F465723
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 381 | 492 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10250765|Ga0105238_102507652 |
| Length | 352 |
| Sequence | MGPNCGLILRDAAGAAPQDEGFADNKRNDPMKAYVYGANGAAITDVPKPAPKGTQVLVKVHACGLNRADLGMTKGHAHGAAGGVGTVLGMEWAGEVAELGPDAKGVKVGDKIMGSGGSAFAEYTLADHGRLFRAPSNMNFDEAATLPVALATMHNAVVTNGALQPGQSVMIQGASSGVGLMAMQIAKLKGAKLVVGSSTDPYRRGRLKEFGADLAVDSSDPGWVDEVLKATNGEGVDLIVDQVSGKVMNQNLAATKIKGRIVNVGRLGGTRAEFNFDLHAARRISYIGVTFRTRSIEEVREIFDEVRRDIWGAVESRKLQLPIDKVYKFEDIGKAFEHMEANKHLGKIVVTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 9 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 12 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 15 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 16 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 19 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 20 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 26 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 27 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 28 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 29 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 30 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 31 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 32 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 33 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 34 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 35 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 36 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 37 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 38 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 39 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 40 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 41 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 42 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 43 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 44 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 45 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 46 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 47 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 48 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 49 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 50 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 51 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 52 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 53 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 54 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 55 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 56 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 57 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 58 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 59 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 60 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 61 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 62 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 63 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 64 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 65 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 66 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 67 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 68 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 69 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 70 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 71 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 72 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 74 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 127 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 240 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 343 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 344 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 345 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 350 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 352 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 358 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 362 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 365 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 367 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 371 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 372 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 373 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 374 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 375 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 376 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 377 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 378 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 379 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 380 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 381 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.57 |
| Metatranscriptomes | 0 |
| Isolates | 14.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.25 |
| Nodule | 10.55 |
| Rhizoplane | 6.06 |
| Rhizosphere | 58.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000021 | 3300003203 | Bacteria | 84514 |
| 2 | JGI25406J46586_10016723 | 3300003203 | Bacteria | 3051 |
| 3 | JGI25160J50197_1006462 | 3300003354 | Bacteria | 4742 |
| 4 | JGI25404J52841_10023995 | 3300003659 | Bacteria | 1315 |
| 5 | Ga0065165_1001283 | 3300005262 | Bacteria | 28362 |
| 6 | Ga0070658_10443915 | 3300005327 | Bacteria | 1117 |
| 7 | Ga0070683_100020392 | 3300005329 | Bacteria | 5899 |
| 8 | Ga0070683_100091955 | 3300005329 | Bacteria | 2849 |
| 9 | Ga0070683_100142442 | 3300005329 | Bacteria | 2271 |
| 10 | Ga0070680_100062296 | 3300005336 | Bacteria | 3054 |
| 11 | Ga0070680_100066425 | 3300005336 | Bacteria | 2957 |
| 12 | Ga0070680_100106009 | 3300005336 | Bacteria | 2337 |
| 13 | Ga0070682_100018684 | 3300005337 | Bacteria | 4056 |
| 14 | Ga0070660_100016099 | 3300005339 | Bacteria | 5420 |
| 15 | Ga0070660_100188978 | 3300005339 | Bacteria | 1668 |
| 16 | Ga0070674_100052465 | 3300005356 | Bacteria | 2813 |
| 17 | Ga0070709_10017401 | 3300005434 | Bacteria | 4122 |
| 18 | Ga0070714_100008845 | 3300005435 | Bacteria | 7876 |
| 19 | Ga0070714_100011360 | 3300005435 | Bacteria | 7065 |
| 20 | Ga0070714_100088105 | 3300005435 | Bacteria | 2715 |
| 21 | Ga0070714_100219322 | 3300005435 | Bacteria | 1747 |
| 22 | Ga0070713_100003607 | 3300005436 | Bacteria | 10231 |
| 23 | Ga0070713_100007249 | 3300005436 | Bacteria | 7765 |
| 24 | Ga0070713_100112787 | 3300005436 | Bacteria | 2373 |
| 25 | Ga0070713_100121064 | 3300005436 | Bacteria | 2295 |
| 26 | Ga0070710_10000708 | 3300005437 | Bacteria | 15866 |
| 27 | Ga0070710_10003983 | 3300005437 | Bacteria | 7002 |
| 28 | Ga0070710_10007420 | 3300005437 | Bacteria | 5310 |
| 29 | Ga0070711_100010293 | 3300005439 | Bacteria | 5784 |
| 30 | Ga0070711_100067656 | 3300005439 | Bacteria | 2507 |
| 31 | Ga0070711_100070979 | 3300005439 | Bacteria | 2453 |
| 32 | Ga0070708_100092186 | 3300005445 | Bacteria | 2760 |
| 33 | Ga0070663_100053860 | 3300005455 | Bacteria | 2873 |
| 34 | Ga0070663_100253703 | 3300005455 | Bacteria | 1393 |
| 35 | Ga0070678_100179583 | 3300005456 | Bacteria | 1731 |
| 36 | Ga0070681_10145484 | 3300005458 | Bacteria | 2299 |
| 37 | Ga0068867_100026289 | 3300005459 | Bacteria | 4179 |
| 38 | Ga0070706_100060174 | 3300005467 | Bacteria | 3506 |
| 39 | Ga0070707_100106031 | 3300005468 | Bacteria | 2725 |
| 40 | Ga0070698_100163268 | 3300005471 | Bacteria | 2171 |
| 41 | Ga0070679_100043461 | 3300005530 | Bacteria | 4476 |
| 42 | Ga0070679_100055274 | 3300005530 | Bacteria | 3953 |
| 43 | Ga0070679_100222919 | 3300005530 | Bacteria | 1846 |
| 44 | Ga0070679_100379164 | 3300005530 | Bacteria | 1361 |
| 45 | Ga0070684_100011602 | 3300005535 | Bacteria | 7022 |
| 46 | Ga0068853_100055695 | 3300005539 | Bacteria | 3408 |
| 47 | Ga0068853_100227659 | 3300005539 | Bacteria | 1705 |
| 48 | Ga0070665_100386310 | 3300005548 | Bacteria | 1407 |
| 49 | Ga0068855_100109884 | 3300005563 | Bacteria | 3165 |
| 50 | Ga0068855_100125665 | 3300005563 | Bacteria | 2933 |
| 51 | Ga0068855_100259195 | 3300005563 | Bacteria | 1938 |
| 52 | Ga0068855_100357908 | 3300005563 | Bacteria | 1606 |
| 53 | Ga0068854_100156385 | 3300005578 | Bacteria | 1762 |
| 54 | Ga0068856_100023694 | 3300005614 | Bacteria | 5969 |
| 55 | Ga0068852_100109398 | 3300005616 | Bacteria | 2510 |
| 56 | Ga0068864_100352679 | 3300005618 | Bacteria | 1388 |
| 57 | Ga0068866_10053236 | 3300005718 | Bacteria | 2069 |
| 58 | Ga0068861_100252161 | 3300005719 | Bacteria | 1506 |
| 59 | Ga0068851_10017694 | 3300005834 | Bacteria | 3427 |
| 60 | Ga0068863_100281933 | 3300005841 | Bacteria | 1610 |
| 61 | Ga0068858_100160769 | 3300005842 | Bacteria | 2115 |
| 62 | Ga0068858_100242536 | 3300005842 | Bacteria | 1710 |
| 63 | Ga0068860_100000471 | 3300005843 | Bacteria | 50128 |
| 64 | Ga0068862_100058558 | 3300005844 | Bacteria | 3304 |
| 65 | Ga0081455_10069621 | 3300005937 | Bacteria | 2925 |
| 66 | Ga0081455_10119730 | 3300005937 | Bacteria | 2076 |
| 67 | Ga0081455_10160945 | 3300005937 | Bacteria | 1721 |
| 68 | Ga0081540_1004707 | 3300005983 | Bacteria | 10325 |
| 69 | Ga0081540_1005778 | 3300005983 | Bacteria | 9157 |
| 70 | Ga0081540_1016036 | 3300005983 | Bacteria | 4715 |
| 71 | Ga0081540_1023016 | 3300005983 | Bacteria | 3661 |
| 72 | Ga0081540_1089534 | 3300005983 | Bacteria | 1357 |
| 73 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 74 | Ga0081539_10000148 | 3300005985 | Bacteria | 163442 |
| 75 | Ga0081539_10009620 | 3300005985 | Bacteria | 8026 |
| 76 | Ga0081539_10027637 | 3300005985 | Bacteria | 3588 |
| 77 | Ga0070717_10000402 | 3300006028 | Bacteria | 27731 |
| 78 | Ga0070717_10077668 | 3300006028 | Bacteria | 2781 |
| 79 | Ga0075365_10089588 | 3300006038 | Bacteria | 2094 |
| 80 | Ga0075363_100063425 | 3300006048 | Bacteria | 1994 |
| 81 | Ga0075363_100139562 | 3300006048 | Bacteria | 1364 |
| 82 | Ga0075364_10045080 | 3300006051 | Bacteria | 2870 |
| 83 | Ga0070715_10045714 | 3300006163 | Bacteria | 1858 |
| 84 | Ga0070716_100006048 | 3300006173 | Bacteria | 5897 |
| 85 | Ga0070716_100101461 | 3300006173 | Bacteria | 1765 |
| 86 | Ga0070716_100112940 | 3300006173 | Bacteria | 1687 |
| 87 | Ga0070712_100008186 | 3300006175 | Bacteria | 6567 |
| 88 | Ga0070712_100037180 | 3300006175 | Bacteria | 3317 |
| 89 | Ga0075362_10078256 | 3300006177 | Bacteria | 1521 |
| 90 | Ga0075367_10057509 | 3300006178 | Bacteria | 2312 |
| 91 | Ga0075369_10024782 | 3300006186 | Bacteria | 2489 |
| 92 | Ga0075370_10032834 | 3300006353 | Bacteria | 2903 |
| 93 | Ga0075434_100024593 | 3300006871 | Bacteria | 5889 |
| 94 | Ga0075434_100122913 | 3300006871 | Bacteria | 2612 |
| 95 | Ga0099824_1031084 | 3300006942 | Bacteria | 2066 |
| 96 | Ga0099822_1001873 | 3300006943 | Bacteria | 25386 |
| 97 | Ga0075435_100021468 | 3300007076 | Bacteria | 4967 |
| 98 | Ga0099794_10125561 | 3300007265 | Bacteria | 1294 |
| 99 | Ga0105240_10177078 | 3300009093 | Bacteria | 2521 |
| 100 | Ga0105240_10436842 | 3300009093 | Bacteria | 1467 |
| 101 | Ga0105247_10005426 | 3300009101 | Bacteria | 8033 |
| 102 | Ga0105241_10508225 | 3300009174 | Bacteria | 1076 |
| 103 | Ga0105248_10101265 | 3300009177 | Bacteria | 3247 |
| 104 | Ga0105237_10056507 | 3300009545 | Bacteria | 3929 |
| 105 | Ga0105237_10136799 | 3300009545 | Bacteria | 2444 |
| 106 | Ga0105238_10024830 | 3300009551 | Bacteria | 6108 |
| 107 | Ga0105238_10250583 | 3300009551 | Bacteria | 1749 |
| 108 | Ga0105238_10250765 | 3300009551 | Bacteria | 1748 |
| 109 | Ga0105239_10043806 | 3300010375 | Bacteria | 4907 |
| 110 | Ga0157335_1000871 | 3300012492 | Bacteria | 1514 |
| 111 | Ga0157370_10043441 | 3300013104 | Bacteria | 4325 |
| 112 | Ga0157370_10148417 | 3300013104 | Bacteria | 2183 |
| 113 | Ga0157369_10011746 | 3300013105 | Bacteria | 9942 |
| 114 | Ga0157369_10024696 | 3300013105 | Bacteria | 6679 |
| 115 | Ga0157369_10466917 | 3300013105 | Bacteria | 1307 |
| 116 | Ga0157374_10034436 | 3300013296 | Bacteria | 4626 |
| 117 | Ga0157374_10100276 | 3300013296 | Bacteria | 2776 |
| 118 | Ga0157378_10025057 | 3300013297 | Bacteria | 5255 |
| 119 | Ga0163162_10417115 | 3300013306 | Bacteria | 1475 |
| 120 | Ga0157372_10428630 | 3300013307 | Bacteria | 1541 |
| 121 | Ga0157375_10164872 | 3300013308 | Bacteria | 2360 |
| 122 | Ga0163163_10581492 | 3300014325 | Bacteria | 1183 |
| 123 | Ga0213876_10000670 | 3300021384 | Bacteria | 24379 |
| 124 | Ga0209233_1020676 | 3300025261 | Bacteria | 1719 |
| 125 | Ga0209564_1000390 | 3300025295 | Bacteria | 78822 |
| 126 | Ga0209758_1003610 | 3300025297 | Bacteria | 13850 |
| 127 | Ga0209758_1004758 | 3300025297 | Bacteria | 11016 |
| 128 | Ga0209758_1007379 | 3300025297 | Bacteria | 7515 |
| 129 | Ga0209758_1008034 | 3300025297 | Bacteria | 6970 |
| 130 | Ga0209758_1014022 | 3300025297 | Bacteria | 4308 |
| 131 | Ga0209758_1038002 | 3300025297 | Bacteria | 1852 |
| 132 | Ga0207426_1000574 | 3300025302 | Bacteria | 49411 |
| 133 | Ga0207426_1000837 | 3300025302 | Bacteria | 32586 |
| 134 | Ga0207692_10007642 | 3300025898 | Bacteria | 4435 |
| 135 | Ga0207692_10013743 | 3300025898 | Bacteria | 3520 |
| 136 | Ga0207642_10048609 | 3300025899 | Bacteria | 1902 |
| 137 | Ga0207710_10008835 | 3300025900 | Bacteria | 4242 |
| 138 | Ga0207710_10052194 | 3300025900 | Bacteria | 1838 |
| 139 | Ga0207688_10059228 | 3300025901 | Bacteria | 2157 |
| 140 | Ga0207680_10153454 | 3300025903 | Bacteria | 1537 |
| 141 | Ga0207647_10112567 | 3300025904 | Bacteria | 1608 |
| 142 | Ga0207685_10047408 | 3300025905 | Bacteria | 1640 |
| 143 | Ga0207699_10040745 | 3300025906 | Bacteria | 2678 |
| 144 | Ga0207684_10052020 | 3300025910 | Bacteria | 3475 |
| 145 | Ga0207654_10115909 | 3300025911 | Bacteria | 1674 |
| 146 | Ga0207707_10007987 | 3300025912 | Bacteria | 9192 |
| 147 | Ga0207707_10049332 | 3300025912 | Bacteria | 3667 |
| 148 | Ga0207707_10370869 | 3300025912 | Bacteria | 1231 |
| 149 | Ga0207695_10062924 | 3300025913 | Bacteria | 3827 |
| 150 | Ga0207695_10255184 | 3300025913 | Bacteria | 1652 |
| 151 | Ga0207695_10432675 | 3300025913 | Bacteria | 1199 |
| 152 | Ga0207671_10089913 | 3300025914 | Bacteria | 2312 |
| 153 | Ga0207671_10246522 | 3300025914 | Bacteria | 1404 |
| 154 | Ga0207693_10001058 | 3300025915 | Bacteria | 24605 |
| 155 | Ga0207693_10002843 | 3300025915 | Bacteria | 15000 |
| 156 | Ga0207693_10022562 | 3300025915 | Bacteria | 5001 |
| 157 | Ga0207693_10105736 | 3300025915 | Bacteria | 2207 |
| 158 | Ga0207693_10152974 | 3300025915 | Bacteria | 1815 |
| 159 | Ga0207663_10002609 | 3300025916 | Bacteria | 8675 |
| 160 | Ga0207663_10002786 | 3300025916 | Bacteria | 8431 |
| 161 | Ga0207663_10115576 | 3300025916 | Bacteria | 1828 |
| 162 | Ga0207663_10137978 | 3300025916 | Bacteria | 1695 |
| 163 | Ga0207663_10254420 | 3300025916 | Bacteria | 1294 |
| 164 | Ga0207660_10019450 | 3300025917 | Bacteria | 4540 |
| 165 | Ga0207660_10419381 | 3300025917 | Bacteria | 1079 |
| 166 | Ga0207662_10158406 | 3300025918 | Bacteria | 1445 |
| 167 | Ga0207657_10013488 | 3300025919 | Bacteria | 8014 |
| 168 | Ga0207652_10019069 | 3300025921 | Bacteria | 5635 |
| 169 | Ga0207652_10050398 | 3300025921 | Bacteria | 3567 |
| 170 | Ga0207652_10412294 | 3300025921 | Bacteria | 1219 |
| 171 | Ga0207646_10088457 | 3300025922 | Bacteria | 2772 |
| 172 | Ga0207694_10046849 | 3300025924 | Bacteria | 3342 |
| 173 | Ga0207687_10174475 | 3300025927 | Bacteria | 1661 |
| 174 | Ga0207700_10012252 | 3300025928 | Bacteria | 5521 |
| 175 | Ga0207700_10014889 | 3300025928 | Bacteria | 5110 |
| 176 | Ga0207700_10044345 | 3300025928 | Bacteria | 3273 |
| 177 | Ga0207700_10048261 | 3300025928 | Bacteria | 3160 |
| 178 | Ga0207664_10023663 | 3300025929 | Bacteria | 4605 |
| 179 | Ga0207664_10025806 | 3300025929 | Bacteria | 4433 |
| 180 | Ga0207664_10162118 | 3300025929 | Bacteria | 1908 |
| 181 | Ga0207664_10369767 | 3300025929 | Bacteria | 1271 |
| 182 | Ga0207644_10218011 | 3300025931 | Bacteria | 1511 |
| 183 | Ga0207690_10280649 | 3300025932 | Bacteria | 1297 |
| 184 | Ga0207706_10016927 | 3300025933 | Bacteria | 6576 |
| 185 | Ga0207669_10059747 | 3300025937 | Bacteria | 2333 |
| 186 | Ga0207665_10005334 | 3300025939 | Bacteria | 8591 |
| 187 | Ga0207665_10010410 | 3300025939 | Bacteria | 6108 |
| 188 | Ga0207665_10100792 | 3300025939 | Bacteria | 2016 |
| 189 | Ga0207691_10090453 | 3300025940 | Bacteria | 2743 |
| 190 | Ga0207661_10009413 | 3300025944 | Bacteria | 7006 |
| 191 | Ga0207667_10045963 | 3300025949 | Bacteria | 4623 |
| 192 | Ga0207667_10223048 | 3300025949 | Bacteria | 1931 |
| 193 | Ga0207667_10422432 | 3300025949 | Bacteria | 1356 |
| 194 | Ga0207668_10056602 | 3300025972 | Bacteria | 2731 |
| 195 | Ga0207658_10232301 | 3300025986 | Bacteria | 1558 |
| 196 | Ga0207703_10280566 | 3300026035 | Bacteria | 1513 |
| 197 | Ga0207639_10061108 | 3300026041 | Bacteria | 2908 |
| 198 | Ga0207639_10394740 | 3300026041 | Bacteria | 1245 |
| 199 | Ga0207678_10007212 | 3300026067 | Bacteria | 9854 |
| 200 | Ga0207678_10085267 | 3300026067 | Bacteria | 2701 |
| 201 | Ga0207678_10130926 | 3300026067 | Bacteria | 2140 |
| 202 | Ga0207702_10003237 | 3300026078 | Bacteria | 15044 |
| 203 | Ga0207641_10479857 | 3300026088 | Bacteria | 1205 |
| 204 | Ga0207648_10163419 | 3300026089 | Bacteria | 1967 |
| 205 | Ga0207674_10393525 | 3300026116 | Bacteria | 1339 |
| 206 | Ga0207674_10547330 | 3300026116 | Bacteria | 1118 |
| 207 | Ga0207683_10011530 | 3300026121 | Bacteria | 7545 |
| 208 | Ga0207698_10126059 | 3300026142 | Bacteria | 2178 |
| 209 | Ga0207698_10300397 | 3300026142 | Bacteria | 1494 |
| 210 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 211 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 212 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 213 | Ga0209588_1015010 | 3300027671 | Bacteria | 2379 |
| 214 | Ga0207428_10088058 | 3300027907 | Bacteria | 2415 |
| 215 | Ga0268266_10019183 | 3300028379 | Bacteria | 5823 |
| 216 | Ga0268266_10227592 | 3300028379 | Bacteria | 1716 |
| 217 | Ga0268265_10120862 | 3300028380 | Bacteria | 2157 |
| 218 | Ga0268265_10297071 | 3300028380 | Bacteria | 1452 |
| 219 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 220 | Ga0265323_10027004 | 3300028653 | Bacteria | 2159 |
| 221 | Ga0265336_10002023 | 3300028666 | Bacteria | 8653 |
| 222 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 223 | Ga0265328_10037150 | 3300031239 | Bacteria | 1799 |
| 224 | Ga0265329_10052548 | 3300031242 | Bacteria | 1296 |
| 225 | Ga0265340_10002448 | 3300031247 | Bacteria | 10562 |
| 226 | Ga0265339_10019603 | 3300031249 | Bacteria | 3968 |
| 227 | Ga0265339_10052502 | 3300031249 | Bacteria | 2220 |
| 228 | Ga0265339_10119678 | 3300031249 | Bacteria | 1355 |
| 229 | Ga0265316_10175752 | 3300031344 | Bacteria | 1596 |
| 230 | Ga0307509_10017893 | 3300031507 | Bacteria | 8139 |
| 231 | Ga0307509_10057532 | 3300031507 | Bacteria | 4122 |
| 232 | Ga0307509_10074154 | 3300031507 | Bacteria | 3540 |
| 233 | Ga0307509_10089606 | 3300031507 | Bacteria | 3154 |
| 234 | Ga0307508_10000003 | 3300031616 | Bacteria | 321602 |
| 235 | Ga0307508_10158265 | 3300031616 | Bacteria | 1868 |
| 236 | Ga0265314_10000412 | 3300031711 | Bacteria | 57508 |
| 237 | Ga0265314_10031282 | 3300031711 | Bacteria | 3932 |
| 238 | Ga0265314_10169392 | 3300031711 | Bacteria | 1320 |
| 239 | Ga0307516_10029440 | 3300031730 | Bacteria | 5553 |
| 240 | Ga0307516_10050482 | 3300031730 | Bacteria | 4081 |
| 241 | Ga0307516_10079612 | 3300031730 | Bacteria | 3121 |
| 242 | Ga0307516_10091060 | 3300031730 | Bacteria | 2878 |
| 243 | Ga0307516_10113310 | 3300031730 | Bacteria | 2510 |
| 244 | Ga0307413_10006633 | 3300031824 | Bacteria | 5308 |
| 245 | Ga0307410_10183178 | 3300031852 | Bacteria | 1587 |
| 246 | Ga0307409_100143463 | 3300031995 | Bacteria | 2061 |
| 247 | Ga0307416_100194684 | 3300032002 | Bacteria | 1916 |
| 248 | Ga0307411_10110610 | 3300032005 | Bacteria | 1965 |
| 249 | Ga0307415_100089816 | 3300032126 | Bacteria | 2220 |
| 250 | Ga0307507_10030513 | 3300033179 | Bacteria | 5686 |
| 251 | Ga0307510_10020754 | 3300033180 | Bacteria | 7670 |
| 252 | Ga0307510_10041569 | 3300033180 | Bacteria | 5023 |
| 253 | Ga0307510_10150176 | 3300033180 | Bacteria | 1951 |
| 254 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 255 | Ga0373923_0042435 | 3300035111 | Bacteria | 1879 |
| 256 | Ga0373936_0050404 | 3300035113 | Bacteria | 1684 |
| 257 | Ga0373943_0074817 | 3300035170 | Bacteria | 1723 |
| 258 | Ga0373931_0023120 | 3300035691 | Bacteria | 3136 |
| 259 | Ga0373935_0091029 | 3300035692 | Bacteria | 1997 |
| 260 | Ga0373927_0004705 | 3300035695 | Bacteria | 9513 |
| 261 | Ga0373927_0006809 | 3300035695 | Bacteria | 7774 |
| 262 | Ga0373927_0030173 | 3300035695 | Bacteria | 3538 |
| 263 | Ga0373933_0000062 | 3300035724 | Bacteria | 64991 |
| 264 | Ga0373933_0155585 | 3300035724 | Bacteria | 1450 |
| 265 | Ga0373947_0053958 | 3300035725 | Bacteria | 2425 |
| 266 | Ga0373947_0114144 | 3300035725 | Bacteria | 1710 |
| 267 | Ga0373937_0094825 | 3300036401 | Bacteria | 2767 |
| 268 | Ga0373937_0113241 | 3300036401 | Bacteria | 2524 |
| 269 | Ga0373937_0116659 | 3300036401 | Bacteria | 2486 |
| 270 | Ga0373925_0011279 | 3300037068 | Bacteria | 6482 |
| 271 | Ga0373925_0046835 | 3300037068 | Bacteria | 3216 |
| 272 | Ga0373925_0057037 | 3300037068 | Bacteria | 2926 |
| 273 | Ga0373925_0074965 | 3300037068 | Bacteria | 2563 |
| 274 | Ga0373925_0334022 | 3300037068 | Bacteria | 1228 |
| 275 | Ga0395898_0039271 | 3300037466 | Bacteria | 4686 |
| 276 | Ga0395898_0553571 | 3300037466 | Bacteria | 1092 |
| 277 | Ga0436364_0043851 | 3300037853 | Bacteria | 2654 |
| 278 | Ga0436364_0563114 | 3300037853 | Bacteria | 3856 |
| 279 | Ga0395901_0190471 | 3300038443 | Bacteria | 2151 |
| 280 | Ga0395901_0195365 | 3300038443 | Bacteria | 2122 |
| 281 | Ga0436365_1128219 | 3300039437 | Bacteria | 41762 |
| 282 | Ga0436363_1161902 | 3300039450 | Bacteria | 3363 |
| 283 | Ga0436363_1526803 | 3300039450 | Bacteria | 2254 |
| 284 | Ga0436362_1099153 | 3300039453 | Bacteria | 4320 |
| 285 | Ga0451833_0238202 | 3300041491 | Bacteria | 1281 |
| 286 | Ga0466969_0097593 | 3300044656 | Bacteria | 1386 |
| 287 | Ga0466966_0082034 | 3300044684 | Bacteria | 2007 |
| 288 | Ga0466961_0213404 | 3300044693 | Bacteria | 1191 |
| 289 | Ga0466963_0235375 | 3300044694 | Bacteria | 1284 |
| 290 | Ga0466957_0025693 | 3300044842 | Bacteria | 3492 |
| 291 | Ga0466959_0104437 | 3300045049 | Bacteria | 2027 |
| 292 | Ga0466959_0214765 | 3300045049 | Bacteria | 1336 |
| 293 | Ga0466967_0061760 | 3300045976 | Bacteria | 3325 |
| 294 | Ga0495603_0005525 | 3300046455 | Bacteria | 7543 |
| 295 | Ga0495603_0012346 | 3300046455 | Bacteria | 5171 |
| 296 | Ga0495603_0105380 | 3300046455 | Bacteria | 1645 |
| 297 | Ga0495590_0048919 | 3300046457 | Bacteria | 1475 |
| 298 | Ga0495629_0271696 | 3300046459 | Bacteria | 1164 |
| 299 | Ga0495638_0163295 | 3300046460 | Bacteria | 1283 |
| 300 | Ga0495580_0038757 | 3300046472 | Bacteria | 3412 |
| 301 | Ga0495580_0104752 | 3300046472 | Bacteria | 1966 |
| 302 | Ga0495664_0073584 | 3300046477 | Bacteria | 2043 |
| 303 | Ga0495594_0129948 | 3300046499 | Bacteria | 1426 |
| 304 | Ga0495596_0075723 | 3300046500 | Bacteria | 1307 |
| 305 | Ga0495606_0010333 | 3300046507 | Bacteria | 7762 |
| 306 | Ga0495606_0031814 | 3300046507 | Bacteria | 3663 |
| 307 | Ga0495606_0127059 | 3300046507 | Bacteria | 1519 |
| 308 | Ga0495608_0014261 | 3300046511 | Bacteria | 5514 |
| 309 | Ga0495618_0066493 | 3300046514 | Bacteria | 2291 |
| 310 | Ga0495630_0045415 | 3300046517 | Bacteria | 3283 |
| 311 | Ga0495631_0091022 | 3300046518 | Bacteria | 1313 |
| 312 | Ga0495631_0109839 | 3300046518 | Bacteria | 1186 |
| 313 | Ga0495632_0043498 | 3300046519 | Bacteria | 2244 |
| 314 | Ga0495632_0092587 | 3300046519 | Bacteria | 1431 |
| 315 | Ga0495644_0040630 | 3300046523 | Bacteria | 1753 |
| 316 | Ga0495586_0146333 | 3300046535 | Bacteria | 1328 |
| 317 | Ga0495622_0011122 | 3300046557 | Bacteria | 4154 |
| 318 | Ga0495622_0060991 | 3300046557 | Bacteria | 1747 |
| 319 | Ga0495633_0068849 | 3300046558 | Bacteria | 1652 |
| 320 | Ga0495656_0001312 | 3300046615 | Bacteria | 8094 |
| 321 | Ga0495625_0229996 | 3300046660 | Bacteria | 1211 |
| 322 | Ga0495635_0007949 | 3300046663 | Bacteria | 7410 |
| 323 | Ga0495635_0029732 | 3300046663 | Bacteria | 3800 |
| 324 | Ga0495599_0040564 | 3300046678 | Bacteria | 2923 |
| 325 | Ga0495623_0083349 | 3300046679 | Bacteria | 1975 |
| 326 | Ga0495624_0034259 | 3300046690 | Bacteria | 3285 |
| 327 | Ga0495600_0015512 | 3300046809 | Bacteria | 4817 |
| 328 | Ga0495581_0080602 | 3300047315 | Bacteria | 1884 |
| 329 | Ga0495581_0093146 | 3300047315 | Bacteria | 1749 |
| 330 | Ga0495604_0159387 | 3300047317 | Bacteria | 1596 |
| 331 | Ga0495674_0300154 | 3300047319 | Bacteria | 1312 |
| 332 | Ga0495675_0067179 | 3300047444 | Bacteria | 2265 |
| 333 | Ga0495673_0019752 | 3300047469 | Bacteria | 3371 |
| 334 | Ga0495684_0011020 | 3300047471 | Bacteria | 6991 |
| 335 | Ga0495684_0054971 | 3300047471 | Bacteria | 3036 |
| 336 | Ga0495602_0053387 | 3300048088 | Bacteria | 3580 |
| 337 | Ga0495602_0062293 | 3300048088 | Bacteria | 3236 |
| 338 | Ga0496100_0041289 | 3300048903 | Bacteria | 2940 |
| 339 | Ga0496100_0051585 | 3300048903 | Bacteria | 2671 |
| 340 | Ga0496101_0067965 | 3300048904 | Bacteria | 2604 |
| 341 | Ga0496101_0273747 | 3300048904 | Bacteria | 1318 |
| 342 | Ga0496102_0029057 | 3300048905 | Bacteria | 4943 |
| 343 | Ga0496102_0048191 | 3300048905 | Bacteria | 3874 |
| 344 | Ga0496104_0189719 | 3300048907 | Bacteria | 1966 |
| 345 | Ga0496105_0000208 | 3300048908 | Bacteria | 39305 |
| 346 | Ga0496106_0001007 | 3300048909 | Bacteria | 20622 |
| 347 | Ga0496106_0001121 | 3300048909 | Bacteria | 19807 |
| 348 | Ga0496106_0095549 | 3300048909 | Bacteria | 2299 |
| 349 | Ga0496107_0044783 | 3300048910 | Bacteria | 3182 |
| 350 | Ga0496107_0080650 | 3300048910 | Bacteria | 2373 |
| 351 | Ga0496108_0000415 | 3300048911 | Bacteria | 34866 |
| 352 | Ga0496108_0062625 | 3300048911 | Bacteria | 3132 |
| 353 | Ga0496108_0312184 | 3300048911 | Bacteria | 1370 |
| 354 | Ga0496109_0061834 | 3300048912 | Bacteria | 3424 |
| 355 | Ga0496109_0298254 | 3300048912 | Bacteria | 1519 |
| 356 | Ga0496110_0021125 | 3300048913 | Bacteria | 5503 |
| 357 | Ga0496111_0005833 | 3300048914 | Bacteria | 7941 |
| 358 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 359 | Ga0496112_0012818 | 3300048915 | Bacteria | 7716 |
| 360 | Ga0496112_0026322 | 3300048915 | Bacteria | 5595 |
| 361 | Ga0496112_0037479 | 3300048915 | Bacteria | 4732 |
| 362 | Ga0496112_0044181 | 3300048915 | Bacteria | 4365 |
| 363 | Ga0496112_0241052 | 3300048915 | Bacteria | 1761 |
| 364 | Ga0496113_0042178 | 3300048916 | Bacteria | 3370 |
| 365 | Ga0496113_0075426 | 3300048916 | Bacteria | 2574 |
| 366 | Ga0496114_0132994 | 3300048917 | Bacteria | 2149 |
| 367 | Ga0496115_0029851 | 3300048918 | Bacteria | 4287 |
| 368 | Ga0496115_0049377 | 3300048918 | Bacteria | 3368 |
| 369 | Ga0496115_0159449 | 3300048918 | Bacteria | 1864 |
| 370 | Ga0496115_0299601 | 3300048918 | Bacteria | 1317 |
| 371 | Ga0496115_0390914 | 3300048918 | Bacteria | 1130 |
| 372 | Ga0496117_0091713 | 3300048920 | Bacteria | 1953 |
| 373 | Ga0496118_0006738 | 3300048921 | Bacteria | 12512 |
| 374 | Ga0496119_0030642 | 3300048922 | Bacteria | 3622 |
| 375 | Ga0496119_0056162 | 3300048922 | Bacteria | 2386 |
| 376 | Ga0496120_0027428 | 3300048923 | Bacteria | 3502 |
| 377 | Ga0496121_0005409 | 3300048924 | Bacteria | 16397 |
| 378 | Ga0496121_0014219 | 3300048924 | Bacteria | 8466 |
| 379 | Ga0496121_0018372 | 3300048924 | Bacteria | 7055 |
| 380 | Ga0496121_0026682 | 3300048924 | Bacteria | 5431 |
| 381 | Ga0496121_0029827 | 3300048924 | Bacteria | 5028 |
| 382 | Ga0496121_0094400 | 3300048924 | Bacteria | 2327 |
| 383 | Ga0496124_0052593 | 3300048927 | Bacteria | 3459 |
| 384 | Ga0496124_0181117 | 3300048927 | Bacteria | 1621 |
| 385 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 386 | Ga0496125_0001260 | 3300048928 | Bacteria | 37764 |
| 387 | Ga0496125_0023458 | 3300048928 | Bacteria | 5694 |
| 388 | Ga0496126_0005981 | 3300048929 | Bacteria | 13673 |
| 389 | Ga0496126_0006080 | 3300048929 | Bacteria | 13539 |
| 390 | Ga0496126_0008347 | 3300048929 | Bacteria | 11179 |
| 391 | Ga0496126_0049358 | 3300048929 | Bacteria | 3842 |
| 392 | Ga0496126_0083208 | 3300048929 | Bacteria | 2825 |
| 393 | Ga0496126_0114010 | 3300048929 | Bacteria | 2352 |
| 394 | Ga0496126_0135884 | 3300048929 | Bacteria | 2121 |
| 395 | Ga0496126_0194465 | 3300048929 | Bacteria | 1716 |
| 396 | Ga0496126_0354999 | 3300048929 | Bacteria | 1198 |
| 397 | Ga0496126_0431532 | 3300048929 | Bacteria | 1063 |
| 398 | Ga0501031_0013260 | 3300049568 | Bacteria | 5378 |
| 399 | Ga0501031_0200539 | 3300049568 | Bacteria | 1302 |
| 400 | Ga0501032_0000038 | 3300049569 | Bacteria | 115810 |
| 401 | Ga0501033_0000089 | 3300049570 | Bacteria | 86782 |
| 402 | Ga0501033_0041227 | 3300049570 | Bacteria | 3445 |
| 403 | Ga0501033_0106426 | 3300049570 | Bacteria | 2043 |
| 404 | Ga0501034_0000228 | 3300049571 | Bacteria | 106111 |
| 405 | Ga0501034_0179401 | 3300049571 | Bacteria | 2083 |
| 406 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 407 | Ga0501036_0165755 | 3300049572 | Bacteria | 1862 |
| 408 | Ga0501037_0000135 | 3300049573 | Bacteria | 68925 |
| 409 | Ga0501038_0000054 | 3300049574 | Bacteria | 94123 |
| 410 | Ga0501039_0013587 | 3300049575 | Bacteria | 6227 |
| 411 | Ga0501039_0361440 | 3300049575 | Bacteria | 1140 |
| 412 | Ga0501041_0052655 | 3300049577 | Bacteria | 2482 |
| 413 | Ga0501043_0000021 | 3300049579 | Bacteria | 155025 |
| 414 | Ga0501043_0065543 | 3300049579 | Bacteria | 2852 |
| 415 | Ga0501043_0178711 | 3300049579 | Bacteria | 1654 |
| 416 | Ga0501046_0000341 | 3300049580 | Bacteria | 47097 |
| 417 | Ga0501046_0032068 | 3300049580 | Bacteria | 4256 |
| 418 | Ga0501047_0000041 | 3300049581 | Bacteria | 184355 |
| 419 | Ga0501047_0132080 | 3300049581 | Bacteria | 2377 |
| 420 | Ga0501047_0135509 | 3300049581 | Bacteria | 2343 |
| 421 | Ga0501048_0000022 | 3300049582 | Bacteria | 68365 |
| 422 | Ga0501067_0000206 | 3300049583 | Bacteria | 33049 |
| 423 | Ga0501069_0160172 | 3300049585 | Bacteria | 1296 |
| 424 | Ga0501070_0101273 | 3300049586 | Bacteria | 2383 |
| 425 | Ga0501071_0057194 | 3300049587 | Bacteria | 2818 |
| 426 | Ga0501071_0250546 | 3300049587 | Bacteria | 1337 |
| 427 | Ga0501072_0007562 | 3300049588 | Bacteria | 8245 |
| 428 | Ga0501073_0000082 | 3300049589 | Bacteria | 59745 |
| 429 | Ga0501074_0000415 | 3300049590 | Bacteria | 25490 |
| 430 | Ga0501079_0006095 | 3300049741 | Bacteria | 9037 |
| 431 | Ga0501080_0000506 | 3300049742 | Bacteria | 30607 |
| 432 | Ga0501080_0384947 | 3300049742 | Bacteria | 1263 |
| 433 | Ga0501083_0023204 | 3300049744 | Bacteria | 4303 |
| 434 | Ga0501035_0000146 | 3300049822 | Bacteria | 86011 |
| 435 | Ga0501035_0172819 | 3300049822 | Bacteria | 1866 |
| 436 | Ga0501044_0001064 | 3300049823 | Bacteria | 32992 |
| 437 | Ga0501044_0002044 | 3300049823 | Bacteria | 23277 |
| 438 | Ga0501044_0111045 | 3300049823 | Bacteria | 2750 |
| 439 | Ga0501045_0067513 | 3300049824 | Bacteria | 2626 |
| 440 | nmdc:mga0yw44_20422_c1 | 3300050492 | Bacteria | 3676 |
| 441 | nmdc:mga0yw44_243758_c1 | 3300050492 | Bacteria | 1195 |
| 442 | nmdc:mga0yw44_35246_c1 | 3300050492 | Bacteria | 2939 |
| 443 | nmdc:mga0k408_157891_c1 | 3300050493 | Bacteria | 1351 |
| 444 | nmdc:mga06z11_155976_c1 | 3300050494 | Bacteria | 1301 |
| 445 | nmdc:mga07m45_215527_c1 | 3300050496 | Bacteria | 1117 |
| 446 | nmdc:mga08y16_137652_c1 | 3300050511 | Bacteria | 2538 |
| 447 | nmdc:mga0n895_228832_c1 | 3300050512 | Bacteria | 1887 |
| 448 | nmdc:mga0n895_6543_c1 | 3300050512 | Bacteria | 9913 |
| 449 | nmdc:mga0sz30_26893_c1 | 3300050516 | Bacteria | 2360 |
| 450 | Ga0495601_0186288 | 3300053077 | Bacteria | 1357 |
| 451 | Ga0500635_0038327 | 3300053080 | Bacteria | 1589 |
| 452 | Ga0495595_0074248 | 3300053084 | Bacteria | 1612 |
| 453 | Ga0495619_0038800 | 3300053085 | Bacteria | 3107 |
| 454 | Ga0500578_0142492 | 3300053086 | Bacteria | 1498 |
| 455 | Ga0500643_000046 | 3300053087 | Bacteria | 150388 |
| 456 | Ga0500644_0028886 | 3300053088 | Bacteria | 1739 |
| 457 | Ga0500647_0016078 | 3300053091 | Bacteria | 3432 |
| 458 | Ga0500647_0079381 | 3300053091 | Bacteria | 1574 |
| 459 | Ga0500583_0037675 | 3300053092 | Bacteria | 2173 |
| 460 | Ga0500651_0003779 | 3300053093 | Bacteria | 8346 |
| 461 | Ga0500566_0001776 | 3300053094 | Bacteria | 12676 |
| 462 | Ga0500641_0025728 | 3300053096 | Bacteria | 2279 |
| 463 | Ga0500555_012563 | 3300053103 | Bacteria | 2438 |
| 464 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 465 | Ga0500557_000020 | 3300053105 | Bacteria | 91933 |
| 466 | Ga0500572_000151 | 3300053111 | Bacteria | 24045 |
| 467 | Ga0500591_040856 | 3300053115 | Bacteria | 2208 |
| 468 | Ga0500595_002109 | 3300053119 | Bacteria | 10154 |
| 469 | Ga0500595_006280 | 3300053119 | Bacteria | 5063 |
| 470 | Ga0500595_015185 | 3300053119 | Bacteria | 2894 |
| 471 | Ga0500608_023013 | 3300053122 | Bacteria | 2895 |
| 472 | Ga0500608_095632 | 3300053122 | Bacteria | 1382 |
| 473 | Ga0500559_0001510 | 3300053136 | Bacteria | 13085 |
| 474 | Ga0500568_0008904 | 3300053139 | Bacteria | 4801 |
| 475 | Ga0500573_0122294 | 3300053140 | Bacteria | 1447 |
| 476 | Ga0500590_075300 | 3300053148 | Bacteria | 1669 |
| 477 | Ga0500590_118112 | 3300053148 | Bacteria | 1247 |
| 478 | Ga0500603_000816 | 3300053150 | Bacteria | 7434 |
| 479 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 480 | Ga0500619_049611 | 3300053154 | Bacteria | 1354 |
| 481 | Ga0500630_000657 | 3300053159 | Bacteria | 15701 |
| 482 | Ga0500634_0104618 | 3300053161 | Bacteria | 1410 |
| 483 | Ga0500638_055089 | 3300053162 | Bacteria | 1917 |
| 484 | Ga0500638_107593 | 3300053162 | Bacteria | 1292 |
| 485 | Ga0500639_000002 | 3300053163 | Bacteria | 233548 |
| 486 | Ga0500636_0000436 | 3300053177 | Bacteria | 22986 |
| 487 | Ga0500636_0163531 | 3300053177 | Bacteria | 1210 |
| 488 | Ga0500637_0000328 | 3300053178 | Bacteria | 17873 |
| 489 | Ga0500596_003112 | 3300053735 | Bacteria | 3190 |
| 490 | Ga0500596_008375 | 3300053735 | Bacteria | 1651 |
| 491 | Ga0501084_0001986 | 3300054114 | Bacteria | 16326 |
| 492 | Ga0501082_0016806 | 3300060353 | Bacteria | 6301 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013297 | Ga0157378_10025057 | Ga0157378_100250575 | 241 |
| 2 | 3300050492 | nmdc:mga0yw44_35246_c1 | nmdc:mga0yw44_35246_c1_14_859 | 243 |
| 3 | 3300025939 | Ga0207665_10100792 | Ga0207665_101007923 | 254 |
| 4 | 3300012492 | Ga0157335_1000871 | Ga0157335_10008711 | 281 |
| 5 | 3300025940 | Ga0207691_10090453 | Ga0207691_100904532 | 281 |
| 6 | 3300037068 | Ga0373925_0334022 | Ga0373925_0334022_22_993 | 282 |
| 7 | 3300005356 | Ga0070674_100052465 | Ga0070674_1000524652 | 283 |
| 8 | 3300005436 | Ga0070713_100003607 | Ga0070713_1000036076 | 283 |
| 9 | 3300005436 | Ga0070713_100112787 | Ga0070713_1001127872 | 283 |
| 10 | 3300005437 | Ga0070710_10003983 | Ga0070710_100039833 | 283 |
| 11 | 3300005439 | Ga0070711_100010293 | Ga0070711_1000102933 | 283 |
| 12 | 3300005455 | Ga0070663_100053860 | Ga0070663_1000538602 | 283 |
| 13 | 3300005459 | Ga0068867_100026289 | Ga0068867_1000262896 | 283 |
| 14 | 3300005844 | Ga0068862_100058558 | Ga0068862_1000585582 | 283 |
| 15 | 3300006028 | Ga0070717_10000402 | Ga0070717_100004025 | 283 |
| 16 | 3300006163 | Ga0070715_10045714 | Ga0070715_100457142 | 283 |
| 17 | 3300006173 | Ga0070716_100112940 | Ga0070716_1001129402 | 283 |
| 18 | 3300025297 | Ga0209758_1008034 | Ga0209758_10080343 | 283 |
| 19 | 3300025903 | Ga0207680_10153454 | Ga0207680_101534542 | 283 |
| 20 | 3300025905 | Ga0207685_10047408 | Ga0207685_100474082 | 283 |
| 21 | 3300025916 | Ga0207663_10137978 | Ga0207663_101379782 | 283 |
| 22 | 3300025928 | Ga0207700_10012252 | Ga0207700_100122523 | 283 |
| 23 | 3300025933 | Ga0207706_10016927 | Ga0207706_100169272 | 283 |
| 24 | 3300025937 | Ga0207669_10059747 | Ga0207669_100597472 | 283 |
| 25 | 3300025939 | Ga0207665_10010410 | Ga0207665_100104102 | 283 |
| 26 | 3300028380 | Ga0268265_10297071 | Ga0268265_102970712 | 283 |
| 27 | 3300031507 | Ga0307509_10089606 | Ga0307509_100896062 | 283 |
| 28 | 3300031824 | Ga0307413_10006633 | Ga0307413_100066334 | 283 |
| 29 | 3300032005 | Ga0307411_10110610 | Ga0307411_101106102 | 283 |
| 30 | 3300033180 | Ga0307510_10041569 | Ga0307510_100415694 | 283 |
| 31 | 3300046457 | Ga0495590_0048919 | Ga0495590_0048919_309_1277 | 283 |
| 32 | 3300046460 | Ga0495638_0163295 | Ga0495638_0163295_49_1017 | 283 |
| 33 | 3300046499 | Ga0495594_0129948 | Ga0495594_0129948_173_1141 | 283 |
| 34 | 3300046500 | Ga0495596_0075723 | Ga0495596_0075723_50_1018 | 283 |
| 35 | 3300046518 | Ga0495631_0091022 | Ga0495631_0091022_14_982 | 283 |
| 36 | 3300046519 | Ga0495632_0092587 | Ga0495632_0092587_128_1096 | 283 |
| 37 | 3300046523 | Ga0495644_0040630 | Ga0495644_0040630_497_1465 | 283 |
| 38 | 3300046535 | Ga0495586_0146333 | Ga0495586_0146333_48_1016 | 283 |
| 39 | 3300046557 | Ga0495622_0011122 | Ga0495622_0011122_2508_3476 | 283 |
| 40 | 3300046615 | Ga0495656_0001312 | Ga0495656_0001312_1778_2746 | 283 |
| 41 | 3300047315 | Ga0495581_0093146 | Ga0495581_0093146_389_1357 | 283 |
| 42 | 3300047319 | Ga0495674_0300154 | Ga0495674_0300154_222_1190 | 283 |
| 43 | 3300053084 | Ga0495595_0074248 | Ga0495595_0074248_327_1295 | 283 |
| 44 | 3300053122 | Ga0500608_095632 | Ga0500608_095632_67_1035 | 283 |
| 45 | 3300053148 | Ga0500590_075300 | Ga0500590_075300_67_1035 | 283 |
| 46 | 3300053154 | Ga0500619_049611 | Ga0500619_049611_312_1280 | 283 |
| 47 | 3300003354 | JGI25160J50197_1006462 | JGI25160J50197_10064623 | 284 |
| 48 | 3300005327 | Ga0070658_10443915 | Ga0070658_104439151 | 284 |
| 49 | 3300006038 | Ga0075365_10089588 | Ga0075365_100895882 | 284 |
| 50 | 3300006048 | Ga0075363_100139562 | Ga0075363_1001395623 | 284 |
| 51 | 3300006051 | Ga0075364_10045080 | Ga0075364_100450802 | 284 |
| 52 | 3300006177 | Ga0075362_10078256 | Ga0075362_100782562 | 284 |
| 53 | 3300006186 | Ga0075369_10024782 | Ga0075369_100247822 | 284 |
| 54 | 3300025302 | Ga0207426_1000837 | Ga0207426_10008377 | 284 |
| 55 | 3300025916 | Ga0207663_10115576 | Ga0207663_101155761 | 284 |
| 56 | 3300031239 | Ga0265328_10037150 | Ga0265328_100371502 | 284 |
| 57 | 3300036401 | Ga0373937_0113241 | Ga0373937_0113241_321_1289 | 284 |
| 58 | 3300045049 | Ga0466959_0214765 | Ga0466959_0214765_186_1154 | 284 |
| 59 | 3300046507 | Ga0495606_0127059 | Ga0495606_0127059_117_1085 | 284 |
| 60 | 3300046679 | Ga0495623_0083349 | Ga0495623_0083349_723_1691 | 284 |
| 61 | 3300048088 | Ga0495602_0053387 | Ga0495602_0053387_1621_2589 | 284 |
| 62 | 3300048928 | Ga0496125_0001260 | Ga0496125_0001260_9899_10873 | 284 |
| 63 | 3300048928 | Ga0496125_0023458 | Ga0496125_0023458_3623_4591 | 284 |
| 64 | 3300048929 | Ga0496126_0354999 | Ga0496126_0354999_35_1006 | 284 |
| 65 | 3300050492 | nmdc:mga0yw44_20422_c1 | nmdc:mga0yw44_20422_c1_832_1800 | 284 |
| 66 | 3300050494 | nmdc:mga06z11_155976_c1 | nmdc:mga06z11_155976_c1_74_1042 | 284 |
| 67 | 3300053080 | Ga0500635_0038327 | Ga0500635_0038327_508_1476 | 284 |
| 68 | 3300053162 | Ga0500638_055089 | Ga0500638_055089_500_1468 | 284 |
| 69 | 3300053177 | Ga0500636_0000436 | Ga0500636_0000436_8361_9329 | 284 |
| 70 | 3300005434 | Ga0070709_10017401 | Ga0070709_100174012 | 285 |
| 71 | 3300005435 | Ga0070714_100011360 | Ga0070714_1000113602 | 285 |
| 72 | 3300005614 | Ga0068856_100023694 | Ga0068856_1000236943 | 285 |
| 73 | 3300005937 | Ga0081455_10069621 | Ga0081455_100696212 | 285 |
| 74 | 3300005985 | Ga0081539_10027637 | Ga0081539_100276374 | 285 |
| 75 | 3300006175 | Ga0070712_100037180 | Ga0070712_1000371802 | 285 |
| 76 | 3300025915 | Ga0207693_10022562 | Ga0207693_100225622 | 285 |
| 77 | 3300025929 | Ga0207664_10162118 | Ga0207664_101621182 | 285 |
| 78 | 3300026078 | Ga0207702_10003237 | Ga0207702_1000323711 | 285 |
| 79 | 3300031730 | Ga0307516_10091060 | Ga0307516_100910603 | 285 |
| 80 | 3300035111 | Ga0373923_0042435 | Ga0373923_0042435_236_1204 | 285 |
| 81 | 3300046507 | Ga0495606_0031814 | Ga0495606_0031814_2014_2982 | 285 |
| 82 | 3300046660 | Ga0495625_0229996 | Ga0495625_0229996_225_1193 | 285 |
| 83 | 3300048918 | Ga0496115_0049377 | Ga0496115_0049377_1847_2815 | 285 |
| 84 | 3300005436 | Ga0070713_100007249 | Ga0070713_1000072492 | 286 |
| 85 | 3300005437 | Ga0070710_10007420 | Ga0070710_100074202 | 286 |
| 86 | 3300005439 | Ga0070711_100067656 | Ga0070711_1000676562 | 286 |
| 87 | 3300005471 | Ga0070698_100163268 | Ga0070698_1001632682 | 286 |
| 88 | 3300005718 | Ga0068866_10053236 | Ga0068866_100532362 | 286 |
| 89 | 3300006048 | Ga0075363_100063425 | Ga0075363_1000634252 | 286 |
| 90 | 3300006173 | Ga0070716_100101461 | Ga0070716_1001014612 | 286 |
| 91 | 3300006175 | Ga0070712_100008186 | Ga0070712_1000081864 | 286 |
| 92 | 3300009174 | Ga0105241_10508225 | Ga0105241_105082252 | 286 |
| 93 | 3300013306 | Ga0163162_10417115 | Ga0163162_104171152 | 286 |
| 94 | 3300025297 | Ga0209758_1038002 | Ga0209758_10380022 | 286 |
| 95 | 3300025898 | Ga0207692_10013743 | Ga0207692_100137432 | 286 |
| 96 | 3300025899 | Ga0207642_10048609 | Ga0207642_100486092 | 286 |
| 97 | 3300025906 | Ga0207699_10040745 | Ga0207699_100407453 | 286 |
| 98 | 3300025915 | Ga0207693_10001058 | Ga0207693_1000105817 | 286 |
| 99 | 3300025916 | Ga0207663_10002609 | Ga0207663_100026097 | 286 |
| 100 | 3300025927 | Ga0207687_10174475 | Ga0207687_101744752 | 286 |
| 101 | 3300025928 | Ga0207700_10014889 | Ga0207700_100148895 | 286 |
| 102 | 3300025972 | Ga0207668_10056602 | Ga0207668_100566023 | 286 |
| 103 | 3300026067 | Ga0207678_10085267 | Ga0207678_100852671 | 286 |
| 104 | 3300031507 | Ga0307509_10057532 | Ga0307509_100575324 | 286 |
| 105 | 3300031711 | Ga0265314_10169392 | Ga0265314_101693921 | 286 |
| 106 | 3300033180 | Ga0307510_10020754 | Ga0307510_100207543 | 286 |
| 107 | 3300035113 | Ga0373936_0050404 | Ga0373936_0050404_17_985 | 286 |
| 108 | 3300035691 | Ga0373931_0023120 | Ga0373931_0023120_259_1227 | 286 |
| 109 | 3300037853 | Ga0436364_0043851 | Ga0436364_0043851_1439_2407 | 286 |
| 110 | 3300046455 | Ga0495603_0005525 | Ga0495603_0005525_2597_3571 | 286 |
| 111 | 3300046809 | Ga0495600_0015512 | Ga0495600_0015512_2222_3190 | 286 |
| 112 | 3300048903 | Ga0496100_0041289 | Ga0496100_0041289_1840_2808 | 286 |
| 113 | 3300048915 | Ga0496112_0044181 | Ga0496112_0044181_1180_2148 | 286 |
| 114 | 3300048916 | Ga0496113_0042178 | Ga0496113_0042178_419_1387 | 286 |
| 115 | 3300048917 | Ga0496114_0132994 | Ga0496114_0132994_1152_2120 | 286 |
| 116 | 3300048929 | Ga0496126_0083208 | Ga0496126_0083208_783_1751 | 286 |
| 117 | 3300050492 | nmdc:mga0yw44_243758_c1 | nmdc:mga0yw44_243758_c1_197_1165 | 286 |
| 118 | 3300053088 | Ga0500644_0028886 | Ga0500644_0028886_748_1719 | 286 |
| 119 | 3300053091 | Ga0500647_0079381 | Ga0500647_0079381_468_1436 | 286 |
| 120 | 3300053094 | Ga0500566_0001776 | Ga0500566_0001776_701_1669 | 286 |
| 121 | 3300053111 | Ga0500572_000151 | Ga0500572_000151_10707_11675 | 286 |
| 122 | 3300053115 | Ga0500591_040856 | Ga0500591_040856_867_1835 | 286 |
| 123 | 3300053119 | Ga0500595_006280 | Ga0500595_006280_2687_3655 | 286 |
| 124 | 3300053119 | Ga0500595_015185 | Ga0500595_015185_434_1405 | 286 |
| 125 | 3300053122 | Ga0500608_023013 | Ga0500608_023013_1474_2442 | 286 |
| 126 | 3300053136 | Ga0500559_0001510 | Ga0500559_0001510_6556_7524 | 286 |
| 127 | 3300053150 | Ga0500603_000816 | Ga0500603_000816_904_1878 | 286 |
| 128 | 3300053159 | Ga0500630_000657 | Ga0500630_000657_12362_13330 | 286 |
| 129 | 3300053163 | Ga0500639_000002 | Ga0500639_000002_3354_4322 | 286 |
| 130 | 3300053178 | Ga0500637_0000328 | Ga0500637_0000328_10068_11042 | 286 |
| 131 | 3300053735 | Ga0500596_003112 | Ga0500596_003112_522_1490 | 286 |
| 132 | 3300003659 | JGI25404J52841_10023995 | JGI25404J52841_100239951 | 287 |
| 133 | 3300005329 | Ga0070683_100142442 | Ga0070683_1001424422 | 287 |
| 134 | 3300005336 | Ga0070680_100062296 | Ga0070680_1000622963 | 287 |
| 135 | 3300005445 | Ga0070708_100092186 | Ga0070708_1000921863 | 287 |
| 136 | 3300005719 | Ga0068861_100252161 | Ga0068861_1002521612 | 287 |
| 137 | 3300005937 | Ga0081455_10160945 | Ga0081455_101609452 | 287 |
| 138 | 3300005983 | Ga0081540_1005778 | Ga0081540_10057787 | 287 |
| 139 | 3300005985 | Ga0081539_10009620 | Ga0081539_100096203 | 287 |
| 140 | 3300006353 | Ga0075370_10032834 | Ga0075370_100328343 | 287 |
| 141 | 3300013104 | Ga0157370_10148417 | Ga0157370_101484172 | 287 |
| 142 | 3300013105 | Ga0157369_10024696 | Ga0157369_100246967 | 287 |
| 143 | 3300013105 | Ga0157369_10466917 | Ga0157369_104669172 | 287 |
| 144 | 3300021384 | Ga0213876_10000670 | Ga0213876_100006709 | 287 |
| 145 | 3300025297 | Ga0209758_1014022 | Ga0209758_10140222 | 287 |
| 146 | 3300025904 | Ga0207647_10112567 | Ga0207647_101125671 | 287 |
| 147 | 3300025914 | Ga0207671_10246522 | Ga0207671_102465221 | 287 |
| 148 | 3300025932 | Ga0207690_10280649 | Ga0207690_102806492 | 287 |
| 149 | 3300026067 | Ga0207678_10130926 | Ga0207678_101309262 | 287 |
| 150 | 3300027907 | Ga0207428_10088058 | Ga0207428_100880582 | 287 |
| 151 | 3300031249 | Ga0265339_10052502 | Ga0265339_100525022 | 287 |
| 152 | 3300031711 | Ga0265314_10031282 | Ga0265314_100312824 | 287 |
| 153 | 3300031730 | Ga0307516_10029440 | Ga0307516_100294402 | 287 |
| 154 | 3300031730 | Ga0307516_10050482 | Ga0307516_100504822 | 287 |
| 155 | 3300031852 | Ga0307410_10183178 | Ga0307410_101831782 | 287 |
| 156 | 3300031995 | Ga0307409_100143463 | Ga0307409_1001434632 | 287 |
| 157 | 3300032002 | Ga0307416_100194684 | Ga0307416_1001946842 | 287 |
| 158 | 3300032126 | Ga0307415_100089816 | Ga0307415_1000898162 | 287 |
| 159 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002384 | 287 |
| 160 | 3300035724 | Ga0373933_0155585 | Ga0373933_0155585_380_1348 | 287 |
| 161 | 3300037466 | Ga0395898_0039271 | Ga0395898_0039271_1058_2026 | 287 |
| 162 | 3300039437 | Ga0436365_1128219 | Ga0436365_1128219_10042_11010 | 287 |
| 163 | 3300039450 | Ga0436363_1526803 | Ga0436363_1526803_520_1488 | 287 |
| 164 | 3300039453 | Ga0436362_1099153 | Ga0436362_1099153_718_1686 | 287 |
| 165 | 3300044656 | Ga0466969_0097593 | Ga0466969_0097593_144_1112 | 287 |
| 166 | 3300044694 | Ga0466963_0235375 | Ga0466963_0235375_164_1132 | 287 |
| 167 | 3300044842 | Ga0466957_0025693 | Ga0466957_0025693_1104_2072 | 287 |
| 168 | 3300045049 | Ga0466959_0104437 | Ga0466959_0104437_643_1611 | 287 |
| 169 | 3300046511 | Ga0495608_0014261 | Ga0495608_0014261_799_1767 | 287 |
| 170 | 3300047444 | Ga0495675_0067179 | Ga0495675_0067179_627_1595 | 287 |
| 171 | 3300047471 | Ga0495684_0011020 | Ga0495684_0011020_1884_2852 | 287 |
| 172 | 3300048088 | Ga0495602_0062293 | Ga0495602_0062293_201_1169 | 287 |
| 173 | 3300048924 | Ga0496121_0029827 | Ga0496121_0029827_1597_2565 | 287 |
| 174 | 3300048929 | Ga0496126_0431532 | Ga0496126_0431532_83_1051 | 287 |
| 175 | 3300049585 | Ga0501069_0160172 | Ga0501069_0160172_31_999 | 287 |
| 176 | 3300050496 | nmdc:mga07m45_215527_c1 | nmdc:mga07m45_215527_c1_121_1089 | 287 |
| 177 | 3300053085 | Ga0495619_0038800 | Ga0495619_0038800_1914_2882 | 287 |
| 178 | 3300053091 | Ga0500647_0016078 | Ga0500647_0016078_439_1407 | 287 |
| 179 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_276372_277340 | 287 |
| 180 | 3300053105 | Ga0500557_000020 | Ga0500557_000020_7840_8808 | 287 |
| 181 | 3300005578 | Ga0068854_100156385 | Ga0068854_1001563851 | 288 |
| 182 | 3300006942 | Ga0099824_1031084 | Ga0099824_10310842 | 288 |
| 183 | 3300006943 | Ga0099822_1001873 | Ga0099822_100187316 | 288 |
| 184 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001702 | 288 |
| 185 | 3300027361 | Ga0209489_100001 | Ga0209489_100001702 | 288 |
| 186 | 3300027363 | Ga0209700_100001 | Ga0209700_100001702 | 288 |
| 187 | 3300039450 | Ga0436363_1161902 | Ga0436363_1161902_2099_3067 | 288 |
| 188 | 3300025901 | Ga0207688_10059228 | Ga0207688_100592282 | 289 |
| 189 | 3300031711 | Ga0265314_10000412 | Ga0265314_1000041248 | 289 |
| 190 | 3300048905 | Ga0496102_0048191 | Ga0496102_0048191_1520_2494 | 289 |
| 191 | 3300048909 | Ga0496106_0001007 | Ga0496106_0001007_11509_12483 | 289 |
| 192 | 3300048910 | Ga0496107_0044783 | Ga0496107_0044783_525_1499 | 289 |
| 193 | 3300048911 | Ga0496108_0000415 | Ga0496108_0000415_1978_2952 | 289 |
| 194 | 3300048912 | Ga0496109_0298254 | Ga0496109_0298254_295_1269 | 289 |
| 195 | 3300048913 | Ga0496110_0021125 | Ga0496110_0021125_3904_4878 | 289 |
| 196 | 3300048915 | Ga0496112_0012818 | Ga0496112_0012818_3800_4774 | 289 |
| 197 | 3300048916 | Ga0496113_0075426 | Ga0496113_0075426_589_1563 | 289 |
| 198 | 3300026116 | Ga0207674_10393525 | Ga0207674_103935252 | 290 |
| 199 | 3300031616 | Ga0307508_10000003 | Ga0307508_10000003180 | 290 |
| 200 | 3300045976 | Ga0466967_0061760 | Ga0466967_0061760_1043_2011 | 290 |
| 201 | 3300037068 | Ga0373925_0011279 | Ga0373925_0011279_889_1857 | 291 |
| 202 | 3300053119 | Ga0500595_002109 | Ga0500595_002109_1374_2342 | 291 |
| 203 | 3300005329 | Ga0070683_100020392 | Ga0070683_1000203922 | 292 |
| 204 | 3300005337 | Ga0070682_100018684 | Ga0070682_1000186843 | 292 |
| 205 | 3300005530 | Ga0070679_100043461 | Ga0070679_1000434613 | 292 |
| 206 | 3300005530 | Ga0070679_100055274 | Ga0070679_1000552742 | 292 |
| 207 | 3300005535 | Ga0070684_100011602 | Ga0070684_1000116022 | 292 |
| 208 | 3300025911 | Ga0207654_10115909 | Ga0207654_101159091 | 292 |
| 209 | 3300025912 | Ga0207707_10007987 | Ga0207707_100079873 | 292 |
| 210 | 3300025913 | Ga0207695_10255184 | Ga0207695_102551842 | 292 |
| 211 | 3300025921 | Ga0207652_10050398 | Ga0207652_100503982 | 292 |
| 212 | 3300025944 | Ga0207661_10009413 | Ga0207661_100094138 | 292 |
| 213 | 3300035692 | Ga0373935_0091029 | Ga0373935_0091029_565_1533 | 292 |
| 214 | 3300035695 | Ga0373927_0030173 | Ga0373927_0030173_175_1143 | 292 |
| 215 | 3300036401 | Ga0373937_0116659 | Ga0373937_0116659_1438_2406 | 292 |
| 216 | 3300037068 | Ga0373925_0046835 | Ga0373925_0046835_684_1652 | 292 |
| 217 | 3300046472 | Ga0495580_0104752 | Ga0495580_0104752_580_1548 | 292 |
| 218 | 3300046477 | Ga0495664_0073584 | Ga0495664_0073584_490_1458 | 292 |
| 219 | 3300046517 | Ga0495630_0045415 | Ga0495630_0045415_339_1307 | 292 |
| 220 | 3300046663 | Ga0495635_0029732 | Ga0495635_0029732_2531_3499 | 292 |
| 221 | 3300047315 | Ga0495581_0080602 | Ga0495581_0080602_530_1498 | 292 |
| 222 | 3300047471 | Ga0495684_0054971 | Ga0495684_0054971_1995_2963 | 292 |
| 223 | 3300048929 | Ga0496126_0135884 | Ga0496126_0135884_186_1154 | 292 |
| 224 | 3300005983 | Ga0081540_1004707 | Ga0081540_10047074 | 293 |
| 225 | 3300048927 | Ga0496124_0181117 | Ga0496124_0181117_297_1265 | 293 |
| 226 | 3300049586 | Ga0501070_0101273 | Ga0501070_0101273_725_1699 | 293 |
| 227 | 3300053086 | Ga0500578_0142492 | Ga0500578_0142492_114_1082 | 293 |
| 228 | 3300053093 | Ga0500651_0003779 | Ga0500651_0003779_1769_2737 | 293 |
| 229 | 3300053096 | Ga0500641_0025728 | Ga0500641_0025728_283_1251 | 293 |
| 230 | 3300005468 | Ga0070707_100106031 | Ga0070707_1001060312 | 294 |
| 231 | 3300025922 | Ga0207646_10088457 | Ga0207646_100884572 | 294 |
| 232 | 3300003203 | JGI25406J46586_10016723 | JGI25406J46586_100167233 | 295 |
| 233 | 3300005983 | Ga0081540_1023016 | Ga0081540_10230165 | 295 |
| 234 | 3300005985 | Ga0081539_10000148 | Ga0081539_1000014810 | 295 |
| 235 | 3300025915 | Ga0207693_10105736 | Ga0207693_101057361 | 295 |
| 236 | 3300025916 | Ga0207663_10254420 | Ga0207663_102544202 | 295 |
| 237 | 3300033180 | Ga0307510_10150176 | Ga0307510_101501762 | 295 |
| 238 | 3300035724 | Ga0373933_0000062 | Ga0373933_0000062_63570_64538 | 295 |
| 239 | 3300041491 | Ga0451833_0238202 | Ga0451833_0238202_83_1051 | 295 |
| 240 | 3300046514 | Ga0495618_0066493 | Ga0495618_0066493_1265_2233 | 295 |
| 241 | 3300046558 | Ga0495633_0068849 | Ga0495633_0068849_71_1039 | 295 |
| 242 | 3300046663 | Ga0495635_0007949 | Ga0495635_0007949_4614_5582 | 295 |
| 243 | 3300046690 | Ga0495624_0034259 | Ga0495624_0034259_290_1258 | 295 |
| 244 | 3300048904 | Ga0496101_0067965 | Ga0496101_0067965_40_1008 | 295 |
| 245 | 3300048908 | Ga0496105_0000208 | Ga0496105_0000208_9017_9985 | 295 |
| 246 | 3300048909 | Ga0496106_0095549 | Ga0496106_0095549_987_1955 | 295 |
| 247 | 3300048922 | Ga0496119_0056162 | Ga0496119_0056162_231_1199 | 295 |
| 248 | 3300048923 | Ga0496120_0027428 | Ga0496120_0027428_1360_2328 | 295 |
| 249 | 3300048924 | Ga0496121_0018372 | Ga0496121_0018372_5678_6652 | 295 |
| 250 | 3300048929 | Ga0496126_0006080 | Ga0496126_0006080_6021_6989 | 295 |
| 251 | 3300050516 | nmdc:mga0sz30_26893_c1 | nmdc:mga0sz30_26893_c1_78_1046 | 295 |
| 252 | 3300013296 | Ga0157374_10100276 | Ga0157374_101002761 | 296 |
| 253 | 3300013308 | Ga0157375_10164872 | Ga0157375_101648721 | 296 |
| 254 | 3300014325 | Ga0163163_10581492 | Ga0163163_105814921 | 296 |
| 255 | 3300025986 | Ga0207658_10232301 | Ga0207658_102323012 | 296 |
| 256 | 3300026121 | Ga0207683_10011530 | Ga0207683_100115308 | 296 |
| 257 | 3300046459 | Ga0495629_0271696 | Ga0495629_0271696_166_1134 | 296 |
| 258 | 3300046519 | Ga0495632_0043498 | Ga0495632_0043498_265_1233 | 296 |
| 259 | 3300048903 | Ga0496100_0051585 | Ga0496100_0051585_1568_2536 | 296 |
| 260 | 3300048904 | Ga0496101_0273747 | Ga0496101_0273747_246_1214 | 296 |
| 261 | 3300048905 | Ga0496102_0029057 | Ga0496102_0029057_3680_4648 | 296 |
| 262 | 3300048907 | Ga0496104_0189719 | Ga0496104_0189719_437_1405 | 296 |
| 263 | 3300048910 | Ga0496107_0080650 | Ga0496107_0080650_685_1653 | 296 |
| 264 | 3300048911 | Ga0496108_0062625 | Ga0496108_0062625_176_1144 | 296 |
| 265 | 3300048912 | Ga0496109_0061834 | Ga0496109_0061834_1504_2472 | 296 |
| 266 | 3300048915 | Ga0496112_0037479 | Ga0496112_0037479_3286_4254 | 296 |
| 267 | 3300048918 | Ga0496115_0299601 | Ga0496115_0299601_275_1243 | 296 |
| 268 | 3300048929 | Ga0496126_0049358 | Ga0496126_0049358_455_1429 | 296 |
| 269 | 3300048929 | Ga0496126_0114010 | Ga0496126_0114010_948_1916 | 296 |
| 270 | 3300049577 | Ga0501041_0052655 | Ga0501041_0052655_389_1357 | 296 |
| 271 | 3300049587 | Ga0501071_0250546 | Ga0501071_0250546_20_988 | 296 |
| 272 | 3300005262 | Ga0065165_1001283 | Ga0065165_100128326 | 297 |
| 273 | 3300005983 | Ga0081540_1089534 | Ga0081540_10895342 | 297 |
| 274 | 3300025302 | Ga0207426_1000574 | Ga0207426_10005742 | 297 |
| 275 | 3300025918 | Ga0207662_10158406 | Ga0207662_101584062 | 297 |
| 276 | 3300028379 | Ga0268266_10019183 | Ga0268266_100191838 | 297 |
| 277 | 3300044693 | Ga0466961_0213404 | Ga0466961_0213404_99_1067 | 297 |
| 278 | 3300005548 | Ga0070665_100386310 | Ga0070665_1003863102 | 298 |
| 279 | 3300005842 | Ga0068858_100242536 | Ga0068858_1002425361 | 298 |
| 280 | 3300006178 | Ga0075367_10057509 | Ga0075367_100575093 | 298 |
| 281 | 3300025297 | Ga0209758_1007379 | Ga0209758_10073796 | 298 |
| 282 | 3300048918 | Ga0496115_0159449 | Ga0496115_0159449_853_1821 | 298 |
| 283 | 3300049581 | Ga0501047_0135509 | Ga0501047_0135509_180_1148 | 298 |
| 284 | 3300006871 | Ga0075434_100024593 | Ga0075434_1000245934 | 299 |
| 285 | 3300007076 | Ga0075435_100021468 | Ga0075435_1000214683 | 299 |
| 286 | 3300025921 | Ga0207652_10412294 | Ga0207652_104122941 | 299 |
| 287 | 3300031242 | Ga0265329_10052548 | Ga0265329_100525481 | 299 |
| 288 | 3300031247 | Ga0265340_10002448 | Ga0265340_100024482 | 299 |
| 289 | 3300031249 | Ga0265339_10119678 | Ga0265339_101196781 | 299 |
| 290 | 3300031344 | Ga0265316_10175752 | Ga0265316_101757521 | 299 |
| 291 | 3300049568 | Ga0501031_0013260 | Ga0501031_0013260_1235_2209 | 299 |
| 292 | 3300049569 | Ga0501032_0000038 | Ga0501032_0000038_3799_4773 | 299 |
| 293 | 3300049570 | Ga0501033_0000089 | Ga0501033_0000089_54992_55966 | 299 |
| 294 | 3300049571 | Ga0501034_0000228 | Ga0501034_0000228_14806_15780 | 299 |
| 295 | 3300049572 | Ga0501036_0000010 | Ga0501036_0000010_100549_101523 | 299 |
| 296 | 3300049573 | Ga0501037_0000135 | Ga0501037_0000135_20147_21121 | 299 |
| 297 | 3300049574 | Ga0501038_0000054 | Ga0501038_0000054_84313_85287 | 299 |
| 298 | 3300049575 | Ga0501039_0013587 | Ga0501039_0013587_944_1918 | 299 |
| 299 | 3300049579 | Ga0501043_0000021 | Ga0501043_0000021_2231_3205 | 299 |
| 300 | 3300049580 | Ga0501046_0000341 | Ga0501046_0000341_44501_45475 | 299 |
| 301 | 3300049581 | Ga0501047_0000041 | Ga0501047_0000041_150265_151239 | 299 |
| 302 | 3300049583 | Ga0501067_0000206 | Ga0501067_0000206_22253_23227 | 299 |
| 303 | 3300049587 | Ga0501071_0057194 | Ga0501071_0057194_835_1809 | 299 |
| 304 | 3300049588 | Ga0501072_0007562 | Ga0501072_0007562_1038_2012 | 299 |
| 305 | 3300049589 | Ga0501073_0000082 | Ga0501073_0000082_44652_45626 | 299 |
| 306 | 3300049590 | Ga0501074_0000415 | Ga0501074_0000415_4438_5412 | 299 |
| 307 | 3300049741 | Ga0501079_0006095 | Ga0501079_0006095_2992_3966 | 299 |
| 308 | 3300049742 | Ga0501080_0000506 | Ga0501080_0000506_9861_10835 | 299 |
| 309 | 3300049742 | Ga0501080_0384947 | Ga0501080_0384947_224_1198 | 299 |
| 310 | 3300049744 | Ga0501083_0023204 | Ga0501083_0023204_2833_3807 | 299 |
| 311 | 3300049822 | Ga0501035_0000146 | Ga0501035_0000146_40386_41360 | 299 |
| 312 | 3300049823 | Ga0501044_0001064 | Ga0501044_0001064_4438_5412 | 299 |
| 313 | 3300049824 | Ga0501045_0067513 | Ga0501045_0067513_930_1904 | 299 |
| 314 | 3300050512 | nmdc:mga0n895_6543_c1 | nmdc:mga0n895_6543_c1_8669_9637 | 299 |
| 315 | 3300054114 | Ga0501084_0001986 | Ga0501084_0001986_5168_6142 | 299 |
| 316 | 3300060353 | Ga0501082_0016806 | Ga0501082_0016806_78_1052 | 299 |
| 317 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_289776_290744 | 300 |
| 318 | 3300005618 | Ga0068864_100352679 | Ga0068864_1003526792 | 301 |
| 319 | 3300006871 | Ga0075434_100122913 | Ga0075434_1001229132 | 301 |
| 320 | 3300009177 | Ga0105248_10101265 | Ga0105248_101012653 | 301 |
| 321 | 3300009545 | Ga0105237_10136799 | Ga0105237_101367992 | 301 |
| 322 | 3300025900 | Ga0207710_10052194 | Ga0207710_100521942 | 301 |
| 323 | 3300025931 | Ga0207644_10218011 | Ga0207644_102180111 | 301 |
| 324 | 3300025949 | Ga0207667_10223048 | Ga0207667_102230482 | 301 |
| 325 | 3300026067 | Ga0207678_10007212 | Ga0207678_100072124 | 301 |
| 326 | 3300048915 | Ga0496112_0241052 | Ga0496112_0241052_699_1667 | 301 |
| 327 | 3300049582 | Ga0501048_0000022 | Ga0501048_0000022_21491_22465 | 301 |
| 328 | 3300050512 | nmdc:mga0n895_228832_c1 | nmdc:mga0n895_228832_c1_614_1582 | 301 |
| 329 | 3300005937 | Ga0081455_10119730 | Ga0081455_101197302 | 302 |
| 330 | 3300048929 | Ga0496126_0194465 | Ga0496126_0194465_442_1410 | 302 |
| 331 | 3300053087 | Ga0500643_000046 | Ga0500643_000046_82217_83185 | 302 |
| 332 | 3300053092 | Ga0500583_0037675 | Ga0500583_0037675_533_1504 | 302 |
| 333 | 3300053103 | Ga0500555_012563 | Ga0500555_012563_878_1849 | 302 |
| 334 | 3300053139 | Ga0500568_0008904 | Ga0500568_0008904_324_1292 | 302 |
| 335 | 3300053161 | Ga0500634_0104618 | Ga0500634_0104618_238_1209 | 302 |
| 336 | 3300013104 | Ga0157370_10043441 | Ga0157370_100434413 | 303 |
| 337 | 3300013307 | Ga0157372_10428630 | Ga0157372_104286302 | 303 |
| 338 | 3300025297 | Ga0209758_1003610 | Ga0209758_10036106 | 306 |
| 339 | 3300005339 | Ga0070660_100188978 | Ga0070660_1001889781 | 307 |
| 340 | 3300005530 | Ga0070679_100379164 | Ga0070679_1003791642 | 307 |
| 341 | 3300005616 | Ga0068852_100109398 | Ga0068852_1001093982 | 307 |
| 342 | 3300009551 | Ga0105238_10250583 | Ga0105238_102505832 | 307 |
| 343 | 3300026142 | Ga0207698_10126059 | Ga0207698_101260592 | 307 |
| 344 | 3300047317 | Ga0495604_0159387 | Ga0495604_0159387_291_1571 | 307 |
| 345 | 3300049579 | Ga0501043_0178711 | Ga0501043_0178711_652_1620 | 307 |
| 346 | 3300049822 | Ga0501035_0172819 | Ga0501035_0172819_354_1322 | 307 |
| 347 | 3300028379 | Ga0268266_10227592 | Ga0268266_102275922 | 309 |
| 348 | 3300048911 | Ga0496108_0312184 | Ga0496108_0312184_340_1308 | 310 |
| 349 | 3300025913 | Ga0207695_10062924 | Ga0207695_100629242 | 312 |
| 350 | 3300037466 | Ga0395898_0553571 | Ga0395898_0553571_52_1020 | 312 |
| 351 | 3300038443 | Ga0395901_0190471 | Ga0395901_0190471_1165_2133 | 312 |
| 352 | 3300025295 | Ga0209564_1000390 | Ga0209564_100039021 | 313 |
| 353 | 3300044684 | Ga0466966_0082034 | Ga0466966_0082034_1009_1977 | 313 |
| 354 | 3300027671 | Ga0209588_1015010 | Ga0209588_10150101 | 314 |
| 355 | 3300025261 | Ga0209233_1020676 | Ga0209233_10206762 | 316 |
| 356 | 3300053077 | Ga0495601_0186288 | Ga0495601_0186288_47_1015 | 316 |
| 357 | iso_pu_bacteria | 2841983080 | 2841988930 | 317 |
| 358 | iso_pu_bacteria | 2507262055 | 2507507866 | 318 |
| 359 | iso_pu_bacteria | 2513237096 | 2513653840 | 318 |
| 360 | iso_pu_bacteria | 2513237098 | 2513677685 | 318 |
| 361 | iso_pu_bacteria | 2513237101 | 2513695714 | 318 |
| 362 | iso_pu_bacteria | 2513237137 | 2513856279 | 318 |
| 363 | iso_pu_bacteria | 2513237141 | 2513891454 | 318 |
| 364 | iso_pu_bacteria | 2513237145 | 2513918180 | 318 |
| 365 | iso_pu_bacteria | 2513237161 | 2514009631 | 318 |
| 366 | iso_pu_bacteria | 2517093001 | 2517103940 | 318 |
| 367 | iso_pu_bacteria | 2517572143 | 2517891582 | 318 |
| 368 | iso_pu_bacteria | 2524023210 | 2524463546 | 318 |
| 369 | iso_pu_bacteria | 2524023228 | 2524538656 | 318 |
| 370 | iso_pu_bacteria | 2617270741 | 2617372509 | 318 |
| 371 | iso_pu_bacteria | 2667528175 | 2671118646 | 318 |
| 372 | iso_pu_bacteria | 2721755755 | 2723846961 | 318 |
| 373 | iso_pu_bacteria | 2728368998 | 2728749350 | 318 |
| 374 | iso_pu_bacteria | 2791355196 | 2793064548 | 318 |
| 375 | iso_pu_bacteria | 2791355197 | 2793066942 | 318 |
| 376 | iso_pu_bacteria | 2824600985 | 2824608722 | 318 |
| 377 | iso_pu_bacteria | 2824609381 | 2824613524 | 318 |
| 378 | iso_pu_bacteria | 2824617872 | 2824622854 | 318 |
| 379 | iso_pu_bacteria | 2824626560 | 2824631995 | 318 |
| 380 | iso_pu_bacteria | 2824635225 | 2824638574 | 318 |
| 381 | iso_pu_bacteria | 2824644064 | 2824647720 | 318 |
| 382 | iso_pu_bacteria | 2824653114 | 2824659331 | 318 |
| 383 | iso_pu_bacteria | 2824671348 | 2824675006 | 318 |
| 384 | iso_pu_bacteria | 2824679649 | 2824681476 | 318 |
| 385 | iso_pu_bacteria | 2824687955 | 2824693371 | 318 |
| 386 | iso_pu_bacteria | 2824714736 | 2824716228 | 318 |
| 387 | iso_pu_bacteria | 2824723954 | 2824726804 | 318 |
| 388 | iso_pu_bacteria | 2824773399 | 2824777345 | 318 |
| 389 | iso_pu_bacteria | 2838122688 | 2838122862 | 318 |
| 390 | iso_pu_bacteria | 2841941048 | 2841944850 | 318 |
| 391 | iso_pu_bacteria | 2841949485 | 2841950875 | 318 |
| 392 | iso_pu_bacteria | 2841957949 | 2841959901 | 318 |
| 393 | iso_pu_bacteria | 2841966195 | 2841973673 | 318 |
| 394 | iso_pu_bacteria | 2841974524 | 2841978568 | 318 |
| 395 | iso_pu_bacteria | 2849076700 | 2849078586 | 318 |
| 396 | iso_pu_bacteria | 2874604998 | 2874611074 | 318 |
| 397 | iso_pu_bacteria | 2876808645 | 2876817269 | 318 |
| 398 | iso_pu_bacteria | 2879110137 | 2879114509 | 318 |
| 399 | iso_pu_bacteria | 2879142872 | 2879148435 | 318 |
| 400 | iso_pu_bacteria | 2881364244 | 2881364743 | 318 |
| 401 | iso_pu_bacteria | 2883577096 | 2883577594 | 318 |
| 402 | iso_pu_bacteria | 2885374607 | 2885381643 | 318 |
| 403 | iso_pu_bacteria | 2885409591 | 2885409823 | 318 |
| 404 | iso_pu_bacteria | 2888419890 | 2888425402 | 318 |
| 405 | iso_pu_bacteria | 2889033259 | 2889038228 | 318 |
| 406 | iso_pu_bacteria | 2903748898 | 2903755238 | 318 |
| 407 | iso_pu_bacteria | 2903768456 | 2903772889 | 318 |
| 408 | iso_pu_bacteria | 2904690495 | 2904694433 | 318 |
| 409 | iso_pu_bacteria | 2904699407 | 2904704699 | 318 |
| 410 | iso_pu_bacteria | 2906610324 | 2906616756 | 318 |
| 411 | iso_pu_bacteria | 2906635258 | 2906640165 | 318 |
| 412 | iso_pu_bacteria | 2906643746 | 2906646931 | 318 |
| 413 | iso_pu_bacteria | 2906660503 | 2906667085 | 318 |
| 414 | iso_pu_bacteria | 2908739725 | 2908741929 | 318 |
| 415 | iso_pu_bacteria | 2908756301 | 2908759622 | 318 |
| 416 | iso_pu_bacteria | 2922361189 | 2922362653 | 318 |
| 417 | iso_pu_bacteria | 2922386360 | 2922387533 | 318 |
| 418 | iso_pu_bacteria | 2922393267 | 2922397272 | 318 |
| 419 | iso_pu_bacteria | 2922425934 | 2922431184 | 318 |
| 420 | iso_pu_bacteria | 2929615660 | 2929620450 | 318 |
| 421 | iso_pu_bacteria | 2929624759 | 2929626343 | 318 |
| 422 | iso_pu_bacteria | 2933577622 | 2933582368 | 318 |
| 423 | iso_pu_bacteria | 2935630451 | 2935633812 | 318 |
| 424 | iso_pu_bacteria | 2941507105 | 2941510885 | 318 |
| 425 | iso_pu_bacteria | 2941515067 | 2941518269 | 318 |
| 426 | iso_pu_bacteria | 2941523033 | 2941526860 | 318 |
| 427 | iso_pu_bacteria | 3005474847 | 3005481001 | 318 |
| 428 | iso_pu_bacteria | 3005587118 | 3005587255 | 318 |
| 429 | iso_pu_bacteria | 3005594810 | 3005600041 | 318 |
| 430 | iso_pu_bacteria | 3005718088 | 3005722964 | 318 |
| 431 | iso_pu_bacteria | 8006933436 | 8006939703 | 318 |
| 432 | iso_pu_bacteria | 8006964411 | 8006968467 | 318 |
| 433 | iso_pu_bacteria | 8006973647 | 8006979452 | 318 |
| 434 | iso_pu_bacteria | 8006984368 | 8006987402 | 318 |
| 435 | iso_pu_bacteria | 8006994254 | 8006994905 | 318 |
| 436 | iso_pu_bacteria | 8019555841 | 8019565598 | 318 |
| 437 | iso_pu_bacteria | 8019565922 | 8019575692 | 318 |
| 438 | iso_pu_bacteria | 8019659431 | 8019661399 | 318 |
| 439 | iso_pu_bacteria | 8055742211 | 8055745312 | 318 |
| 440 | iso_pu_bacteria | 8056673599 | 8056679475 | 318 |
| 441 | iso_pu_bacteria | 8056681323 | 8056684995 | 318 |
| 442 | iso_pu_bacteria | 8056689827 | 8056693457 | 318 |
| 443 | 3300007265 | Ga0099794_10125561 | Ga0099794_101255612 | 319 |
| 444 | 3300005329 | Ga0070683_100091955 | Ga0070683_1000919552 | 322 |
| 445 | 3300005336 | Ga0070680_100066425 | Ga0070680_1000664252 | 322 |
| 446 | 3300005336 | Ga0070680_100106009 | Ga0070680_1001060092 | 322 |
| 447 | 3300005339 | Ga0070660_100016099 | Ga0070660_1000160992 | 322 |
| 448 | 3300005435 | Ga0070714_100008845 | Ga0070714_1000088458 | 322 |
| 449 | 3300005435 | Ga0070714_100088105 | Ga0070714_1000881053 | 322 |
| 450 | 3300005435 | Ga0070714_100219322 | Ga0070714_1002193222 | 322 |
| 451 | 3300005436 | Ga0070713_100121064 | Ga0070713_1001210643 | 322 |
| 452 | 3300005437 | Ga0070710_10000708 | Ga0070710_1000070812 | 322 |
| 453 | 3300005439 | Ga0070711_100070979 | Ga0070711_1000709792 | 322 |
| 454 | 3300005455 | Ga0070663_100253703 | Ga0070663_1002537032 | 322 |
| 455 | 3300005456 | Ga0070678_100179583 | Ga0070678_1001795832 | 322 |
| 456 | 3300005458 | Ga0070681_10145484 | Ga0070681_101454842 | 322 |
| 457 | 3300005467 | Ga0070706_100060174 | Ga0070706_1000601743 | 322 |
| 458 | 3300005530 | Ga0070679_100222919 | Ga0070679_1002229192 | 322 |
| 459 | 3300005539 | Ga0068853_100055695 | Ga0068853_1000556953 | 322 |
| 460 | 3300005539 | Ga0068853_100227659 | Ga0068853_1002276592 | 322 |
| 461 | 3300005563 | Ga0068855_100109884 | Ga0068855_1001098842 | 322 |
| 462 | 3300005563 | Ga0068855_100125665 | Ga0068855_1001256652 | 322 |
| 463 | 3300005563 | Ga0068855_100259195 | Ga0068855_1002591952 | 322 |
| 464 | 3300005563 | Ga0068855_100357908 | Ga0068855_1003579082 | 322 |
| 465 | 3300005834 | Ga0068851_10017694 | Ga0068851_100176942 | 322 |
| 466 | 3300005841 | Ga0068863_100281933 | Ga0068863_1002819332 | 322 |
| 467 | 3300005842 | Ga0068858_100160769 | Ga0068858_1001607692 | 322 |
| 468 | 3300005843 | Ga0068860_100000471 | Ga0068860_10000047112 | 322 |
| 469 | 3300005983 | Ga0081540_1016036 | Ga0081540_10160362 | 322 |
| 470 | 3300006028 | Ga0070717_10077668 | Ga0070717_100776683 | 322 |
| 471 | 3300006173 | Ga0070716_100006048 | Ga0070716_1000060486 | 322 |
| 472 | 3300009093 | Ga0105240_10177078 | Ga0105240_101770782 | 322 |
| 473 | 3300009093 | Ga0105240_10436842 | Ga0105240_104368422 | 322 |
| 474 | 3300009101 | Ga0105247_10005426 | Ga0105247_100054267 | 322 |
| 475 | 3300009545 | Ga0105237_10056507 | Ga0105237_100565073 | 322 |
| 476 | 3300009551 | Ga0105238_10024830 | Ga0105238_100248303 | 322 |
| 477 | 3300009551 | Ga0105238_10250765 | Ga0105238_102507652 | 322 |
| 478 | 3300010375 | Ga0105239_10043806 | Ga0105239_100438063 | 322 |
| 479 | 3300013105 | Ga0157369_10011746 | Ga0157369_100117467 | 322 |
| 480 | 3300013296 | Ga0157374_10034436 | Ga0157374_100344362 | 322 |
| 481 | 3300025297 | Ga0209758_1004758 | Ga0209758_10047589 | 322 |
| 482 | 3300025898 | Ga0207692_10007642 | Ga0207692_100076423 | 322 |
| 483 | 3300025900 | Ga0207710_10008835 | Ga0207710_100088354 | 322 |
| 484 | 3300025910 | Ga0207684_10052020 | Ga0207684_100520202 | 322 |
| 485 | 3300025912 | Ga0207707_10049332 | Ga0207707_100493322 | 322 |
| 486 | 3300025912 | Ga0207707_10370869 | Ga0207707_103708692 | 322 |
| 487 | 3300025913 | Ga0207695_10432675 | Ga0207695_104326752 | 322 |
| 488 | 3300025914 | Ga0207671_10089913 | Ga0207671_100899131 | 322 |
| 489 | 3300025915 | Ga0207693_10002843 | Ga0207693_100028432 | 322 |
| 490 | 3300025915 | Ga0207693_10152974 | Ga0207693_101529742 | 322 |
| 491 | 3300025916 | Ga0207663_10002786 | Ga0207663_100027863 | 322 |
| 492 | 3300025917 | Ga0207660_10019450 | Ga0207660_100194504 | 322 |
| 493 | 3300025917 | Ga0207660_10419381 | Ga0207660_104193811 | 322 |
| 494 | 3300025919 | Ga0207657_10013488 | Ga0207657_100134883 | 322 |
| 495 | 3300025921 | Ga0207652_10019069 | Ga0207652_100190692 | 322 |
| 496 | 3300025924 | Ga0207694_10046849 | Ga0207694_100468492 | 322 |
| 497 | 3300025928 | Ga0207700_10044345 | Ga0207700_100443452 | 322 |
| 498 | 3300025928 | Ga0207700_10048261 | Ga0207700_100482613 | 322 |
| 499 | 3300025929 | Ga0207664_10023663 | Ga0207664_100236636 | 322 |
| 500 | 3300025929 | Ga0207664_10025806 | Ga0207664_100258061 | 322 |
| 501 | 3300025929 | Ga0207664_10369767 | Ga0207664_103697671 | 322 |
| 502 | 3300025939 | Ga0207665_10005334 | Ga0207665_100053342 | 322 |
| 503 | 3300025949 | Ga0207667_10045963 | Ga0207667_100459633 | 322 |
| 504 | 3300025949 | Ga0207667_10422432 | Ga0207667_104224322 | 322 |
| 505 | 3300026035 | Ga0207703_10280566 | Ga0207703_102805662 | 322 |
| 506 | 3300026041 | Ga0207639_10061108 | Ga0207639_100611082 | 322 |
| 507 | 3300026041 | Ga0207639_10394740 | Ga0207639_103947402 | 322 |
| 508 | 3300026088 | Ga0207641_10479857 | Ga0207641_104798571 | 322 |
| 509 | 3300026089 | Ga0207648_10163419 | Ga0207648_101634192 | 322 |
| 510 | 3300026116 | Ga0207674_10547330 | Ga0207674_105473301 | 322 |
| 511 | 3300026142 | Ga0207698_10300397 | Ga0207698_103003972 | 322 |
| 512 | 3300028380 | Ga0268265_10120862 | Ga0268265_101208622 | 322 |
| 513 | 3300028381 | Ga0268264_10000048 | Ga0268264_10000048254 | 322 |
| 514 | 3300028653 | Ga0265323_10027004 | Ga0265323_100270043 | 322 |
| 515 | 3300028666 | Ga0265336_10002023 | Ga0265336_100020237 | 322 |
| 516 | 3300028800 | Ga0265338_10000034 | Ga0265338_1000003420 | 322 |
| 517 | 3300031249 | Ga0265339_10019603 | Ga0265339_100196033 | 322 |
| 518 | 3300031507 | Ga0307509_10017893 | Ga0307509_100178939 | 322 |
| 519 | 3300031507 | Ga0307509_10074154 | Ga0307509_100741543 | 322 |
| 520 | 3300031616 | Ga0307508_10158265 | Ga0307508_101582653 | 322 |
| 521 | 3300031730 | Ga0307516_10079612 | Ga0307516_100796122 | 322 |
| 522 | 3300031730 | Ga0307516_10113310 | Ga0307516_101133102 | 322 |
| 523 | 3300033179 | Ga0307507_10030513 | Ga0307507_100305136 | 322 |
| 524 | 3300035170 | Ga0373943_0074817 | Ga0373943_0074817_316_1284 | 322 |
| 525 | 3300035695 | Ga0373927_0004705 | Ga0373927_0004705_3062_4030 | 322 |
| 526 | 3300035695 | Ga0373927_0006809 | Ga0373927_0006809_5287_6255 | 322 |
| 527 | 3300035725 | Ga0373947_0053958 | Ga0373947_0053958_346_1314 | 322 |
| 528 | 3300035725 | Ga0373947_0114144 | Ga0373947_0114144_26_994 | 322 |
| 529 | 3300036401 | Ga0373937_0094825 | Ga0373937_0094825_796_1764 | 322 |
| 530 | 3300037068 | Ga0373925_0057037 | Ga0373925_0057037_461_1429 | 322 |
| 531 | 3300037068 | Ga0373925_0074965 | Ga0373925_0074965_1074_2042 | 322 |
| 532 | 3300037853 | Ga0436364_0563114 | Ga0436364_0563114_363_1331 | 322 |
| 533 | 3300046455 | Ga0495603_0012346 | Ga0495603_0012346_694_1662 | 322 |
| 534 | 3300046455 | Ga0495603_0105380 | Ga0495603_0105380_481_1449 | 322 |
| 535 | 3300046472 | Ga0495580_0038757 | Ga0495580_0038757_2094_3062 | 322 |
| 536 | 3300046518 | Ga0495631_0109839 | Ga0495631_0109839_50_1018 | 322 |
| 537 | 3300046557 | Ga0495622_0060991 | Ga0495622_0060991_199_1167 | 322 |
| 538 | 3300046678 | Ga0495599_0040564 | Ga0495599_0040564_1844_2821 | 322 |
| 539 | 3300048909 | Ga0496106_0001121 | Ga0496106_0001121_4301_5269 | 322 |
| 540 | 3300048914 | Ga0496111_0005833 | Ga0496111_0005833_1833_2801 | 322 |
| 541 | 3300048915 | Ga0496112_0026322 | Ga0496112_0026322_3224_4192 | 322 |
| 542 | 3300048918 | Ga0496115_0029851 | Ga0496115_0029851_1641_2609 | 322 |
| 543 | 3300048918 | Ga0496115_0390914 | Ga0496115_0390914_109_1077 | 322 |
| 544 | 3300048920 | Ga0496117_0091713 | Ga0496117_0091713_397_1365 | 322 |
| 545 | 3300048921 | Ga0496118_0006738 | Ga0496118_0006738_3317_4285 | 322 |
| 546 | 3300048922 | Ga0496119_0030642 | Ga0496119_0030642_1828_2796 | 322 |
| 547 | 3300048924 | Ga0496121_0005409 | Ga0496121_0005409_15233_16201 | 322 |
| 548 | 3300048924 | Ga0496121_0014219 | Ga0496121_0014219_6562_7530 | 322 |
| 549 | 3300048924 | Ga0496121_0026682 | Ga0496121_0026682_4050_5018 | 322 |
| 550 | 3300048924 | Ga0496121_0094400 | Ga0496121_0094400_485_1453 | 322 |
| 551 | 3300048927 | Ga0496124_0052593 | Ga0496124_0052593_11_979 | 322 |
| 552 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_301582_302556 | 322 |
| 553 | 3300048929 | Ga0496126_0005981 | Ga0496126_0005981_11711_12679 | 322 |
| 554 | 3300049568 | Ga0501031_0200539 | Ga0501031_0200539_228_1196 | 322 |
| 555 | 3300049570 | Ga0501033_0041227 | Ga0501033_0041227_1841_2809 | 322 |
| 556 | 3300049570 | Ga0501033_0106426 | Ga0501033_0106426_106_1074 | 322 |
| 557 | 3300049571 | Ga0501034_0179401 | Ga0501034_0179401_520_1488 | 322 |
| 558 | 3300049572 | Ga0501036_0165755 | Ga0501036_0165755_53_1021 | 322 |
| 559 | 3300049575 | Ga0501039_0361440 | Ga0501039_0361440_144_1112 | 322 |
| 560 | 3300049579 | Ga0501043_0065543 | Ga0501043_0065543_668_1636 | 322 |
| 561 | 3300049580 | Ga0501046_0032068 | Ga0501046_0032068_3215_4183 | 322 |
| 562 | 3300049581 | Ga0501047_0132080 | Ga0501047_0132080_165_1133 | 322 |
| 563 | 3300049823 | Ga0501044_0002044 | Ga0501044_0002044_21688_22656 | 322 |
| 564 | 3300049823 | Ga0501044_0111045 | Ga0501044_0111045_60_1031 | 322 |
| 565 | 3300050493 | nmdc:mga0k408_157891_c1 | nmdc:mga0k408_157891_c1_262_1230 | 322 |
| 566 | 3300050511 | nmdc:mga08y16_137652_c1 | nmdc:mga08y16_137652_c1_227_1195 | 322 |
| 567 | 3300053140 | Ga0500573_0122294 | Ga0500573_0122294_330_1307 | 322 |
| 568 | 3300053148 | Ga0500590_118112 | Ga0500590_118112_262_1230 | 322 |
| 569 | 3300053162 | Ga0500638_107593 | Ga0500638_107593_244_1221 | 322 |
| 570 | 3300053177 | Ga0500636_0163531 | Ga0500636_0163531_148_1125 | 322 |
| 571 | 3300053735 | Ga0500596_008375 | Ga0500596_008375_445_1413 | 322 |
| 572 | 3300003203 | JGI25406J46586_10000021 | JGI25406J46586_1000002114 | 324 |
| 573 | 3300005985 | Ga0081539_10000051 | Ga0081539_10000051107 | 324 |
| 574 | 3300038443 | Ga0395901_0195365 | Ga0395901_0195365_1134_2108 | 324 |
| 575 | 3300046507 | Ga0495606_0010333 | Ga0495606_0010333_2808_3782 | 324 |
| 576 | 3300047469 | Ga0495673_0019752 | Ga0495673_0019752_2380_3354 | 324 |
| 577 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_455547_456521 | 324 |
| 578 | 3300048929 | Ga0496126_0008347 | Ga0496126_0008347_5638_6612 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9096 | 2 | 324 |
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9042 | 2 | 324 |
| 4a27-assembly1.cif.gz_B | crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein | 0.8984 | 1 | 323 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.8922 | 2 | 323 |
| 4a27-assembly1.cif.gz_A | crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein | 0.8911 | 1 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8MNM6_143_282_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9467 | 128 | 237 | 3.40.50.720 |
| af_A0A1D6HNQ2_3_340_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9135 | 1 | 324 | 3.90.180.10 |
| af_A0A1D6HNQ2_3_340_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9108 | 1 | 324 | 3.90.180.10 |
| af_Q75JT6_1_334_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9092 | 1 | 323 | 3.90.180.10 |
| af_O74489_128_266_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.904 | 126 | 263 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2NFX9-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9365 | 121 | 235 |
GO:0016491
|
| AF-A0A4U9HK34-F1-model_v4 | Quinone oxidoreductase 1 (EC 1.6.5.5) | 0.9287 | 67 | 235 |
GO:0003960
GO:0070402 |
| AF-A0A522TED3-F1-model_v4 | NAD(P)H-quinone oxidoreductase | 0.9214 | 1 | 324 |
GO:0016651
GO:0070402 |
| AF-A0A355F2Z3-F1-model_v4 | NAD(P)H quinone oxidoreductase, PIG3 family protein | 0.9197 | 16 | 324 |
GO:0016651
GO:0070402 |
| AF-A0A0A0BYB4-F1-model_v4 | NADPH:quinone oxidoreductase | 0.9195 | 137 | 324 |
GO:0016651
GO:0070402 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar