F465698

General Info

Members Datasets Scaffolds Average Seq Length
578 342 1156 332

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000746|Ga0070703_100007463
Length 373
Sequence MAAHLVYKEILGDSEMRQAQVLGQWPAPRGGGDGEDWTMLISRHARRTAAILFGLGVALTSTAAIGQKREFSFAYDQPKNSGYGVGADIFSKKLVELSKGTLSINQYPSAQLGTEAQTMQKVQTGDIDFVMLSTANASTAQPESGVFSLHFIFRDEAHAIKVLGDPSVIAAMKDLYAAKIKGAHMLALGSQGLRHMYGKKAVQKLADIKGAKMRVQATVTEDTLFPAYGAQVVHMPFGEVYTSLQTGVVDMAENGINNYLINKHYEPAPVLSLTEHEANNAALFVSDKVWQSLSAEQKGWVQAAADEISRNEPAAAFMLEHEALAKLQKIGVKIVRDVDKSGFQSVSKPIQDKLAKDLGPNAVKVLGLVRNVK

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
228 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
231 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
338 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
339 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 3.46
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10000746 3300005406 Bacteria 10858
2 2214800760 2209111006 Bacteria 10890
3 ARSoilYngRDRAFT_c00057 3300000042 Bacteria 18462
4 ARcpr5yngRDRAFT_c000673 3300000043 Bacteria 4250
5 ARSoilOldRDRAFT_c000044 3300000044 Bacteria 26451
6 ARCol0yngRDRAFT_1000153 3300000652 Bacteria 12275
7 JGI25406J46586_10000826 3300003203 Bacteria 14573
8 JGI25405J52794_10001935 3300003911 Bacteria 3505
9 Ga0065717_1002193 3300005276 Bacteria 2535
10 Ga0065716_1001695 3300005277 Bacteria 4115
11 Ga0065704_10084341 3300005289 Bacteria 3345
12 Ga0065712_10071542 3300005290 Bacteria 5192
13 Ga0065715_10001318 3300005293 Bacteria 10293
14 Ga0065715_10144991 3300005293 Bacteria 1800
15 Ga0070658_10035834 3300005327 Bacteria 3997
16 Ga0070658_10123637 3300005327 Bacteria 2152
17 Ga0070676_10113303 3300005328 Bacteria 1692
18 Ga0070683_100078518 3300005329 Bacteria 3088
19 Ga0070683_100115860 3300005329 Bacteria 2530
20 Ga0070690_100022947 3300005330 Bacteria 3823
21 Ga0070670_100070304 3300005331 Bacteria 3005
22 Ga0070670_100309827 3300005331 Bacteria 1382
23 Ga0070677_10020348 3300005333 Bacteria 2417
24 Ga0070677_10098690 3300005333 Bacteria 1284
25 Ga0068869_100000039 3300005334 Bacteria 54386
26 Ga0068869_100144735 3300005334 Bacteria 1838
27 Ga0070680_100000933 3300005336 Bacteria 20696
28 Ga0070680_100003206 3300005336 Bacteria 12165
29 Ga0070680_100169296 3300005336 Bacteria 1838
30 Ga0070682_100035457 3300005337 Bacteria 3046
31 Ga0070660_100014143 3300005339 Bacteria 5745
32 Ga0070660_100027333 3300005339 Bacteria 4257
33 Ga0070660_100267836 3300005339 Bacteria 1396
34 Ga0070689_100017381 3300005340 Bacteria 5281
35 Ga0070689_100150147 3300005340 Bacteria 1879
36 Ga0070691_10009000 3300005341 Bacteria 4567
37 Ga0070691_10025475 3300005341 Bacteria 2754
38 Ga0070687_100049318 3300005343 Bacteria 2169
39 Ga0070687_100166548 3300005343 Bacteria 1308
40 Ga0070687_100194776 3300005343 Bacteria 1224
41 Ga0070661_100055552 3300005344 Bacteria 2899
42 Ga0070661_100128324 3300005344 Bacteria 1903
43 Ga0070692_10030076 3300005345 Bacteria 2713
44 Ga0070668_100017292 3300005347 Bacteria 5399
45 Ga0070668_100042788 3300005347 Bacteria 3472
46 Ga0070668_100136857 3300005347 Bacteria 1971
47 Ga0070668_100150793 3300005347 Bacteria 1880
48 Ga0070669_100059437 3300005353 Bacteria 2807
49 Ga0070675_100296524 3300005354 Bacteria 1424
50 Ga0070673_100481900 3300005364 Bacteria 1120
51 Ga0070688_100001879 3300005365 Bacteria 10522
52 Ga0070659_100009187 3300005366 Bacteria 7254
53 Ga0070659_100023236 3300005366 Bacteria 4742
54 Ga0070667_100000488 3300005367 Bacteria 40240
55 Ga0070667_100102127 3300005367 Bacteria 2477
56 Ga0070709_10017300 3300005434 Bacteria 4133
57 Ga0070709_10188712 3300005434 Bacteria 1452
58 Ga0070709_10258273 3300005434 Bacteria 1258
59 Ga0070714_100018028 3300005435 Bacteria 5727
60 Ga0070714_100076575 3300005435 Bacteria 2904
61 Ga0070714_100110567 3300005435 Bacteria 2433
62 Ga0070713_100075891 3300005436 Bacteria 2852
63 Ga0070711_100058899 3300005439 Bacteria 2665
64 Ga0070705_100000029 3300005440 Bacteria 74892
65 Ga0070705_100038253 3300005440 Bacteria 2713
66 Ga0070705_100113402 3300005440 Bacteria 1737
67 Ga0070700_100001497 3300005441 Bacteria 11629
68 Ga0070700_100015163 3300005441 Bacteria 4364
69 Ga0070694_100000652 3300005444 Bacteria 19181
70 Ga0070708_100002320 3300005445 Bacteria 14723
71 Ga0070663_100008847 3300005455 Bacteria 6213
72 Ga0070663_100023132 3300005455 Bacteria 4162
73 Ga0070678_100006921 3300005456 Bacteria 6689
74 Ga0070678_100092721 3300005456 Bacteria 2321
75 Ga0070662_100003081 3300005457 Bacteria 10344
76 Ga0070662_100013722 3300005457 Bacteria 5395
77 Ga0070681_10038482 3300005458 Bacteria 4796
78 Ga0070681_10115718 3300005458 Bacteria 2619
79 Ga0070681_10157011 3300005458 Bacteria 2199
80 Ga0070681_10192388 3300005458 Bacteria 1960
81 Ga0070681_10219770 3300005458 Bacteria 1815
82 Ga0068867_100002184 3300005459 Bacteria 13734
83 Ga0068867_100017486 3300005459 Bacteria 5093
84 Ga0068867_100117012 3300005459 Bacteria 2055
85 Ga0070706_100021874 3300005467 Bacteria 5889
86 Ga0070707_100135285 3300005468 Bacteria 2398
87 Ga0070698_100002091 3300005471 Bacteria 22152
88 Ga0070698_100177985 3300005471 Bacteria 2065
89 Ga0070698_100182302 3300005471 Bacteria 2038
90 Ga0074259_11019792 3300005507 Bacteria 3086
91 Ga0070699_100000947 3300005518 Bacteria 27076
92 Ga0070699_100013134 3300005518 Bacteria 7140
93 Ga0070699_100207974 3300005518 Bacteria 1741
94 Ga0070679_100009132 3300005530 Bacteria 9359
95 Ga0070679_100022933 3300005530 Bacteria 6105
96 Ga0070679_100057578 3300005530 Bacteria 3874
97 Ga0070679_100122680 3300005530 Bacteria 2582
98 Ga0070684_100010266 3300005535 Bacteria 7412
99 Ga0070697_100187495 3300005536 Bacteria 1755
100 Ga0068853_100015534 3300005539 Bacteria 6254
101 Ga0068853_100083026 3300005539 Bacteria 2807
102 Ga0070672_100101954 3300005543 Bacteria 2329
103 Ga0070686_100053084 3300005544 Bacteria 2586
104 Ga0070695_100006175 3300005545 Bacteria 7080
105 Ga0070696_100001966 3300005546 Bacteria 13495
106 Ga0070696_100004759 3300005546 Bacteria 9065
107 Ga0070696_100016707 3300005546 Bacteria 4949
108 Ga0070696_100081234 3300005546 Bacteria 2296
109 Ga0070693_100097099 3300005547 Bacteria 1788
110 Ga0070704_100000624 3300005549 Bacteria 17082
111 Ga0070704_100005471 3300005549 Bacteria 7401
112 Ga0068855_100219987 3300005563 Bacteria 2130
113 Ga0068855_100295627 3300005563 Bacteria 1794
114 Ga0070664_100015069 3300005564 Bacteria 6312
115 Ga0070664_100023513 3300005564 Bacteria 5092
116 Ga0070664_100041115 3300005564 Bacteria 3900
117 Ga0068857_100025254 3300005577 Bacteria 5232
118 Ga0068854_100241517 3300005578 Bacteria 1438
119 Ga0068856_100033873 3300005614 Bacteria 5002
120 Ga0068856_100309998 3300005614 Bacteria 1596
121 Ga0068856_100587956 3300005614 Bacteria 1134
122 Ga0070702_100046999 3300005615 Bacteria 2449
123 Ga0068852_100414326 3300005616 Bacteria 1328
124 Ga0068859_100000189 3300005617 Bacteria 59789
125 Ga0068859_100032215 3300005617 Bacteria 5266
126 Ga0068859_100134543 3300005617 Bacteria 2544
127 Ga0068864_100000192 3300005618 Bacteria 55904
128 Ga0068861_100011083 3300005719 Bacteria 6263
129 Ga0068861_100107550 3300005719 Bacteria 2230
130 Ga0068851_10002769 3300005834 Bacteria 7726
131 Ga0068863_100012588 3300005841 Bacteria 8160
132 Ga0068863_100181101 3300005841 Bacteria 2022
133 Ga0068863_100204759 3300005841 Bacteria 1899
134 Ga0068863_100328025 3300005841 Bacteria 1488
135 Ga0068858_100022002 3300005842 Bacteria 5955
136 Ga0068858_100114748 3300005842 Bacteria 2517
137 Ga0068860_100000350 3300005843 Bacteria 62017
138 Ga0068860_100009593 3300005843 Bacteria 9619
139 Ga0068862_100000691 3300005844 Bacteria 34469
140 Ga0068862_100048145 3300005844 Bacteria 3639
141 Ga0068862_100057387 3300005844 Bacteria 3339
142 Ga0068862_100066585 3300005844 Bacteria 3104
143 Ga0081455_10000012 3300005937 Bacteria 201668
144 Ga0081455_10034958 3300005937 Bacteria 4497
145 Ga0081455_10097858 3300005937 Bacteria 2363
146 Ga0081455_10135784 3300005937 Bacteria 1917
147 Ga0081540_1001830 3300005983 Bacteria 17860
148 Ga0081539_10002294 3300005985 Bacteria 27712
149 Ga0070717_10275687 3300006028 Bacteria 1490
150 Ga0075364_10028110 3300006051 Bacteria 3598
151 Ga0070716_100079022 3300006173 Bacteria 1958
152 Ga0075366_10083127 3300006195 Bacteria 1913
153 Ga0097621_100001440 3300006237 Bacteria 16328
154 Ga0075370_10013741 3300006353 Bacteria 4309
155 Ga0068871_100002792 3300006358 Bacteria 11935
156 Ga0068871_100310511 3300006358 Bacteria 1386
157 Ga0075434_100152364 3300006871 Bacteria 2332
158 Ga0068865_100148051 3300006881 Bacteria 1778
159 Ga0075436_100057054 3300006914 Bacteria 2697
160 Ga0075436_100125947 3300006914 Bacteria 1795
161 Ga0097620_100000189 3300006931 Bacteria 59789
162 Ga0097620_100032216 3300006931 Bacteria 5266
163 Ga0097620_100134544 3300006931 Bacteria 2544
164 Ga0075435_100002930 3300007076 Bacteria 11463
165 Ga0105251_10065994 3300009011 Bacteria 1693
166 Ga0105240_10004752 3300009093 Bacteria 20518
167 Ga0105240_10025445 3300009093 Bacteria 7776
168 Ga0105240_10079097 3300009093 Bacteria 4047
169 Ga0111539_10000114 3300009094 Bacteria 88757
170 Ga0111539_10011997 3300009094 Bacteria 10864
171 Ga0111539_10416843 3300009094 Bacteria 1564
172 Ga0105247_10017646 3300009101 Bacteria 4280
173 Ga0114129_10733661 3300009147 Bacteria 1266
174 Ga0105243_10026263 3300009148 Bacteria 4457
175 Ga0105242_10455801 3300009176 Bacteria 1207
176 Ga0105248_10013370 3300009177 Bacteria 9034
177 Ga0105248_10131270 3300009177 Bacteria 2826
178 Ga0105238_10021202 3300009551 Bacteria 6623
179 Ga0105249_10001774 3300009553 Bacteria 18804
180 Ga0105249_10170477 3300009553 Bacteria 2110
181 Ga0105239_10053091 3300010375 Bacteria 4446
182 Ga0105239_10180994 3300010375 Bacteria 2358
183 Ga0157320_1000654 3300012481 Bacteria 1502
184 Ga0157342_1000297 3300012507 Bacteria 2801
185 Ga0157338_1000224 3300012515 Bacteria 2975
186 Ga0157371_10008859 3300013102 Bacteria 7969
187 Ga0157370_10010239 3300013104 Bacteria 9901
188 Ga0157369_10051616 3300013105 Bacteria 4450
189 Ga0157369_10117912 3300013105 Bacteria 2818
190 Ga0157378_10242284 3300013297 Bacteria 1723
191 Ga0157372_10043914 3300013307 Bacteria 4951
192 Ga0157372_10086413 3300013307 Bacteria 3558
193 Ga0157372_10222015 3300013307 Bacteria 2190
194 Ga0157372_10266014 3300013307 Bacteria 1991
195 Ga0157375_10022576 3300013308 Bacteria 5793
196 Ga0163163_10005846 3300014325 Bacteria 10702
197 Ga0157380_10061308 3300014326 Bacteria 3009
198 Ga0157377_10085370 3300014745 Bacteria 1853
199 Ga0157379_10000028 3300014968 Bacteria 86433
200 Ga0157379_10011943 3300014968 Bacteria 7588
201 Ga0157376_10020495 3300014969 Bacteria 5115
202 Ga0163161_10003601 3300017792 Bacteria 10864
203 Ga0213872_10069800 3300021361 Bacteria 1585
204 Ga0213875_10048223 3300021388 Bacteria 1998
205 Ga0207666_1000497 3300025271 Bacteria 4888
206 Ga0209758_1001507 3300025297 Bacteria 27061
207 Ga0207697_10021107 3300025315 Bacteria 2667
208 Ga0207692_10013091 3300025898 Bacteria 3589
209 Ga0207688_10046379 3300025901 Bacteria 2426
210 Ga0207688_10078506 3300025901 Bacteria 1882
211 Ga0207647_10008867 3300025904 Bacteria 7175
212 Ga0207699_10015906 3300025906 Bacteria 3922
213 Ga0207699_10025985 3300025906 Bacteria 3222
214 Ga0207699_10054214 3300025906 Bacteria 2381
215 Ga0207645_10058475 3300025907 Bacteria 2461
216 Ga0207645_10087504 3300025907 Bacteria 2002
217 Ga0207705_10019721 3300025909 Bacteria 4822
218 Ga0207705_10110771 3300025909 Bacteria 2028
219 Ga0207684_10025016 3300025910 Bacteria 5088
220 Ga0207684_10063778 3300025910 Bacteria 3128
221 Ga0207684_10141231 3300025910 Bacteria 2070
222 Ga0207707_10007786 3300025912 Bacteria 9326
223 Ga0207695_10009523 3300025913 Bacteria 12011
224 Ga0207695_10018499 3300025913 Bacteria 8053
225 Ga0207693_10072881 3300025915 Bacteria 2689
226 Ga0207663_10003419 3300025916 Bacteria 7766
227 Ga0207663_10127849 3300025916 Bacteria 1751
228 Ga0207660_10009390 3300025917 Bacteria 6332
229 Ga0207660_10020459 3300025917 Bacteria 4441
230 Ga0207660_10069481 3300025917 Bacteria 2558
231 Ga0207662_10026368 3300025918 Bacteria 3352
232 Ga0207662_10091333 3300025918 Bacteria 1873
233 Ga0207662_10126359 3300025918 Bacteria 1608
234 Ga0207662_10195291 3300025918 Bacteria 1307
235 Ga0207657_10000213 3300025919 Bacteria 60310
236 Ga0207657_10015476 3300025919 Bacteria 7389
237 Ga0207657_10058340 3300025919 Bacteria 3322
238 Ga0207657_10177378 3300025919 Bacteria 1724
239 Ga0207649_10025487 3300025920 Bacteria 3447
240 Ga0207649_10070306 3300025920 Bacteria 2232
241 Ga0207652_10006590 3300025921 Bacteria 9362
242 Ga0207652_10039490 3300025921 Bacteria 4005
243 Ga0207652_10041610 3300025921 Bacteria 3907
244 Ga0207652_10096003 3300025921 Bacteria 2611
245 Ga0207652_10115192 3300025921 Unclassified 2388
246 Ga0207681_10015114 3300025923 Bacteria 4813
247 Ga0207681_10229423 3300025923 Bacteria 1440
248 Ga0207694_10024491 3300025924 Bacteria 4584
249 Ga0207694_10059169 3300025924 Bacteria 2980
250 Ga0207650_10030156 3300025925 Bacteria 3904
251 Ga0207659_10303805 3300025926 Bacteria 1311
252 Ga0207700_10013374 3300025928 Bacteria 5337
253 Ga0207700_10264924 3300025928 Bacteria 1473
254 Ga0207664_10030851 3300025929 Bacteria 4096
255 Ga0207664_10051388 3300025929 Bacteria 3254
256 Ga0207664_10066992 3300025929 Bacteria 2880
257 Ga0207664_10084441 3300025929 Bacteria 2590
258 Ga0207644_10135404 3300025931 Bacteria 1891
259 Ga0207690_10008048 3300025932 Bacteria 6260
260 Ga0207690_10050009 3300025932 Bacteria 2788
261 Ga0207706_10009628 3300025933 Bacteria 8869
262 Ga0207706_10026463 3300025933 Bacteria 5192
263 Ga0207686_10072241 3300025934 Bacteria 2223
264 Ga0207709_10164511 3300025935 Bacteria 1550
265 Ga0207670_10023433 3300025936 Bacteria 3843
266 Ga0207670_10108058 3300025936 Bacteria 1999
267 Ga0207669_10027702 3300025937 Bacteria 3107
268 Ga0207704_10069375 3300025938 Bacteria 2227
269 Ga0207691_10088334 3300025940 Bacteria 2780
270 Ga0207711_10012235 3300025941 Bacteria 7137
271 Ga0207689_10000151 3300025942 Bacteria 59965
272 Ga0207689_10061712 3300025942 Bacteria 3083
273 Ga0207661_10117452 3300025944 Bacteria 2259
274 Ga0207661_10125311 3300025944 Bacteria 2193
275 Ga0207679_10007601 3300025945 Bacteria 6884
276 Ga0207679_10014124 3300025945 Bacteria 5243
277 Ga0207679_10079320 3300025945 Bacteria 2503
278 Ga0207667_10007731 3300025949 Bacteria 12852
279 Ga0207667_10023539 3300025949 Bacteria 6780
280 Ga0207667_10157811 3300025949 Bacteria 2334
281 Ga0207712_10025372 3300025961 Bacteria 3937
282 Ga0207712_10134992 3300025961 Bacteria 1885
283 Ga0207668_10018538 3300025972 Bacteria 4383
284 Ga0207668_10311279 3300025972 Bacteria 1303
285 Ga0207703_10000300 3300026035 Bacteria 54568
286 Ga0207703_10048191 3300026035 Bacteria 3438
287 Ga0207703_10378494 3300026035 Bacteria 1309
288 Ga0207639_10045997 3300026041 Bacteria 3291
289 Ga0207678_10003426 3300026067 Bacteria 14285
290 Ga0207678_10009871 3300026067 Bacteria 8382
291 Ga0207678_10021702 3300026067 Bacteria 5631
292 Ga0207678_10186960 3300026067 Bacteria 1770
293 Ga0207708_10005456 3300026075 Bacteria 9381
294 Ga0207708_10005844 3300026075 Bacteria 9104
295 Ga0207708_10007962 3300026075 Bacteria 7853
296 Ga0207702_10052580 3300026078 Bacteria 3447
297 Ga0207641_10017758 3300026088 Bacteria 5829
298 Ga0207641_10018900 3300026088 Bacteria 5653
299 Ga0207641_10174243 3300026088 Bacteria 1966
300 Ga0207641_10218059 3300026088 Bacteria 1768
301 Ga0207648_10004613 3300026089 Bacteria 14128
302 Ga0207648_10052305 3300026089 Bacteria 3571
303 Ga0207676_10001288 3300026095 Bacteria 18648
304 Ga0207676_10189192 3300026095 Bacteria 1810
305 Ga0207676_10292850 3300026095 Bacteria 1483
306 Ga0207674_10000045 3300026116 Bacteria 122251
307 Ga0207674_10009358 3300026116 Bacteria 11207
308 Ga0207674_10051123 3300026116 Bacteria 4218
309 Ga0207674_10082438 3300026116 Bacteria 3217
310 Ga0207674_10235200 3300026116 Bacteria 1780
311 Ga0207675_100001119 3300026118 Bacteria 26560
312 Ga0207675_100056667 3300026118 Bacteria 3655
313 Ga0207675_100066051 3300026118 Bacteria 3380
314 Ga0207675_100458862 3300026118 Bacteria 1263
315 Ga0207683_10009436 3300026121 Bacteria 8315
316 Ga0207683_10021746 3300026121 Bacteria 5498
317 Ga0207683_10179745 3300026121 Bacteria 1918
318 Ga0207698_10014647 3300026142 Bacteria 5221
319 Ga0207698_10049585 3300026142 Bacteria 3197
320 Ga0209966_1001307 3300027695 Bacteria 4406
321 Ga0209998_10001451 3300027717 Bacteria 5728
322 Ga0209998_10003218 3300027717 Bacteria 3606
323 Ga0209974_10018298 3300027876 Bacteria 2325
324 Ga0209974_10021058 3300027876 Bacteria 2161
325 Ga0207428_10000255 3300027907 Bacteria 72962
326 Ga0207428_10050828 3300027907 Bacteria 3314
327 Ga0268265_10003089 3300028380 Bacteria 12151
328 Ga0268264_10000451 3300028381 Bacteria 56097
329 Ga0268264_10003127 3300028381 Bacteria 14348
330 Ga0265332_10025356 3300031238 Bacteria 2605
331 Ga0265325_10000708 3300031241 Bacteria 24173
332 Ga0265313_10009620 3300031595 Bacteria 6252
333 Ga0307413_10306885 3300031824 Bacteria 1206
334 Ga0307407_10110147 3300031903 Bacteria 1727
335 Ga0307412_10175021 3300031911 Bacteria 1608
336 Ga0307412_10223124 3300031911 Bacteria 1446
337 Ga0307409_100263115 3300031995 Bacteria 1584
338 Ga0307409_100523351 3300031995 Bacteria 1159
339 Ga0307414_10319916 3300032004 Bacteria 1320
340 Ga0307411_10314804 3300032005 Bacteria 1261
341 Ga0373930_0001628 3300034816 Bacteria 3387
342 Ga0373948_0000403 3300034817 Bacteria 5344
343 Ga0373950_0000200 3300034818 Bacteria 8183
344 Ga0373959_0001588 3300034820 Bacteria 3614
345 Ga0373938_0000844 3300034957 Bacteria 4942
346 Ga0373928_0000443 3300035084 Bacteria 8179
347 Ga0373929_0000756 3300035085 Bacteria 6285
348 Ga0373940_0000018 3300035088 Bacteria 19361
349 Ga0373949_0003205 3300035090 Bacteria 3964
350 Ga0373952_0000228 3300035092 Bacteria 9021
351 Ga0373923_0010688 3300035111 Bacteria 3348
352 Ga0373932_0000155 3300035112 Bacteria 19871
353 Ga0373936_0001591 3300035113 Bacteria 8288
354 Ga0373936_0004284 3300035113 Bacteria 5390
355 Ga0373936_0009238 3300035113 Bacteria 3716
356 Ga0373941_0001756 3300035115 Bacteria 4656
357 Ga0373945_0004589 3300035116 Bacteria 4392
358 Ga0373953_0022944 3300035117 Bacteria 2359
359 Ga0373954_0020778 3300035118 Bacteria 2971
360 Ga0373954_0044028 3300035118 Bacteria 2082
361 Ga0373960_0000061 3300035121 Bacteria 14957
362 Ga0373943_0001108 3300035170 Bacteria 12022
363 Ga0373946_0001186 3300035171 Bacteria 9031
364 Ga0373946_0008129 3300035171 Bacteria 3851
365 Ga0373955_0008613 3300035172 Bacteria 4744
366 Ga0373942_0002062 3300035207 Bacteria 4998
367 Ga0373961_0000451 3300035241 Bacteria 16466
368 Ga0373961_0006208 3300035241 Bacteria 2872
369 Ga0373962_0000409 3300035242 Bacteria 9394
370 Ga0373924_0014055 3300035410 Bacteria 3019
371 Ga0373931_0020850 3300035691 Bacteria 3282
372 Ga0373935_0003508 3300035692 Bacteria 9123
373 Ga0373935_0028092 3300035692 Bacteria 3476
374 Ga0373935_0033212 3300035692 Bacteria 3210
375 Ga0373927_0002017 3300035695 Bacteria 14958
376 Ga0373927_0004258 3300035695 Bacteria 10045
377 Ga0373933_0022312 3300035724 Bacteria 3603
378 Ga0373933_0096356 3300035724 Bacteria 1831
379 Ga0373933_0160317 3300035724 Bacteria 1428
380 Ga0373947_0002042 3300035725 Bacteria 12318
381 Ga0373947_0016168 3300035725 Bacteria 4288
382 Ga0373937_0009662 3300036401 Bacteria 8401
383 Ga0373937_0051194 3300036401 Bacteria 3785
384 Ga0373937_0215916 3300036401 Bacteria 1805
385 Ga0373937_0455248 3300036401 Bacteria 1215
386 Ga0373925_0004980 3300037068 Bacteria 9973
387 Ga0395905_0049971 3300037471 Bacteria 3919
388 Ga0436364_0663275 3300037853 Bacteria 97909
389 Ga0436365_1342486 3300039437 Bacteria 2466
390 Ga0436361_0886998 3300039447 Bacteria 5611
391 Ga0436363_1654980 3300039450 Bacteria 10573
392 Ga0451833_0091326 3300041491 Bacteria 985
393 Ga0451843_0100024 3300041509 Bacteria 1723
394 Ga0439448_0025513 3300042005 Bacteria 1854
395 Ga0439450_005017 3300042008 Bacteria 2300
396 Ga0439463_028313 3300042016 Bacteria 1411
397 Ga0439464_0014054 3300042439 Bacteria 2149
398 Ga0451576_0058905 3300045051 Bacteria 4011
399 Ga0495592_0001157 3300046454 Bacteria 18304
400 Ga0495592_0006155 3300046454 Bacteria 8922
401 Ga0495603_0065858 3300046455 Bacteria 2135
402 Ga0495629_0005121 3300046459 Bacteria 9800
403 Ga0495641_0003638 3300046461 Bacteria 11412
404 Ga0495641_0089976 3300046461 Bacteria 1371
405 Ga0495651_0002175 3300046462 Bacteria 15159
406 Ga0495653_0002883 3300046463 Bacteria 13751
407 Ga0495653_0045259 3300046463 Bacteria 3412
408 Ga0495580_0012164 3300046472 Bacteria 6616
409 Ga0495580_0025286 3300046472 Bacteria 4340
410 Ga0495582_0002391 3300046473 Bacteria 10488
411 Ga0495639_0000713 3300046475 Bacteria 15217
412 Ga0495639_0064779 3300046475 Bacteria 1680
413 Ga0495662_0000084 3300046476 Bacteria 33781
414 Ga0495662_0053207 3300046476 Bacteria 1955
415 Ga0495662_0058494 3300046476 Bacteria 1862
416 Ga0495664_0000482 3300046477 Bacteria 19803
417 Ga0495664_0059591 3300046477 Bacteria 2272
418 Ga0495585_0032653 3300046492 Bacteria 2948
419 Ga0495594_0008249 3300046499 Bacteria 5361
420 Ga0495608_0005556 3300046511 Bacteria 9006
421 Ga0495618_0004433 3300046514 Bacteria 8635
422 Ga0495628_0007423 3300046516 Bacteria 9490
423 Ga0495628_0018284 3300046516 Bacteria 5810
424 Ga0495628_0020031 3300046516 Bacteria 5523
425 Ga0495630_0001951 3300046517 Bacteria 14336
426 Ga0495630_0006736 3300046517 Bacteria 8188
427 Ga0495630_0129648 3300046517 Bacteria 1915
428 Ga0495632_0056324 3300046519 Bacteria 1922
429 Ga0495666_0004463 3300046526 Bacteria 7069
430 Ga0495666_0014684 3300046526 Bacteria 3898
431 Ga0495652_0007683 3300046529 Bacteria 9928
432 Ga0495665_0002359 3300046531 Bacteria 10190
433 Ga0495665_0024936 3300046531 Bacteria 3213
434 Ga0495665_0055338 3300046531 Bacteria 2095
435 Ga0495640_0002890 3300046533 Bacteria 13841
436 Ga0495640_0007345 3300046533 Bacteria 8671
437 Ga0495640_0043685 3300046533 Bacteria 3119
438 Ga0495586_0001095 3300046535 Bacteria 15316
439 Ga0495586_0044159 3300046535 Bacteria 2400
440 Ga0495587_0010083 3300046536 Bacteria 6029
441 Ga0495645_0046268 3300046543 Bacteria 3171
442 Ga0495622_0069760 3300046557 Bacteria 1623
443 Ga0495633_0035702 3300046558 Bacteria 2386
444 Ga0495667_0000202 3300046559 Bacteria 40046
445 Ga0495667_0035082 3300046559 Bacteria 3354
446 Ga0495667_0086742 3300046559 Bacteria 2029
447 Ga0495656_0105891 3300046615 Bacteria 1308
448 Ga0495634_0005317 3300046642 Bacteria 9928
449 Ga0495634_0014760 3300046642 Bacteria 5620
450 Ga0495625_0035683 3300046660 Bacteria 3663
451 Ga0495625_0037749 3300046660 Bacteria 3540
452 Ga0495635_0000399 3300046663 Bacteria 27531
453 Ga0495588_0062754 3300046674 Bacteria 1926
454 Ga0495657_0001733 3300046675 Bacteria 18667
455 Ga0495599_0004717 3300046678 Bacteria 8096
456 Ga0495599_0077697 3300046678 Bacteria 2072
457 Ga0495646_0003722 3300046680 Bacteria 9525
458 Ga0495647_0004315 3300046681 Bacteria 4608
459 Ga0495647_0013214 3300046681 Bacteria 2857
460 Ga0495658_0001713 3300046683 Bacteria 11388
461 Ga0495658_0007999 3300046683 Bacteria 5239
462 Ga0495658_0008581 3300046683 Bacteria 5069
463 Ga0495613_0001462 3300046689 Bacteria 17997
464 Ga0495613_0008236 3300046689 Bacteria 7739
465 Ga0495613_0009305 3300046689 Bacteria 7290
466 Ga0495624_0000222 3300046690 Bacteria 44293
467 Ga0495624_0041636 3300046690 Bacteria 2937
468 Ga0495624_0072273 3300046690 Bacteria 2146
469 Ga0495670_0000837 3300046691 Bacteria 14887
470 Ga0495600_0002124 3300046809 Bacteria 11221
471 Ga0495600_0003235 3300046809 Bacteria 9529
472 Ga0495581_0000145 3300047315 Bacteria 31255
473 Ga0495604_0005816 3300047317 Bacteria 9782
474 Ga0495604_0086560 3300047317 Bacteria 2335
475 Ga0495636_0038403 3300047318 Unclassified 1981
476 Ga0495674_0007404 3300047319 Bacteria 10489
477 Ga0495674_0015727 3300047319 Bacteria 7063
478 Ga0495676_0020974 3300047321 Bacteria 5718
479 Ga0495676_0059995 3300047321 Bacteria 2984
480 Ga0495680_0001864 3300047322 Bacteria 22174
481 Ga0495680_0002897 3300047322 Bacteria 17243
482 Ga0495684_0000075 3300047471 Bacteria 67922
483 Ga0495593_0000228 3300047673 Bacteria 30037
484 Ga0496101_0118117 3300048904 Bacteria 2003
485 Ga0496102_0004792 3300048905 Bacteria 11439
486 Ga0496102_0110070 3300048905 Bacteria 2567
487 Ga0496102_0117308 3300048905 Bacteria 2484
488 Ga0496103_0010350 3300048906 Bacteria 5519
489 Ga0496103_0092071 3300048906 Bacteria 1914
490 Ga0496104_0000061 3300048907 Bacteria 117394
491 Ga0496104_0065899 3300048907 Bacteria 3438
492 Ga0496106_0000300 3300048909 Bacteria 34880
493 Ga0496106_0046270 3300048909 Bacteria 3270
494 Ga0496107_0002193 3300048910 Bacteria 12549
495 Ga0496107_0018653 3300048910 Bacteria 4888
496 Ga0496107_0249197 3300048910 Bacteria 1321
497 Ga0496108_0004930 3300048911 Bacteria 10782
498 Ga0496109_0001819 3300048912 Bacteria 17742
499 Ga0496109_0257661 3300048912 Bacteria 1643
500 Ga0496110_0037046 3300048913 Bacteria 4238
501 Ga0496112_0004718 3300048915 Bacteria 11614
502 Ga0496113_0036894 3300048916 Bacteria 3583
503 Ga0496115_0051521 3300048918 Bacteria 3301
504 Ga0501032_0008708 3300049569 Bacteria 7389
505 Ga0501033_0020592 3300049570 Bacteria 4984
506 Ga0501034_0000439 3300049571 Bacteria 68932
507 Ga0501034_0019423 3300049571 Bacteria 6951
508 Ga0501036_0000689 3300049572 Bacteria 24929
509 Ga0501036_0013749 3300049572 Bacteria 6730
510 Ga0501037_0007499 3300049573 Bacteria 7985
511 Ga0501037_0126837 3300049573 Bacteria 1831
512 Ga0501038_0004102 3300049574 Bacteria 13549
513 Ga0501038_0236569 3300049574 Bacteria 1451
514 Ga0501039_0059755 3300049575 Bacteria 2952
515 Ga0501043_0002343 3300049579 Bacteria 16061
516 Ga0501043_0032695 3300049579 Bacteria 4090
517 Ga0501046_0115613 3300049580 Bacteria 2045
518 Ga0501047_0000204 3300049581 Bacteria 71976
519 Ga0501047_0006456 3300049581 Bacteria 11031
520 Ga0501047_0011147 3300049581 Bacteria 8507
521 Ga0501047_0268488 3300049581 Bacteria 1552
522 Ga0501048_0000065 3300049582 Bacteria 53623
523 Ga0501048_0083602 3300049582 Bacteria 2251
524 Ga0501048_0115983 3300049582 Bacteria 1892
525 Ga0501067_0082272 3300049583 Bacteria 1785
526 Ga0501068_0005601 3300049584 Bacteria 6878
527 Ga0501068_0014257 3300049584 Bacteria 4541
528 Ga0501069_0088964 3300049585 Bacteria 1745
529 Ga0501070_0002291 3300049586 Bacteria 16823
530 Ga0501070_0012101 3300049586 Bacteria 7282
531 Ga0501070_0031140 3300049586 Bacteria 4468
532 Ga0501072_0115487 3300049588 Bacteria 2137
533 Ga0501073_0054599 3300049589 Bacteria 2796
534 Ga0501074_0008526 3300049590 Bacteria 7427
535 Ga0501074_0036552 3300049590 Bacteria 3557
536 Ga0501076_0218921 3300049592 Bacteria 1556
537 Ga0501080_0000815 3300049742 Bacteria 25419
538 Ga0501080_0062194 3300049742 Bacteria 3474
539 Ga0501080_0186629 3300049742 Bacteria 1906
540 Ga0501080_0485200 3300049742 Bacteria 1105
541 Ga0501083_0001712 3300049744 Bacteria 14955
542 Ga0501083_0031399 3300049744 Bacteria 3646
543 Ga0501035_0025991 3300049822 Bacteria 5363
544 Ga0501035_0091494 3300049822 Bacteria 2677
545 Ga0501044_0001827 3300049823 Bacteria 24776
546 Ga0501044_0016948 3300049823 Bacteria 7816
547 Ga0501045_0125873 3300049824 Bacteria 1904
548 nmdc:mga03683_33286_c1 3300050489 Bacteria 2078
549 nmdc:mga0yw44_56388_c1 3300050492 Bacteria 2393
550 nmdc:mga0k408_267671_c1 3300050493 Bacteria 1020
551 nmdc:mga0k408_39815_c1 3300050493 Bacteria 2703
552 nmdc:mga0k408_78503_c1 3300050493 Bacteria 1443
553 nmdc:mga06z11_30677_c1 3300050494 Bacteria 2604
554 nmdc:mga05p37_208054_c1 3300050507 Bacteria 2366
555 nmdc:mga08y16_28547_c1 3300050511 Bacteria 5882
556 nmdc:mga08y16_8011_c1 3300050511 Bacteria 11053
557 nmdc:mga0n895_157457_c1 3300050512 Bacteria 2302
558 nmdc:mga0rr50_125787_c1 3300050513 Bacteria 2047
559 nmdc:mga0a205_18403_c1 3300050515 Bacteria 6568
560 Ga0495601_0010704 3300053077 Bacteria 5470
561 Ga0495601_0014582 3300053077 Bacteria 4737
562 Ga0495612_0001242 3300053078 Bacteria 10512
563 Ga0495612_0063252 3300053078 Bacteria 1535
564 Ga0495595_0000988 3300053084 Bacteria 10960
565 Ga0495595_0013080 3300053084 Bacteria 3501
566 Ga0495619_0001117 3300053085 Bacteria 17612
567 Ga0495619_0043241 3300053085 Bacteria 2952
568 Ga0500643_000795 3300053087 Bacteria 20468
569 Ga0500651_0014672 3300053093 Bacteria 4797
570 Ga0500566_0127711 3300053094 Bacteria 1364
571 Ga0500595_000001 3300053119 Bacteria 1088438
572 Ga0500604_0043800 3300053151 Bacteria 1361
573 Ga0500637_0030651 3300053178 Bacteria 2995
574 Ga0500645_000015 3300053730 Bacteria 150140
575 Ga0501084_0215386 3300054114 Bacteria 1620
576 Ga0501082_0145737 3300060353 Bacteria 2055
577 Ga0501082_0271351 3300060353 Bacteria 1476
578 2643758912 2643221547 Bacteria 4740017
579 Ga0070703_10000746
580 2214800760
581 ARSoilYngRDRAFT_c00057
582 ARcpr5yngRDRAFT_c000673
583 ARSoilOldRDRAFT_c000044
584 ARCol0yngRDRAFT_1000153
585 JGI25406J46586_10000826
586 JGI25405J52794_10001935
587 Ga0065717_1002193
588 Ga0065716_1001695
589 Ga0065704_10084341
590 Ga0065712_10071542
591 Ga0065715_10001318
592 Ga0065715_10144991
593 Ga0070658_10035834
594 Ga0070658_10123637
595 Ga0070676_10113303
596 Ga0070683_100078518
597 Ga0070683_100115860
598 Ga0070690_100022947
599 Ga0070670_100070304
600 Ga0070670_100309827
601 Ga0070677_10020348
602 Ga0070677_10098690
603 Ga0068869_100000039
604 Ga0068869_100144735
605 Ga0070680_100000933
606 Ga0070680_100003206
607 Ga0070680_100169296
608 Ga0070682_100035457
609 Ga0070660_100014143
610 Ga0070660_100027333
611 Ga0070660_100267836
612 Ga0070689_100017381
613 Ga0070689_100150147
614 Ga0070691_10009000
615 Ga0070691_10025475
616 Ga0070687_100049318
617 Ga0070687_100166548
618 Ga0070687_100194776
619 Ga0070661_100055552
620 Ga0070661_100128324
621 Ga0070692_10030076
622 Ga0070668_100017292
623 Ga0070668_100042788
624 Ga0070668_100136857
625 Ga0070668_100150793
626 Ga0070669_100059437
627 Ga0070675_100296524
628 Ga0070673_100481900
629 Ga0070688_100001879
630 Ga0070659_100009187
631 Ga0070659_100023236
632 Ga0070667_100000488
633 Ga0070667_100102127
634 Ga0070709_10017300
635 Ga0070709_10188712
636 Ga0070709_10258273
637 Ga0070714_100018028
638 Ga0070714_100076575
639 Ga0070714_100110567
640 Ga0070713_100075891
641 Ga0070711_100058899
642 Ga0070705_100000029
643 Ga0070705_100038253
644 Ga0070705_100113402
645 Ga0070700_100001497
646 Ga0070700_100015163
647 Ga0070694_100000652
648 Ga0070708_100002320
649 Ga0070663_100008847
650 Ga0070663_100023132
651 Ga0070678_100006921
652 Ga0070678_100092721
653 Ga0070662_100003081
654 Ga0070662_100013722
655 Ga0070681_10038482
656 Ga0070681_10115718
657 Ga0070681_10157011
658 Ga0070681_10192388
659 Ga0070681_10219770
660 Ga0068867_100002184
661 Ga0068867_100017486
662 Ga0068867_100117012
663 Ga0070706_100021874
664 Ga0070707_100135285
665 Ga0070698_100002091
666 Ga0070698_100177985
667 Ga0070698_100182302
668 Ga0074259_11019792
669 Ga0070699_100000947
670 Ga0070699_100013134
671 Ga0070699_100207974
672 Ga0070679_100009132
673 Ga0070679_100022933
674 Ga0070679_100057578
675 Ga0070679_100122680
676 Ga0070684_100010266
677 Ga0070697_100187495
678 Ga0068853_100015534
679 Ga0068853_100083026
680 Ga0070672_100101954
681 Ga0070686_100053084
682 Ga0070695_100006175
683 Ga0070696_100001966
684 Ga0070696_100004759
685 Ga0070696_100016707
686 Ga0070696_100081234
687 Ga0070693_100097099
688 Ga0070704_100000624
689 Ga0070704_100005471
690 Ga0068855_100219987
691 Ga0068855_100295627
692 Ga0070664_100015069
693 Ga0070664_100023513
694 Ga0070664_100041115
695 Ga0068857_100025254
696 Ga0068854_100241517
697 Ga0068856_100033873
698 Ga0068856_100309998
699 Ga0068856_100587956
700 Ga0070702_100046999
701 Ga0068852_100414326
702 Ga0068859_100000189
703 Ga0068859_100032215
704 Ga0068859_100134543
705 Ga0068864_100000192
706 Ga0068861_100011083
707 Ga0068861_100107550
708 Ga0068851_10002769
709 Ga0068863_100012588
710 Ga0068863_100181101
711 Ga0068863_100204759
712 Ga0068863_100328025
713 Ga0068858_100022002
714 Ga0068858_100114748
715 Ga0068860_100000350
716 Ga0068860_100009593
717 Ga0068862_100000691
718 Ga0068862_100048145
719 Ga0068862_100057387
720 Ga0068862_100066585
721 Ga0081455_10000012
722 Ga0081455_10034958
723 Ga0081455_10097858
724 Ga0081455_10135784
725 Ga0081540_1001830
726 Ga0081539_10002294
727 Ga0070717_10275687
728 Ga0075364_10028110
729 Ga0070716_100079022
730 Ga0075366_10083127
731 Ga0097621_100001440
732 Ga0075370_10013741
733 Ga0068871_100002792
734 Ga0068871_100310511
735 Ga0075434_100152364
736 Ga0068865_100148051
737 Ga0075436_100057054
738 Ga0075436_100125947
739 Ga0097620_100000189
740 Ga0097620_100032216
741 Ga0097620_100134544
742 Ga0075435_100002930
743 Ga0105251_10065994
744 Ga0105240_10004752
745 Ga0105240_10025445
746 Ga0105240_10079097
747 Ga0111539_10000114
748 Ga0111539_10011997
749 Ga0111539_10416843
750 Ga0105247_10017646
751 Ga0114129_10733661
752 Ga0105243_10026263
753 Ga0105242_10455801
754 Ga0105248_10013370
755 Ga0105248_10131270
756 Ga0105238_10021202
757 Ga0105249_10001774
758 Ga0105249_10170477
759 Ga0105239_10053091
760 Ga0105239_10180994
761 Ga0157320_1000654
762 Ga0157342_1000297
763 Ga0157338_1000224
764 Ga0157371_10008859
765 Ga0157370_10010239
766 Ga0157369_10051616
767 Ga0157369_10117912
768 Ga0157378_10242284
769 Ga0157372_10043914
770 Ga0157372_10086413
771 Ga0157372_10222015
772 Ga0157372_10266014
773 Ga0157375_10022576
774 Ga0163163_10005846
775 Ga0157380_10061308
776 Ga0157377_10085370
777 Ga0157379_10000028
778 Ga0157379_10011943
779 Ga0157376_10020495
780 Ga0163161_10003601
781 Ga0213872_10069800
782 Ga0213875_10048223
783 Ga0207666_1000497
784 Ga0209758_1001507
785 Ga0207697_10021107
786 Ga0207692_10013091
787 Ga0207688_10046379
788 Ga0207688_10078506
789 Ga0207647_10008867
790 Ga0207699_10015906
791 Ga0207699_10025985
792 Ga0207699_10054214
793 Ga0207645_10058475
794 Ga0207645_10087504
795 Ga0207705_10019721
796 Ga0207705_10110771
797 Ga0207684_10025016
798 Ga0207684_10063778
799 Ga0207684_10141231
800 Ga0207707_10007786
801 Ga0207695_10009523
802 Ga0207695_10018499
803 Ga0207693_10072881
804 Ga0207663_10003419
805 Ga0207663_10127849
806 Ga0207660_10009390
807 Ga0207660_10020459
808 Ga0207660_10069481
809 Ga0207662_10026368
810 Ga0207662_10091333
811 Ga0207662_10126359
812 Ga0207662_10195291
813 Ga0207657_10000213
814 Ga0207657_10015476
815 Ga0207657_10058340
816 Ga0207657_10177378
817 Ga0207649_10025487
818 Ga0207649_10070306
819 Ga0207652_10006590
820 Ga0207652_10039490
821 Ga0207652_10041610
822 Ga0207652_10096003
823 Ga0207652_10115192
824 Ga0207681_10015114
825 Ga0207681_10229423
826 Ga0207694_10024491
827 Ga0207694_10059169
828 Ga0207650_10030156
829 Ga0207659_10303805
830 Ga0207700_10013374
831 Ga0207700_10264924
832 Ga0207664_10030851
833 Ga0207664_10051388
834 Ga0207664_10066992
835 Ga0207664_10084441
836 Ga0207644_10135404
837 Ga0207690_10008048
838 Ga0207690_10050009
839 Ga0207706_10009628
840 Ga0207706_10026463
841 Ga0207686_10072241
842 Ga0207709_10164511
843 Ga0207670_10023433
844 Ga0207670_10108058
845 Ga0207669_10027702
846 Ga0207704_10069375
847 Ga0207691_10088334
848 Ga0207711_10012235
849 Ga0207689_10000151
850 Ga0207689_10061712
851 Ga0207661_10117452
852 Ga0207661_10125311
853 Ga0207679_10007601
854 Ga0207679_10014124
855 Ga0207679_10079320
856 Ga0207667_10007731
857 Ga0207667_10023539
858 Ga0207667_10157811
859 Ga0207712_10025372
860 Ga0207712_10134992
861 Ga0207668_10018538
862 Ga0207668_10311279
863 Ga0207703_10000300
864 Ga0207703_10048191
865 Ga0207703_10378494
866 Ga0207639_10045997
867 Ga0207678_10003426
868 Ga0207678_10009871
869 Ga0207678_10021702
870 Ga0207678_10186960
871 Ga0207708_10005456
872 Ga0207708_10005844
873 Ga0207708_10007962
874 Ga0207702_10052580
875 Ga0207641_10017758
876 Ga0207641_10018900
877 Ga0207641_10174243
878 Ga0207641_10218059
879 Ga0207648_10004613
880 Ga0207648_10052305
881 Ga0207676_10001288
882 Ga0207676_10189192
883 Ga0207676_10292850
884 Ga0207674_10000045
885 Ga0207674_10009358
886 Ga0207674_10051123
887 Ga0207674_10082438
888 Ga0207674_10235200
889 Ga0207675_100001119
890 Ga0207675_100056667
891 Ga0207675_100066051
892 Ga0207675_100458862
893 Ga0207683_10009436
894 Ga0207683_10021746
895 Ga0207683_10179745
896 Ga0207698_10014647
897 Ga0207698_10049585
898 Ga0209966_1001307
899 Ga0209998_10001451
900 Ga0209998_10003218
901 Ga0209974_10018298
902 Ga0209974_10021058
903 Ga0207428_10000255
904 Ga0207428_10050828
905 Ga0268265_10003089
906 Ga0268264_10000451
907 Ga0268264_10003127
908 Ga0265332_10025356
909 Ga0265325_10000708
910 Ga0265313_10009620
911 Ga0307413_10306885
912 Ga0307407_10110147
913 Ga0307412_10175021
914 Ga0307412_10223124
915 Ga0307409_100263115
916 Ga0307409_100523351
917 Ga0307414_10319916
918 Ga0307411_10314804
919 Ga0373930_0001628
920 Ga0373948_0000403
921 Ga0373950_0000200
922 Ga0373959_0001588
923 Ga0373938_0000844
924 Ga0373928_0000443
925 Ga0373929_0000756
926 Ga0373940_0000018
927 Ga0373949_0003205
928 Ga0373952_0000228
929 Ga0373923_0010688
930 Ga0373932_0000155
931 Ga0373936_0001591
932 Ga0373936_0004284
933 Ga0373936_0009238
934 Ga0373941_0001756
935 Ga0373945_0004589
936 Ga0373953_0022944
937 Ga0373954_0020778
938 Ga0373954_0044028
939 Ga0373960_0000061
940 Ga0373943_0001108
941 Ga0373946_0001186
942 Ga0373946_0008129
943 Ga0373955_0008613
944 Ga0373942_0002062
945 Ga0373961_0000451
946 Ga0373961_0006208
947 Ga0373962_0000409
948 Ga0373924_0014055
949 Ga0373931_0020850
950 Ga0373935_0003508
951 Ga0373935_0028092
952 Ga0373935_0033212
953 Ga0373927_0002017
954 Ga0373927_0004258
955 Ga0373933_0022312
956 Ga0373933_0096356
957 Ga0373933_0160317
958 Ga0373947_0002042
959 Ga0373947_0016168
960 Ga0373937_0009662
961 Ga0373937_0051194
962 Ga0373937_0215916
963 Ga0373937_0455248
964 Ga0373925_0004980
965 Ga0395905_0049971
966 Ga0436364_0663275
967 Ga0436365_1342486
968 Ga0436361_0886998
969 Ga0436363_1654980
970 Ga0451833_0091326
971 Ga0451843_0100024
972 Ga0439448_0025513
973 Ga0439450_005017
974 Ga0439463_028313
975 Ga0439464_0014054
976 Ga0451576_0058905
977 Ga0495592_0001157
978 Ga0495592_0006155
979 Ga0495603_0065858
980 Ga0495629_0005121
981 Ga0495641_0003638
982 Ga0495641_0089976
983 Ga0495651_0002175
984 Ga0495653_0002883
985 Ga0495653_0045259
986 Ga0495580_0012164
987 Ga0495580_0025286
988 Ga0495582_0002391
989 Ga0495639_0000713
990 Ga0495639_0064779
991 Ga0495662_0000084
992 Ga0495662_0053207
993 Ga0495662_0058494
994 Ga0495664_0000482
995 Ga0495664_0059591
996 Ga0495585_0032653
997 Ga0495594_0008249
998 Ga0495608_0005556
999 Ga0495618_0004433
1000 Ga0495628_0007423
1001 Ga0495628_0018284
1002 Ga0495628_0020031
1003 Ga0495630_0001951
1004 Ga0495630_0006736
1005 Ga0495630_0129648
1006 Ga0495632_0056324
1007 Ga0495666_0004463
1008 Ga0495666_0014684
1009 Ga0495652_0007683
1010 Ga0495665_0002359
1011 Ga0495665_0024936
1012 Ga0495665_0055338
1013 Ga0495640_0002890
1014 Ga0495640_0007345
1015 Ga0495640_0043685
1016 Ga0495586_0001095
1017 Ga0495586_0044159
1018 Ga0495587_0010083
1019 Ga0495645_0046268
1020 Ga0495622_0069760
1021 Ga0495633_0035702
1022 Ga0495667_0000202
1023 Ga0495667_0035082
1024 Ga0495667_0086742
1025 Ga0495656_0105891
1026 Ga0495634_0005317
1027 Ga0495634_0014760
1028 Ga0495625_0035683
1029 Ga0495625_0037749
1030 Ga0495635_0000399
1031 Ga0495588_0062754
1032 Ga0495657_0001733
1033 Ga0495599_0004717
1034 Ga0495599_0077697
1035 Ga0495646_0003722
1036 Ga0495647_0004315
1037 Ga0495647_0013214
1038 Ga0495658_0001713
1039 Ga0495658_0007999
1040 Ga0495658_0008581
1041 Ga0495613_0001462
1042 Ga0495613_0008236
1043 Ga0495613_0009305
1044 Ga0495624_0000222
1045 Ga0495624_0041636
1046 Ga0495624_0072273
1047 Ga0495670_0000837
1048 Ga0495600_0002124
1049 Ga0495600_0003235
1050 Ga0495581_0000145
1051 Ga0495604_0005816
1052 Ga0495604_0086560
1053 Ga0495636_0038403
1054 Ga0495674_0007404
1055 Ga0495674_0015727
1056 Ga0495676_0020974
1057 Ga0495676_0059995
1058 Ga0495680_0001864
1059 Ga0495680_0002897
1060 Ga0495684_0000075
1061 Ga0495593_0000228
1062 Ga0496101_0118117
1063 Ga0496102_0004792
1064 Ga0496102_0110070
1065 Ga0496102_0117308
1066 Ga0496103_0010350
1067 Ga0496103_0092071
1068 Ga0496104_0000061
1069 Ga0496104_0065899
1070 Ga0496106_0000300
1071 Ga0496106_0046270
1072 Ga0496107_0002193
1073 Ga0496107_0018653
1074 Ga0496107_0249197
1075 Ga0496108_0004930
1076 Ga0496109_0001819
1077 Ga0496109_0257661
1078 Ga0496110_0037046
1079 Ga0496112_0004718
1080 Ga0496113_0036894
1081 Ga0496115_0051521
1082 Ga0501032_0008708
1083 Ga0501033_0020592
1084 Ga0501034_0000439
1085 Ga0501034_0019423
1086 Ga0501036_0000689
1087 Ga0501036_0013749
1088 Ga0501037_0007499
1089 Ga0501037_0126837
1090 Ga0501038_0004102
1091 Ga0501038_0236569
1092 Ga0501039_0059755
1093 Ga0501043_0002343
1094 Ga0501043_0032695
1095 Ga0501046_0115613
1096 Ga0501047_0000204
1097 Ga0501047_0006456
1098 Ga0501047_0011147
1099 Ga0501047_0268488
1100 Ga0501048_0000065
1101 Ga0501048_0083602
1102 Ga0501048_0115983
1103 Ga0501067_0082272
1104 Ga0501068_0005601
1105 Ga0501068_0014257
1106 Ga0501069_0088964
1107 Ga0501070_0002291
1108 Ga0501070_0012101
1109 Ga0501070_0031140
1110 Ga0501072_0115487
1111 Ga0501073_0054599
1112 Ga0501074_0008526
1113 Ga0501074_0036552
1114 Ga0501076_0218921
1115 Ga0501080_0000815
1116 Ga0501080_0062194
1117 Ga0501080_0186629
1118 Ga0501080_0485200
1119 Ga0501083_0001712
1120 Ga0501083_0031399
1121 Ga0501035_0025991
1122 Ga0501035_0091494
1123 Ga0501044_0001827
1124 Ga0501044_0016948
1125 Ga0501045_0125873
1126 nmdc:mga03683_33286_c1
1127 nmdc:mga0yw44_56388_c1
1128 nmdc:mga0k408_267671_c1
1129 nmdc:mga0k408_39815_c1
1130 nmdc:mga0k408_78503_c1
1131 nmdc:mga06z11_30677_c1
1132 nmdc:mga05p37_208054_c1
1133 nmdc:mga08y16_28547_c1
1134 nmdc:mga08y16_8011_c1
1135 nmdc:mga0n895_157457_c1
1136 nmdc:mga0rr50_125787_c1
1137 nmdc:mga0a205_18403_c1
1138 Ga0495601_0010704
1139 Ga0495601_0014582
1140 Ga0495612_0001242
1141 Ga0495612_0063252
1142 Ga0495595_0000988
1143 Ga0495595_0013080
1144 Ga0495619_0001117
1145 Ga0495619_0043241
1146 Ga0500643_000795
1147 Ga0500651_0014672
1148 Ga0500566_0127711
1149 Ga0500595_000001
1150 Ga0500604_0043800
1151 Ga0500637_0030651
1152 Ga0500645_000015
1153 Ga0501084_0215386
1154 Ga0501082_0145737
1155 Ga0501082_0271351
1156 2643758912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

73

357

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pfr-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered 0.9115 88 334
4pfr-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered 0.9077 88 334
4pfi-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from marinobacter aquaeolei vt8 (maqu_2829, target efi-510133), apo open structure 0.9064 30 330
4p47-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket 0.9014 27 333
4ng7-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899), target efi-510094, apo, open structure 0.9003 33 331
ID Description Score Start End Superfamily
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9013 27 333 3.40.190.170
4ng7A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9003 33 331 3.40.190.170
4pfiA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8999 30 330 3.40.190.170
4pfiA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8914 30 330 3.40.190.170
4pfrA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8913 31 334 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A416Z4W9-F1-model_v4 deleted 0.9458 29 334
AF-A0A373PRQ1-F1-model_v4 deleted 0.9201 110 331
AF-A0A841PW79-F1-model_v4 Tripartite ATP-independent transporter DctP family solute receptor 0.9108 28 331 GO:0030288
GO:0055085
AF-A0A6P5P1F9-F1-model_v4 deleted 0.91 72 331
AF-A0A101W8W5-F1-model_v4 C4-dicarboxylate ABC transporter 0.909 27 333 GO:0030288
GO:0055085

Map