024696 Ga0157369_100246967 287
143 3300013105 Ga0157369_10466917 Ga0157369_104669172 287
144 3300021384 Ga0213876_10000670 Ga0213876_100006709 287
145 3300025297 Ga0209758_1014022 Ga0209758_10140222 287
146 3300025904 Ga0207647_10112567 Ga0207647_101125671 287
147 3300025914 Ga0207671_10246522 Ga0207671_102465221 287
148 3300025932 Ga0207690_10280649 Ga0207690_102806492 287
149 3300026067 Ga0207678_10130926 Ga0207678_101309262 287
150 3300027907 Ga0207428_10088058 Ga0207428_100880582 287
151 3300031249 Ga0265339_10052502 Ga0265339_100525022 287
152 3300031711 Ga0265314_10031282 Ga0265314_100312824 287
153 3300031730 Ga0307516_10029440 Ga0307516_100294402 287
154 3300031730 Ga0307516_10050482 Ga0307516_100504822 287
155 3300031852 Ga0307410_10183178 Ga0307410_101831782 287
156 3300031995 Ga0307409_100143463 Ga0307409_1001434632 287
157 3300032002 Ga0307416_100194684 Ga0307416_1001946842 287
158 3300032126 Ga0307415_100089816 Ga0307415_1000898162 287
159 3300033442 Ga0315911_1000002 Ga0315911_1000002384 287
160 3300035724 Ga0373933_0155585 Ga0373933_0155585_380_1348 287
161 3300037466 Ga0395898_0039271 Ga0395898_0039271_1058_2026 287
162 3300039437 Ga0436365_1128219 Ga0436365_1128219_10042_11010 287
163 3300039450 Ga0436363_1526803 Ga0436363_1526803_520_1488 287
164 3300039453 Ga0436362_1099153 Ga0436362_1099153_718_1686 287
165 3300044656 Ga0466969_0097593 Ga0466969_0097593_144_1112 287
166 3300044694 Ga0466963_0235375 Ga0466963_0235375_164_1132 287
167 3300044842 Ga0466957_0025693 Ga0466957_0025693_1104_2072 287
168 3300045049 Ga0466959_0104437 Ga0466959_0104437_643_1611 287
169 3300046511 Ga0495608_0014261 Ga0495608_0014261_799_1767 287
170 3300047444 Ga0495675_0067179 Ga0495675_0067179_627_1595 287
171 3300047471 Ga0495684_0011020 Ga0495684_0011020_1884_2852 287
172 3300048088 Ga0495602_0062293 Ga0495602_0062293_201_1169 287
173 3300048924 Ga0496121_0029827 Ga0496121_0029827_1597_2565 287
174 3300048929 Ga0496126_0431532 Ga0496126_0431532_83_1051 287
175 3300049585 Ga0501069_0160172 Ga0501069_0160172_31_999 287
176 3300050496 nmdc:mga07m45_215527_c1 nmdc:mga07m45_215527_c1_121_1089 287
177 3300053085 Ga0495619_0038800 Ga0495619_0038800_1914_2882 287
178 3300053091 Ga0500647_0016078 Ga0500647_0016078_439_1407 287
179 3300053104 Ga0500556_0000002 Ga0500556_0000002_276372_277340 287
180 3300053105 Ga0500557_000020 Ga0500557_000020_7840_8808 287
181 3300005578 Ga0068854_100156385 Ga0068854_1001563851 288
182 3300006942 Ga0099824_1031084 Ga0099824_10310842 288
183 3300006943 Ga0099822_1001873 Ga0099822_100187316 288
184 3300027357 Ga0209589_1000001 Ga0209589_1000001702 288
185 3300027361 Ga0209489_100001 Ga0209489_100001702 288
186 3300027363 Ga0209700_100001 Ga0209700_100001702 288
187 3300039450 Ga0436363_1161902 Ga0436363_1161902_2099_3067 288
188 3300025901 Ga0207688_10059228 Ga0207688_100592282 289
189 3300031711 Ga0265314_10000412 Ga0265314_1000041248 289
190 3300048905 Ga0496102_0048191 Ga0496102_0048191_1520_2494 289
191 3300048909 Ga0496106_0001007 Ga0496106_0001007_11509_12483 289
192 3300048910 Ga0496107_0044783 Ga0496107_0044783_525_1499 289
193 3300048911 Ga0496108_0000415 Ga0496108_0000415_1978_2952 289
194 3300048912 Ga0496109_0298254 Ga0496109_0298254_295_1269 289
195 3300048913 Ga0496110_0021125 Ga0496110_0021125_3904_4878 289
196 3300048915 Ga0496112_0012818 Ga0496112_0012818_3800_4774 289
197 3300048916 Ga0496113_0075426 Ga0496113_0075426_589_1563 289
198 3300026116 Ga0207674_10393525 Ga0207674_103935252 290
199 3300031616 Ga0307508_10000003 Ga0307508_10000003180 290
200 3300045976 Ga0466967_0061760 Ga0466967_0061760_1043_2011 290
201 3300037068 Ga0373925_0011279 Ga0373925_0011279_889_1857 291
202 3300053119 Ga0500595_002109 Ga0500595_002109_1374_2342 291
203 3300005329 Ga0070683_100020392 Ga0070683_1000203922 292
204 3300005337 Ga0070682_100018684 Ga0070682_1000186843 292
205 3300005530 Ga0070679_100043461 Ga0070679_1000434613 292
206 3300005530 Ga0070679_100055274 Ga0070679_1000552742 292
207 3300005535 Ga0070684_100011602 Ga0070684_1000116022 292
208 3300025911 Ga0207654_10115909 Ga0207654_101159091 292
209 3300025912 Ga0207707_10007987 Ga0207707_100079873 292
210 3300025913 Ga0207695_10255184 Ga0207695_102551842 292
211 3300025921 Ga0207652_10050398 Ga0207652_100503982 292
212 3300025944 Ga0207661_10009413 Ga0207661_100094138 292
213 3300035692 Ga0373935_0091029 Ga0373935_0091029_565_1533 292
214 3300035695 Ga0373927_0030173 Ga0373927_0030173_175_1143 292
215 3300036401 Ga0373937_0116659 Ga0373937_0116659_1438_2406 292
216 3300037068 Ga0373925_0046835 Ga0373925_0046835_684_1652 292
217 3300046472 Ga0495580_0104752 Ga0495580_0104752_580_1548 292
218 3300046477 Ga0495664_0073584 Ga0495664_0073584_490_1458 292
219 3300046517 Ga0495630_0045415 Ga0495630_0045415_339_1307 292
220 3300046663 Ga0495635_0029732 Ga0495635_0029732_2531_3499 292
221 3300047315 Ga0495581_0080602 Ga0495581_0080602_530_1498 292
222 3300047471 Ga0495684_0054971 Ga0495684_0054971_1995_2963 292
223 3300048929 Ga0496126_0135884 Ga0496126_0135884_186_1154 292
224 3300005983 Ga0081540_1004707 Ga0081540_10047074 293
225 3300048927 Ga0496124_0181117 Ga0496124_0181117_297_1265 293
226 3300049586 Ga0501070_0101273 Ga0501070_0101273_725_1699 293
227 3300053086 Ga0500578_0142492 Ga0500578_0142492_114_1082 293
228 3300053093 Ga0500651_0003779 Ga0500651_0003779_1769_2737 293
229 3300053096 Ga0500641_0025728 Ga0500641_0025728_283_1251 293
230 3300005468 Ga0070707_100106031 Ga0070707_1001060312 294
231 3300025922 Ga0207646_10088457 Ga0207646_100884572 294
232 3300003203 JGI25406J46586_10016723 JGI25406J46586_100167233 295
233 3300005983 Ga0081540_1023016 Ga0081540_10230165 295
234 3300005985 Ga0081539_10000148 Ga0081539_1000014810 295
235 3300025915 Ga0207693_10105736 Ga0207693_101057361 295
236 3300025916 Ga0207663_10254420 Ga0207663_102544202 295
237 3300033180 Ga0307510_10150176 Ga0307510_101501762 295
238 3300035724 Ga0373933_0000062 Ga0373933_0000062_63570_64538 295
239 3300041491 Ga0451833_0238202 Ga0451833_0238202_83_1051 295
240 3300046514 Ga0495618_0066493 Ga0495618_0066493_1265_2233 295
241 3300046558 Ga0495633_0068849 Ga0495633_0068849_71_1039 295
242 3300046663 Ga0495635_0007949 Ga0495635_0007949_4614_5582 295
243 3300046690 Ga0495624_0034259 Ga0495624_0034259_290_1258 295
244 3300048904 Ga0496101_0067965 Ga0496101_0067965_40_1008 295
245 3300048908 Ga0496105_0000208 Ga0496105_0000208_9017_9985 295
246 3300048909 Ga0496106_0095549 Ga0496106_0095549_987_1955 295
247 3300048922 Ga0496119_0056162 Ga0496119_0056162_231_1199 295
248 3300048923 Ga0496120_0027428 Ga0496120_0027428_1360_2328 295
249 3300048924 Ga0496121_0018372 Ga0496121_0018372_5678_6652 295
250 3300048929 Ga0496126_0006080 Ga0496126_0006080_6021_6989 295
251 3300050516 nmdc:mga0sz30_26893_c1 nmdc:mga0sz30_26893_c1_78_1046 295
252 3300013296 Ga0157374_10100276 Ga0157374_101002761 296
253 3300013308 Ga0157375_10164872 Ga0157375_101648721 296
254 3300014325 Ga0163163_10581492 Ga0163163_105814921 296
255 3300025986 Ga0207658_10232301 Ga0207658_102323012 296
256 3300026121 Ga0207683_10011530 Ga0207683_100115308 296
257 3300046459 Ga0495629_0271696 Ga0495629_0271696_166_1134 296
258 3300046519 Ga0495632_0043498 Ga0495632_0043498_265_1233 296
259 3300048903 Ga0496100_0051585 Ga0496100_0051585_1568_2536 296
260 3300048904 Ga0496101_0273747 Ga0496101_0273747_246_1214 296
261 3300048905 Ga0496102_0029057 Ga0496102_0029057_3680_4648 296
262 3300048907 Ga0496104_0189719 Ga0496104_0189719_437_1405 296
263 3300048910 Ga0496107_0080650 Ga0496107_0080650_685_1653 296
264 3300048911 Ga0496108_0062625 Ga0496108_0062625_176_1144 296
265 3300048912 Ga0496109_0061834 Ga0496109_0061834_1504_2472 296
266 3300048915 Ga0496112_0037479 Ga0496112_0037479_3286_4254 296
267 3300048918 Ga0496115_0299601 Ga0496115_0299601_275_1243 296
268 3300048929 Ga0496126_0049358 Ga0496126_0049358_455_1429 296
269 3300048929 Ga0496126_0114010 Ga0496126_0114010_948_1916 296
270 3300049577 Ga0501041_0052655 Ga0501041_0052655_389_1357 296
271 3300049587 Ga0501071_0250546 Ga0501071_0250546_20_988 296
272 3300005262 Ga0065165_1001283 Ga0065165_100128326 297
273 3300005983 Ga0081540_1089534 Ga0081540_10895342 297
274 3300025302 Ga0207426_1000574 Ga0207426_10005742 297
275 3300025918 Ga0207662_10158406 Ga0207662_101584062 297
276 3300028379 Ga0268266_10019183 Ga0268266_100191838 297
277 3300044693 Ga0466961_0213404 Ga0466961_0213404_99_1067 297
278 3300005548 Ga0070665_100386310 Ga0070665_1003863102 298
279 3300005842 Ga0068858_100242536 Ga0068858_1002425361 298
280 3300006178 Ga0075367_10057509 Ga0075367_100575093 298
281 3300025297 Ga0209758_1007379 Ga0209758_10073796 298
282 3300048918 Ga0496115_0159449 Ga0496115_0159449_853_1821 298
283 3300049581 Ga0501047_0135509 Ga0501047_0135509_180_1148 298
284 3300006871 Ga0075434_100024593 Ga0075434_1000245934 299
285 3300007076 Ga0075435_100021468 Ga0075435_1000214683 299
286 3300025921 Ga0207652_10412294 Ga0207652_104122941 299
287 3300031242 Ga0265329_10052548 Ga0265329_100525481 299
288 3300031247 Ga0265340_10002448 Ga0265340_100024482 299
289 3300031249 Ga0265339_10119678 Ga0265339_101196781 299
290 3300031344 Ga0265316_10175752 Ga0265316_101757521 299
291 3300049568 Ga0501031_0013260 Ga0501031_0013260_1235_2209 299
292 3300049569 Ga0501032_0000038 Ga0501032_0000038_3799_4773 299
293 3300049570 Ga0501033_0000089 Ga0501033_0000089_54992_55966 299
294 3300049571 Ga0501034_0000228 Ga0501034_0000228_14806_15780 299
295 3300049572 Ga0501036_0000010 Ga0501036_0000010_100549_101523 299
296 3300049573 Ga0501037_0000135 Ga0501037_0000135_20147_21121 299
297 3300049574 Ga0501038_0000054 Ga0501038_0000054_84313_85287 299
298 3300049575 Ga0501039_0013587 Ga0501039_0013587_944_1918 299
299 3300049579 Ga0501043_0000021 Ga0501043_0000021_2231_3205 299
300 3300049580 Ga0501046_0000341 Ga0501046_0000341_44501_45475 299
301 3300049581 Ga0501047_0000041 Ga0501047_0000041_150265_151239 299
302 3300049583 Ga0501067_0000206 Ga0501067_0000206_22253_23227 299
303 3300049587 Ga0501071_0057194 Ga0501071_0057194_835_1809 299
304 3300049588 Ga0501072_0007562 Ga0501072_0007562_1038_2012 299
305 3300049589 Ga0501073_0000082 Ga0501073_0000082_44652_45626 299
306 3300049590 Ga0501074_0000415 Ga0501074_0000415_4438_5412 299
307 3300049741 Ga0501079_0006095 Ga0501079_0006095_2992_3966 299
308 3300049742 Ga0501080_0000506 Ga0501080_0000506_9861_10835 299
309 3300049742 Ga0501080_0384947 Ga0501080_0384947_224_1198 299
310 3300049744 Ga0501083_0023204 Ga0501083_0023204_2833_3807 299
311 3300049822 Ga0501035_0000146 Ga0501035_0000146_40386_41360 299
312 3300049823 Ga0501044_0001064 Ga0501044_0001064_4438_5412 299
313 3300049824 Ga0501045_0067513 Ga0501045_0067513_930_1904 299
314 3300050512 nmdc:mga0n895_6543_c1 nmdc:mga0n895_6543_c1_8669_9637 299
315 3300054114 Ga0501084_0001986 Ga0501084_0001986_5168_6142 299
316 3300060353 Ga0501082_0016806 Ga0501082_0016806_78_1052 299
317 3300053153 Ga0500616_0000034 Ga0500616_0000034_289776_290744 300
318 3300005618 Ga0068864_100352679 Ga0068864_1003526792 301
319 3300006871 Ga0075434_100122913 Ga0075434_1001229132 301
320 3300009177 Ga0105248_10101265 Ga0105248_101012653 301
321 3300009545 Ga0105237_10136799 Ga0105237_101367992 301
322 3300025900 Ga0207710_10052194 Ga0207710_100521942 301
323 3300025931 Ga0207644_10218011 Ga0207644_102180111 301
324 3300025949 Ga0207667_10223048 Ga0207667_102230482 301
325 3300026067 Ga0207678_10007212 Ga0207678_100072124 301
326 3300048915 Ga0496112_0241052 Ga0496112_0241052_699_1667 301
327 3300049582 Ga0501048_0000022 Ga0501048_0000022_21491_22465 301
328 3300050512 nmdc:mga0n895_228832_c1 nmdc:mga0n895_228832_c1_614_1582 301
329 3300005937 Ga0081455_10119730 Ga0081455_101197302 302
330 3300048929 Ga0496126_0194465 Ga0496126_0194465_442_1410 302
331 3300053087 Ga0500643_000046 Ga0500643_000046_82217_83185 302
332 3300053092 Ga0500583_0037675 Ga0500583_0037675_533_1504 302
333 3300053103 Ga0500555_012563 Ga0500555_012563_878_1849 302
334 3300053139 Ga0500568_0008904 Ga0500568_0008904_324_1292 302
335 3300053161 Ga0500634_0104618 Ga0500634_0104618_238_1209 302
336 3300013104 Ga0157370_10043441 Ga0157370_100434413 303
337 3300013307 Ga0157372_10428630 Ga0157372_104286302 303
338 3300025297 Ga0209758_1003610 Ga0209758_10036106 306
339 3300005339 Ga0070660_100188978 Ga0070660_1001889781 307
340 3300005530 Ga0070679_100379164 Ga0070679_1003791642 307
341 3300005616 Ga0068852_100109398 Ga0068852_1001093982 307
342 3300009551 Ga0105238_10250583 Ga0105238_102505832 307
343 3300026142 Ga0207698_10126059 Ga0207698_101260592 307
344 3300047317 Ga0495604_0159387 Ga0495604_0159387_291_1571 307
345 3300049579 Ga0501043_0178711 Ga0501043_0178711_652_1620 307
346 3300049822 Ga0501035_0172819 Ga0501035_0172819_354_1322 307
347 3300028379 Ga0268266_10227592 Ga0268266_102275922 309
348 3300048911 Ga0496108_0312184 Ga0496108_0312184_340_1308 310
349 3300025913 Ga0207695_10062924 Ga0207695_100629242 312
350 3300037466 Ga0395898_0553571 Ga0395898_0553571_52_1020 312
351 3300038443 Ga0395901_0190471 Ga0395901_0190471_1165_2133 312
352 3300025295 Ga0209564_1000390 Ga0209564_100039021 313
353 3300044684 Ga0466966_0082034 Ga0466966_0082034_1009_1977 313
354 3300027671 Ga0209588_1015010 Ga0209588_10150101 314
355 3300025261 Ga0209233_1020676 Ga0209233_10206762 316
356 3300053077 Ga0495601_0186288 Ga0495601_0186288_47_1015 316
357 iso_pu_bacteria 2841983080 2841988930 317
358 iso_pu_bacteria 2507262055 2507507866 318
359 iso_pu_bacteria 2513237096 2513653840 318
360 iso_pu_bacteria 2513237098 2513677685 318
361 iso_pu_bacteria 2513237101 2513695714 318
362 iso_pu_bacteria 2513237137 2513856279 318
363 iso_pu_bacteria 2513237141 2513891454 318
364 iso_pu_bacteria 2513237145 2513918180 318
365 iso_pu_bacteria 2513237161 2514009631 318
366 iso_pu_bacteria 2517093001 2517103940 318
367 iso_pu_bacteria 2517572143 2517891582 318
368 iso_pu_bacteria 2524023210 2524463546 318
369 iso_pu_bacteria 2524023228 2524538656 318
370 iso_pu_bacteria 2617270741 2617372509 318
371 iso_pu_bacteria 2667528175 2671118646 318
372 iso_pu_bacteria 2721755755 2723846961 318
373 iso_pu_bacteria 2728368998 2728749350 318
374 iso_pu_bacteria 2791355196 2793064548 318
375 iso_pu_bacteria 2791355197 2793066942 318
376 iso_pu_bacteria 2824600985 2824608722 318
377 iso_pu_bacteria 2824609381 2824613524 318
378 iso_pu_bacteria 2824617872 2824622854 318
379 iso_pu_bacteria 2824626560 2824631995 318
380 iso_pu_bacteria 2824635225 2824638574 318
381 iso_pu_bacteria 2824644064 2824647720 318
382 iso_pu_bacteria 2824653114 2824659331 318
383 iso_pu_bacteria 2824671348 2824675006 318
384 iso_pu_bacteria 2824679649 2824681476 318
385 iso_pu_bacteria 2824687955 2824693371 318
386 iso_pu_bacteria 2824714736 2824716228 318
387 iso_pu_bacteria 2824723954 2824726804 318
388 iso_pu_bacteria 2824773399 2824777345 318
389 iso_pu_bacteria 2838122688 2838122862 318
390 iso_pu_bacteria 2841941048 2841944850 318
391 iso_pu_bacteria 2841949485 2841950875 318
392 iso_pu_bacteria 2841957949 2841959901 318
393 iso_pu_bacteria 2841966195 2841973673 318
394 iso_pu_bacteria 2841974524 2841978568 318
395 iso_pu_bacteria 2849076700 2849078586 318
396 iso_pu_bacteria 2874604998 2874611074 318
397 iso_pu_bacteria 2876808645 2876817269 318
398 iso_pu_bacteria 2879110137 2879114509 318
399 iso_pu_bacteria 2879142872 2879148435 318
400 iso_pu_bacteria 2881364244 2881364743 318
401 iso_pu_bacteria 2883577096 2883577594 318
402 iso_pu_bacteria 2885374607 2885381643 318
403 iso_pu_bacteria 2885409591 2885409823 318
404 iso_pu_bacteria 2888419890 2888425402 318
405 iso_pu_bacteria 2889033259 2889038228 318
406 iso_pu_bacteria 2903748898 2903755238 318
407 iso_pu_bacteria 2903768456 2903772889 318
408 iso_pu_bacteria 2904690495 2904694433 318
409 iso_pu_bacteria 2904699407 2904704699 318
410 iso_pu_bacteria 2906610324 2906616756 318
411 iso_pu_bacteria 2906635258 2906640165 318
412 iso_pu_bacteria 2906643746 2906646931 318
413 iso_pu_bacteria 2906660503 2906667085 318
414 iso_pu_bacteria 2908739725 2908741929 318
415 iso_pu_bacteria 2908756301 2908759622 318
416 iso_pu_bacteria 2922361189 2922362653 318
417 iso_pu_bacteria 2922386360 2922387533 318
418 iso_pu_bacteria 2922393267 2922397272 318
419 iso_pu_bacteria 2922425934 2922431184 318
420 iso_pu_bacteria 2929615660 2929620450 318
421 iso_pu_bacteria 2929624759 2929626343 318
422 iso_pu_bacteria 2933577622 2933582368 318
423 iso_pu_bacteria 2935630451 2935633812 318
424 iso_pu_bacteria 2941507105 2941510885 318
425 iso_pu_bacteria 2941515067 2941518269 318
426 iso_pu_bacteria 2941523033 2941526860 318
427 iso_pu_bacteria 3005474847 3005481001 318
428 iso_pu_bacteria 3005587118 3005587255 318
429 iso_pu_bacteria 3005594810 3005600041 318
430 iso_pu_bacteria 3005718088 3005722964 318
431 iso_pu_bacteria 8006933436 8006939703 318
432 iso_pu_bacteria 8006964411 8006968467 318
433 iso_pu_bacteria 8006973647 8006979452 318
434 iso_pu_bacteria 8006984368 8006987402 318
435 iso_pu_bacteria 8006994254 8006994905 318
436 iso_pu_bacteria 8019555841 8019565598 318
437 iso_pu_bacteria 8019565922 8019575692 318
438 iso_pu_bacteria 8019659431 8019661399 318
439 iso_pu_bacteria 8055742211 8055745312 318
440 iso_pu_bacteria 8056673599 8056679475 318
441 iso_pu_bacteria 8056681323 8056684995 318
442 iso_pu_bacteria 8056689827 8056693457 318
443 3300007265 Ga0099794_10125561 Ga0099794_101255612 319
444 3300005329 Ga0070683_100091955 Ga0070683_1000919552 322
445 3300005336 Ga0070680_100066425 Ga0070680_1000664252 322
446 3300005336 Ga0070680_100106009 Ga0070680_1001060092 322
447 3300005339 Ga0070660_100016099 Ga0070660_1000160992 322
448 3300005435 Ga0070714_100008845 Ga0070714_1000088458 322
449 3300005435 Ga0070714_100088105 Ga0070714_1000881053 322
450 3300005435 Ga0070714_100219322 Ga0070714_1002193222 322
451 3300005436 Ga0070713_100121064 Ga0070713_1001210643 322
452 3300005437 Ga0070710_10000708 Ga0070710_1000070812 322
453 3300005439 Ga0070711_100070979 Ga0070711_1000709792 322
454 3300005455 Ga0070663_100253703 Ga0070663_1002537032 322
455 3300005456 Ga0070678_100179583 Ga0070678_1001795832 322
456 3300005458 Ga0070681_10145484 Ga0070681_101454842 322
457 3300005467 Ga0070706_100060174 Ga0070706_1000601743 322
458 3300005530 Ga0070679_100222919 Ga0070679_1002229192 322
459 3300005539 Ga0068853_100055695 Ga0068853_1000556953 322
460 3300005539 Ga0068853_100227659 Ga0068853_1002276592 322
461 3300005563 Ga0068855_100109884 Ga0068855_1001098842 322
462 3300005563 Ga0068855_100125665 Ga0068855_1001256652 322
463 3300005563 Ga0068855_100259195 Ga0068855_1002591952 322
464 3300005563 Ga0068855_100357908 Ga0068855_1003579082 322
465 3300005834 Ga0068851_10017694 Ga0068851_100176942 322
466 3300005841 Ga0068863_100281933 Ga0068863_1002819332 322
467 3300005842 Ga0068858_100160769 Ga0068858_1001607692 322
468 3300005843 Ga0068860_100000471 Ga0068860_10000047112 322
469 3300005983 Ga0081540_1016036 Ga0081540_10160362 322
470 3300006028 Ga0070717_10077668 Ga0070717_100776683 322
471 3300006173 Ga0070716_100006048 Ga0070716_1000060486 322
472 3300009093 Ga0105240_10177078 Ga0105240_101770782 322
473 3300009093 Ga0105240_10436842 Ga0105240_104368422 322
474 3300009101 Ga0105247_10005426 Ga0105247_100054267 322
475 3300009545 Ga0105237_10056507 Ga0105237_100565073 322
476 3300009551 Ga0105238_10024830 Ga0105238_100248303 322
477 3300009551 Ga0105238_10250765 Ga0105238_102507652 322
478 3300010375 Ga0105239_10043806 Ga0105239_100438063 322
479 3300013105 Ga0157369_10011746 Ga0157369_100117467 322
480 3300013296 Ga0157374_10034436 Ga0157374_100344362 322
481 3300025297 Ga0209758_1004758 Ga0209758_10047589 322
482 3300025898 Ga0207692_10007642 Ga0207692_100076423 322
483 3300025900 Ga0207710_10008835 Ga0207710_100088354 322
484 3300025910 Ga0207684_10052020 Ga0207684_100520202 322
485 3300025912 Ga0207707_10049332 Ga0207707_100493322 322
486 3300025912 Ga0207707_10370869 Ga0207707_103708692 322
487 3300025913 Ga0207695_10432675 Ga0207695_104326752 322
488 3300025914 Ga0207671_10089913 Ga0207671_100899131 322
489 3300025915 Ga0207693_10002843 Ga0207693_100028432 322
490 3300025915 Ga0207693_10152974 Ga0207693_101529742 322
491 3300025916 Ga0207663_10002786 Ga0207663_100027863 322
492 3300025917 Ga0207660_10019450 Ga0207660_100194504 322
493 3300025917 Ga0207660_10419381 Ga0207660_104193811 322
494 3300025919 Ga0207657_10013488 Ga0207657_100134883 322
495 3300025921 Ga0207652_10019069 Ga0207652_100190692 322
496 3300025924 Ga0207694_10046849 Ga0207694_100468492 322
497 3300025928 Ga0207700_10044345 Ga0207700_100443452 322
498 3300025928 Ga0207700_10048261 Ga0207700_100482613 322
499 3300025929 Ga0207664_10023663 Ga0207664_100236636 322
500 3300025929 Ga0207664_10025806 Ga0207664_100258061 322
501 3300025929 Ga0207664_10369767 Ga0207664_103697671 322
502 3300025939 Ga0207665_10005334 Ga0207665_100053342 322
503 3300025949 Ga0207667_10045963 Ga0207667_100459633 322
504 3300025949 Ga0207667_10422432 Ga0207667_104224322 322
505 3300026035 Ga0207703_10280566 Ga0207703_102805662 322
506 3300026041 Ga0207639_10061108 Ga0207639_100611082 322
507 3300026041 Ga0207639_10394740 Ga0207639_103947402 322
508 3300026088 Ga0207641_10479857 Ga0207641_104798571 322
509 3300026089 Ga0207648_10163419 Ga0207648_101634192 322
510 3300026116 Ga0207674_10547330 Ga0207674_105473301 322
511 3300026142 Ga0207698_10300397 Ga0207698_103003972 322
512 3300028380 Ga0268265_10120862 Ga0268265_101208622 322
513 3300028381 Ga0268264_10000048 Ga0268264_10000048254 322
514 3300028653 Ga0265323_10027004 Ga0265323_100270043 322
515 3300028666 Ga0265336_10002023 Ga0265336_100020237 322
516 3300028800 Ga0265338_10000034 Ga0265338_1000003420 322
517 3300031249 Ga0265339_10019603 Ga0265339_100196033 322
518 3300031507 Ga0307509_10017893 Ga0307509_100178939 322
519 3300031507 Ga0307509_10074154 Ga0307509_100741543 322
520 3300031616 Ga0307508_10158265 Ga0307508_101582653 322
521 3300031730 Ga0307516_10079612 Ga0307516_100796122 322
522 3300031730 Ga0307516_10113310 Ga0307516_101133102 322
523 3300033179 Ga0307507_10030513 Ga0307507_100305136 322
524 3300035170 Ga0373943_0074817 Ga0373943_0074817_316_1284 322
525 3300035695 Ga0373927_0004705 Ga0373927_0004705_3062_4030 322
526 3300035695 Ga0373927_0006809 Ga0373927_0006809_5287_6255 322
527 3300035725 Ga0373947_0053958 Ga0373947_0053958_346_1314 322
528 3300035725 Ga0373947_0114144 Ga0373947_0114144_26_994 322
529 3300036401 Ga0373937_0094825 Ga0373937_0094825_796_1764 322
530 3300037068 Ga0373925_0057037 Ga0373925_0057037_461_1429 322
531 3300037068 Ga0373925_0074965 Ga0373925_0074965_1074_2042 322
532 3300037853 Ga0436364_0563114 Ga0436364_0563114_363_1331 322
533 3300046455 Ga0495603_0012346 Ga0495603_0012346_694_1662 322
534 3300046455 Ga0495603_0105380 Ga0495603_0105380_481_1449 322
535 3300046472 Ga0495580_0038757 Ga0495580_0038757_2094_3062 322
536 3300046518 Ga0495631_0109839 Ga0495631_0109839_50_1018 322
537 3300046557 Ga0495622_0060991 Ga0495622_0060991_199_1167 322
538 3300046678 Ga0495599_0040564 Ga0495599_0040564_1844_2821 322
539 3300048909 Ga0496106_0001121 Ga0496106_0001121_4301_5269 322
540 3300048914 Ga0496111_0005833 Ga0496111_0005833_1833_2801 322
541 3300048915 Ga0496112_0026322 Ga0496112_0026322_3224_4192 322
542 3300048918 Ga0496115_0029851 Ga0496115_0029851_1641_2609 322
543 3300048918 Ga0496115_0390914 Ga0496115_0390914_109_1077 322
544 3300048920 Ga0496117_0091713 Ga0496117_0091713_397_1365 322
545 3300048921 Ga0496118_0006738 Ga0496118_0006738_3317_4285 322
546 3300048922 Ga0496119_0030642 Ga0496119_0030642_1828_2796 322
547 3300048924 Ga0496121_0005409 Ga0496121_0005409_15233_16201 322
548 3300048924 Ga0496121_0014219 Ga0496121_0014219_6562_7530 322
549 3300048924 Ga0496121_0026682 Ga0496121_0026682_4050_5018 322
550 3300048924 Ga0496121_0094400 Ga0496121_0094400_485_1453 322
551 3300048927 Ga0496124_0052593 Ga0496124_0052593_11_979 322
552 3300048928 Ga0496125_0000040 Ga0496125_0000040_301582_302556 322
553 3300048929 Ga0496126_0005981 Ga0496126_0005981_11711_12679 322
554 3300049568 Ga0501031_0200539 Ga0501031_0200539_228_1196 322
555 3300049570 Ga0501033_0041227 Ga0501033_0041227_1841_2809 322
556 3300049570 Ga0501033_0106426 Ga0501033_0106426_106_1074 322
557 3300049571 Ga0501034_0179401 Ga0501034_0179401_520_1488 322
558 3300049572 Ga0501036_0165755 Ga0501036_0165755_53_1021 322
559 3300049575 Ga0501039_0361440 Ga0501039_0361440_144_1112 322
560 3300049579 Ga0501043_0065543 Ga0501043_0065543_668_1636 322
561 3300049580 Ga0501046_0032068 Ga0501046_0032068_3215_4183 322
562 3300049581 Ga0501047_0132080 Ga0501047_0132080_165_1133 322
563 3300049823 Ga0501044_0002044 Ga0501044_0002044_21688_22656 322
564 3300049823 Ga0501044_0111045 Ga0501044_0111045_60_1031 322
565 3300050493 nmdc:mga0k408_157891_c1 nmdc:mga0k408_157891_c1_262_1230 322
566 3300050511 nmdc:mga08y16_137652_c1 nmdc:mga08y16_137652_c1_227_1195 322
567 3300053140 Ga0500573_0122294 Ga0500573_0122294_330_1307 322
568 3300053148 Ga0500590_118112 Ga0500590_118112_262_1230 322
569 3300053162 Ga0500638_107593 Ga0500638_107593_244_1221 322
570 3300053177 Ga0500636_0163531 Ga0500636_0163531_148_1125 322
571 3300053735 Ga0500596_008375 Ga0500596_008375_445_1413 322
572 3300003203 JGI25406J46586_10000021 JGI25406J46586_1000002114 324
573 3300005985 Ga0081539_10000051 Ga0081539_10000051107 324
574 3300038443 Ga0395901_0195365 Ga0395901_0195365_1134_2108 324
575 3300046507 Ga0495606_0010333 Ga0495606_0010333_2808_3782 324
576 3300047469 Ga0495673_0019752 Ga0495673_0019752_2380_3354 324
577 3300048915 Ga0496112_0000004 Ga0496112_0000004_455547_456521 324
578 3300048929 Ga0496126_0008347 Ga0496126_0008347_5638_6612 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

177

308

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

210

350

0.85

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

52

136

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9096 2 324
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9042 2 324
4a27-assembly1.cif.gz_B crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8984 1 323
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.8922 2 323
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8911 1 324
ID Description Score Start End Superfamily
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 128 237 3.40.50.720
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9135 1 324 3.90.180.10
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9108 1 324 3.90.180.10
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9092 1 323 3.90.180.10
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.904 126 263 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9365 121 235 GO:0016491
AF-A0A4U9HK34-F1-model_v4 Quinone oxidoreductase 1 (EC 1.6.5.5) 0.9287 67 235 GO:0003960
GO:0070402
AF-A0A522TED3-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9214 1 324 GO:0016651
GO:0070402
AF-A0A355F2Z3-F1-model_v4 NAD(P)H quinone oxidoreductase, PIG3 family protein 0.9197 16 324 GO:0016651
GO:0070402
AF-A0A0A0BYB4-F1-model_v4 NADPH:quinone oxidoreductase 0.9195 137 324 GO:0016651
GO:0070402

Feature Viewer

pLDDT pTM Quality
88.95 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map