F465664

General Info

Members Datasets Scaffolds Average Seq Length
577 333 1154 161

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0332879|Ga0496121_0332879_23_535
Length 170
Sequence VSEVRNIRFTLNGRPVRAQVEAGESVVTMLSQRFELTGTRESCGQGLCGCCTVSVDGKVVSGCLHMAWFLDGTQVQTIEGLSDLGKPLDPVQDAFIEAGAFQCGFCTPGFIMMTKSLLKENPNPDDEEIRHYLAGNLCRCSAYPEIVRAIKLAASRAASANEKTLQASHD

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
301 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
322 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
327 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
332 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
333 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.45
Nodule 0.17
Rhizoplane 12.82
Rhizosphere 77.3
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0332879 3300048924 Bacteria 1018
2 JGI24735J21928_10017376 3300002067 Bacteria 2225
3 JGI24745J21846_1042476 3300002073 Bacteria 565
4 JGI24738J21930_10020907 3300002075 Bacteria 1359
5 JGI24744J21845_10019802 3300002077 Bacteria 1330
6 JGI24751J29686_10039331 3300002459 Bacteria 979
7 JGI25404J52841_10002029 3300003659 Bacteria 3743
8 JGI25405J52794_10003580 3300003911 Bacteria 2734
9 Ga0065707_10504854 3300005295 Unclassified 754
10 Ga0070676_10043756 3300005328 Bacteria 2603
11 Ga0070690_100061644 3300005330 Bacteria 2417
12 Ga0070690_100078608 3300005330 Bacteria 2155
13 Ga0070670_100078153 3300005331 Bacteria 2843
14 Ga0070670_100244713 3300005331 Bacteria 1562
15 Ga0070670_101591671 3300005331 Unclassified 600
16 Ga0070666_10209764 3300005335 Bacteria 1371
17 Ga0070682_101075649 3300005337 Bacteria 672
18 Ga0068868_100156071 3300005338 Bacteria 1882
19 Ga0068868_101514545 3300005338 Bacteria 628
20 Ga0070660_100140000 3300005339 Bacteria 1941
21 Ga0070691_10034176 3300005341 Bacteria 2392
22 Ga0070687_100014219 3300005343 Bacteria 3570
23 Ga0070661_100131416 3300005344 Bacteria 1881
24 Ga0070661_100324424 3300005344 Bacteria 1203
25 Ga0070668_100210483 3300005347 Bacteria 1599
26 Ga0070669_100040898 3300005353 Bacteria 3370
27 Ga0070675_100052908 3300005354 Bacteria 3339
28 Ga0070675_101239731 3300005354 Bacteria 687
29 Ga0070671_100213050 3300005355 Bacteria 1638
30 Ga0070671_101315898 3300005355 Unclassified 637
31 Ga0070674_100558770 3300005356 Bacteria 961
32 Ga0070673_100227298 3300005364 Bacteria 1617
33 Ga0070673_101250252 3300005364 Unclassified 696
34 Ga0070688_100094156 3300005365 Bacteria 1963
35 Ga0070667_100445703 3300005367 Bacteria 1182
36 Ga0070667_100993167 3300005367 Bacteria 783
37 Ga0070667_101529590 3300005367 Bacteria 627
38 Ga0070709_10070204 3300005434 Bacteria 2257
39 Ga0070709_10157329 3300005434 Bacteria 1577
40 Ga0070709_10249539 3300005434 Bacteria 1278
41 Ga0070713_101494117 3300005436 Bacteria 656
42 Ga0070710_10183026 3300005437 Unclassified 1313
43 Ga0070711_100365080 3300005439 Bacteria 1164
44 Ga0070705_100158134 3300005440 Bacteria 1512
45 Ga0070700_100032154 3300005441 Bacteria 3151
46 Ga0070708_100878252 3300005445 Bacteria 842
47 Ga0070663_100040476 3300005455 Bacteria 3263
48 Ga0070678_100409387 3300005456 Bacteria 1180
49 Ga0070662_100192351 3300005457 Bacteria 1614
50 Ga0068867_100051720 3300005459 Bacteria 3030
51 Ga0070685_10007267 3300005466 Bacteria 5664
52 Ga0070698_100000549 3300005471 Bacteria 40084
53 Ga0070698_100377022 3300005471 Unclassified 1351
54 Ga0070699_100005284 3300005518 Bacteria 11329
55 Ga0070679_100413680 3300005530 Bacteria 1294
56 Ga0068853_100450357 3300005539 Bacteria 1211
57 Ga0070672_100112458 3300005543 Bacteria 2221
58 Ga0070686_100030005 3300005544 Bacteria 3313
59 Ga0070695_100059608 3300005545 Bacteria 2472
60 Ga0070696_100022850 3300005546 Bacteria 4252
61 Ga0070665_100003291 3300005548 Bacteria 17337
62 Ga0070665_100303009 3300005548 Bacteria 1601
63 Ga0070665_100533449 3300005548 Bacteria 1185
64 Ga0070704_100041427 3300005549 Bacteria 3178
65 Ga0068855_100209912 3300005563 Bacteria 2188
66 Ga0070664_100361817 3300005564 Bacteria 1321
67 Ga0070664_100362403 3300005564 Bacteria 1320
68 Ga0070664_100683338 3300005564 Bacteria 955
69 Ga0068854_100009305 3300005578 Bacteria 6340
70 Ga0068856_100876217 3300005614 Bacteria 917
71 Ga0070702_100010331 3300005615 Bacteria 4592
72 Ga0068852_100086168 3300005616 Bacteria 2799
73 Ga0068859_100318693 3300005617 Bacteria 1649
74 Ga0068859_101275783 3300005617 Bacteria 809
75 Ga0068864_100130888 3300005618 Bacteria 2253
76 Ga0068864_100690401 3300005618 Bacteria 996
77 Ga0068864_102054165 3300005618 Bacteria 578
78 Ga0068861_100035421 3300005719 Bacteria 3697
79 Ga0068861_101994763 3300005719 Bacteria 579
80 Ga0068851_10354338 3300005834 Bacteria 855
81 Ga0068863_100097110 3300005841 Bacteria 2798
82 Ga0068858_100458280 3300005842 Bacteria 1229
83 Ga0068858_100830856 3300005842 Bacteria 902
84 Ga0068860_100647350 3300005843 Unclassified 1064
85 Ga0068860_101064774 3300005843 Bacteria 827
86 Ga0068862_100225430 3300005844 Bacteria 1698
87 Ga0081455_10026128 3300005937 Bacteria 5379
88 Ga0081538_10048875 3300005981 Bacteria 2573
89 Ga0081540_1000096 3300005983 Bacteria 92520
90 Ga0081540_1024793 3300005983 Bacteria 3471
91 Ga0070717_10548740 3300006028 Bacteria 1046
92 Ga0075365_10034017 3300006038 Bacteria 3289
93 Ga0075365_10271808 3300006038 Unclassified 1192
94 Ga0075368_10088816 3300006042 Bacteria 1263
95 Ga0075368_10357122 3300006042 Bacteria 637
96 Ga0075363_100004439 3300006048 Bacteria 6140
97 Ga0075363_100692085 3300006048 Bacteria 615
98 Ga0075364_10061332 3300006051 Bacteria 2467
99 Ga0075364_10266943 3300006051 Bacteria 1164
100 Ga0075432_10096719 3300006058 Bacteria 1087
101 Ga0070715_10037383 3300006163 Bacteria 2009
102 Ga0070712_100000645 3300006175 Bacteria 20511
103 Ga0070712_100382695 3300006175 Bacteria 1159
104 Ga0070712_100457447 3300006175 Bacteria 1064
105 Ga0075362_10051224 3300006177 Bacteria 1847
106 Ga0075362_10074433 3300006177 Unclassified 1556
107 Ga0075362_10097891 3300006177 Bacteria 1368
108 Ga0075362_10236980 3300006177 Bacteria 895
109 Ga0075367_10018880 3300006178 Bacteria 3812
110 Ga0075367_10038185 3300006178 Bacteria 2794
111 Ga0075367_10494536 3300006178 Bacteria 776
112 Ga0075366_10007424 3300006195 Bacteria 6057
113 Ga0097621_100066201 3300006237 Bacteria 2975
114 Ga0097621_100605152 3300006237 Bacteria 1002
115 Ga0075370_10042264 3300006353 Bacteria 2575
116 Ga0068871_100061038 3300006358 Bacteria 3077
117 Ga0075428_100040726 3300006844 Bacteria 5110
118 Ga0075428_100205746 3300006844 Bacteria 2127
119 Ga0075430_100201883 3300006846 Bacteria 1651
120 Ga0075430_100245548 3300006846 Bacteria 1483
121 Ga0075430_100728138 3300006846 Bacteria 818
122 Ga0075431_100097466 3300006847 Bacteria 3036
123 Ga0075431_100624268 3300006847 Bacteria 1060
124 Ga0075434_100004479 3300006871 Bacteria 12608
125 Ga0075434_100024408 3300006871 Bacteria 5910
126 Ga0075434_100032115 3300006871 Bacteria 5176
127 Ga0075434_100109950 3300006871 Bacteria 2767
128 Ga0075434_100172984 3300006871 Bacteria 2179
129 Ga0075434_101489773 3300006871 Bacteria 686
130 Ga0075429_100229999 3300006880 Bacteria 1624
131 Ga0075429_100261320 3300006880 Bacteria 1516
132 Ga0068865_100067191 3300006881 Bacteria 2531
133 Ga0075436_100006453 3300006914 Bacteria 8030
134 Ga0075436_100024183 3300006914 Bacteria 4176
135 Ga0075436_100152430 3300006914 Bacteria 1627
136 Ga0097620_100318697 3300006931 Bacteria 1649
137 Ga0097620_101275743 3300006931 Bacteria 809
138 Ga0075435_100006329 3300007076 Bacteria 8362
139 Ga0075435_100011046 3300007076 Bacteria 6625
140 Ga0075435_100393379 3300007076 Bacteria 1191
141 Ga0099795_10011148 3300007788 Bacteria 2675
142 Ga0099795_10048957 3300007788 Bacteria 1532
143 Ga0111539_10063999 3300009094 Bacteria 4352
144 Ga0111539_10116031 3300009094 Bacteria 3140
145 Ga0111539_10233499 3300009094 Bacteria 2141
146 Ga0111539_10268201 3300009094 Bacteria 1987
147 Ga0111539_10473594 3300009094 Bacteria 1458
148 Ga0111539_11602197 3300009094 Unclassified 755
149 Ga0105245_11088961 3300009098 Bacteria 845
150 Ga0105245_11121608 3300009098 Bacteria 833
151 Ga0105247_10152427 3300009101 Bacteria 1524
152 Ga0105247_10294281 3300009101 Bacteria 1124
153 Ga0114129_10024927 3300009147 Bacteria 8481
154 Ga0114129_10038065 3300009147 Bacteria 6786
155 Ga0114129_10383174 3300009147 Bacteria 1856
156 Ga0105243_10275770 3300009148 Unclassified 1512
157 Ga0105241_10409299 3300009174 Bacteria 1191
158 Ga0105241_10698018 3300009174 Bacteria 926
159 Ga0105242_10241767 3300009176 Bacteria 1623
160 Ga0105242_11180872 3300009176 Unclassified 783
161 Ga0105248_10245468 3300009177 Bacteria 2016
162 Ga0105248_11318134 3300009177 Unclassified 817
163 Ga0105248_11651635 3300009177 Bacteria 726
164 Ga0105237_10059075 3300009545 Bacteria 3837
165 Ga0105238_10093250 3300009551 Bacteria 2999
166 Ga0105249_10095187 3300009553 Bacteria 2792
167 Ga0105249_10333499 3300009553 Bacteria 1531
168 Ga0105249_12162413 3300009553 Bacteria 629
169 Ga0099796_10017862 3300010159 Bacteria 2119
170 Ga0099796_10066205 3300010159 Bacteria 1294
171 Ga0105239_10086249 3300010375 Bacteria 3460
172 Ga0105239_10135402 3300010375 Bacteria 2742
173 Ga0105239_10565603 3300010375 Bacteria 1295
174 Ga0105239_11011916 3300010375 Bacteria 955
175 Ga0105246_10612753 3300011119 Bacteria 942
176 Ga0157371_10224503 3300013102 Bacteria 1349
177 Ga0157374_10036956 3300013296 Bacteria 4477
178 Ga0163162_10229489 3300013306 Bacteria 1987
179 Ga0157375_10961026 3300013308 Bacteria 996
180 Ga0163163_10130795 3300014325 Bacteria 2550
181 Ga0163163_10171731 3300014325 Bacteria 2215
182 Ga0157380_10057187 3300014326 Bacteria 3105
183 Ga0157377_10001914 3300014745 Bacteria 9110
184 Ga0157376_11354977 3300014969 Bacteria 742
185 Ga0163161_10040395 3300017792 Bacteria 3351
186 Ga0209758_1003980 3300025297 Bacteria 12791
187 Ga0207642_10132689 3300025899 Bacteria 1302
188 Ga0207688_10002461 3300025901 Bacteria 9960
189 Ga0207647_10114777 3300025904 Bacteria 1591
190 Ga0207685_10075139 3300025905 Bacteria 1382
191 Ga0207685_10422351 3300025905 Bacteria 688
192 Ga0207699_10036813 3300025906 Bacteria 2793
193 Ga0207645_10119595 3300025907 Bacteria 1709
194 Ga0207643_10000233 3300025908 Bacteria 38972
195 Ga0207693_10002646 3300025915 Bacteria 15552
196 Ga0207693_10063975 3300025915 Bacteria 2882
197 Ga0207663_10080625 3300025916 Bacteria 2129
198 Ga0207657_10034859 3300025919 Bacteria 4519
199 Ga0207649_10548008 3300025920 Bacteria 884
200 Ga0207694_10417667 3300025924 Bacteria 1117
201 Ga0207650_10094737 3300025925 Bacteria 2288
202 Ga0207650_10871253 3300025925 Bacteria 764
203 Ga0207659_10056393 3300025926 Bacteria 2814
204 Ga0207659_10189884 3300025926 Bacteria 1634
205 Ga0207687_10308523 3300025927 Bacteria 1277
206 Ga0207700_10550438 3300025928 Bacteria 1024
207 Ga0207700_11588277 3300025928 Bacteria 579
208 Ga0207664_10525130 3300025929 Bacteria 1061
209 Ga0207644_10306933 3300025931 Bacteria 1280
210 Ga0207690_10268213 3300025932 Bacteria 1325
211 Ga0207690_10500818 3300025932 Bacteria 982
212 Ga0207690_10729789 3300025932 Bacteria 816
213 Ga0207706_10003937 3300025933 Bacteria 14075
214 Ga0207686_10168038 3300025934 Bacteria 1544
215 Ga0207709_10024046 3300025935 Bacteria 3475
216 Ga0207709_10163907 3300025935 Unclassified 1553
217 Ga0207670_10242861 3300025936 Bacteria 1388
218 Ga0207704_10029265 3300025938 Bacteria 3068
219 Ga0207691_10032224 3300025940 Bacteria 4888
220 Ga0207689_10029489 3300025942 Bacteria 4581
221 Ga0207661_10070914 3300025944 Bacteria 2846
222 Ga0207679_10241789 3300025945 Bacteria 1530
223 Ga0207679_10954996 3300025945 Bacteria 785
224 Ga0207651_10219892 3300025960 Bacteria 1535
225 Ga0207712_10018184 3300025961 Bacteria 4575
226 Ga0207712_10060456 3300025961 Bacteria 2686
227 Ga0207712_10434047 3300025961 Bacteria 1111
228 Ga0207668_10080841 3300025972 Bacteria 2355
229 Ga0207668_11941069 3300025972 Bacteria 531
230 Ga0207677_10058378 3300026023 Bacteria 2656
231 Ga0207703_10033883 3300026035 Bacteria 4050
232 Ga0207703_10799176 3300026035 Bacteria 900
233 Ga0207639_10046958 3300026041 Bacteria 3260
234 Ga0207678_10000904 3300026067 Bacteria 27235
235 Ga0207678_10015183 3300026067 Bacteria 6775
236 Ga0207708_10000911 3300026075 Bacteria 22215
237 Ga0207708_10207410 3300026075 Bacteria 1565
238 Ga0207702_10778109 3300026078 Bacteria 945
239 Ga0207702_11064991 3300026078 Bacteria 802
240 Ga0207648_10032057 3300026089 Bacteria 4643
241 Ga0207676_10118123 3300026095 Bacteria 2231
242 Ga0207676_10299433 3300026095 Bacteria 1468
243 Ga0207675_100005973 3300026118 Bacteria 11600
244 Ga0207683_10004734 3300026121 Bacteria 11725
245 Ga0207698_10056130 3300026142 Bacteria 3039
246 Ga0209179_1041977 3300027512 Bacteria 965
247 Ga0207428_10085020 3300027907 Bacteria 2464
248 Ga0207428_10459026 3300027907 Bacteria 928
249 Ga0268266_10001331 3300028379 Bacteria 29945
250 Ga0268266_10058883 3300028379 Bacteria 3308
251 Ga0268266_10251009 3300028379 Bacteria 1636
252 Ga0268266_11373251 3300028379 Bacteria 682
253 Ga0268265_10247281 3300028380 Bacteria 1577
254 Ga0268264_10230968 3300028381 Bacteria 1708
255 Ga0265324_10070911 3300029957 Bacteria 1187
256 Ga0265332_10000658 3300031238 Bacteria 22422
257 Ga0265325_10060947 3300031241 Bacteria 1915
258 Ga0265340_10016582 3300031247 Bacteria 3814
259 Ga0265331_10018707 3300031250 Bacteria 3586
260 Ga0265316_10390578 3300031344 Bacteria 1003
261 Ga0307408_100343992 3300031548 Bacteria 1263
262 Ga0265314_10022894 3300031711 Bacteria 4776
263 Ga0265342_10000354 3300031712 Bacteria 51330
264 Ga0307405_10002795 3300031731 Bacteria 7833
265 Ga0307413_11592505 3300031824 Bacteria 580
266 Ga0307410_10325912 3300031852 Bacteria 1220
267 Ga0307406_10261301 3300031901 Bacteria 1310
268 Ga0307412_10208531 3300031911 Bacteria 1489
269 Ga0307409_100095083 3300031995 Bacteria 2454
270 Ga0307416_100002236 3300032002 Bacteria 11015
271 Ga0307415_100059732 3300032126 Bacteria 2631
272 Ga0307510_10035032 3300033180 Bacteria 5611
273 Ga0373930_0060534 3300034816 Unclassified 844
274 Ga0373958_0007847 3300034819 Bacteria 1713
275 Ga0373959_0010011 3300034820 Unclassified 1649
276 Ga0373938_0053781 3300034957 Unclassified 926
277 Ga0373926_0033108 3300035083 Bacteria 1826
278 Ga0373928_0049399 3300035084 Bacteria 989
279 Ga0373929_0088942 3300035085 Bacteria 763
280 Ga0373940_0014659 3300035088 Bacteria 1916
281 Ga0373944_0000852 3300035089 Bacteria 7480
282 Ga0373944_0030548 3300035089 Bacteria 1616
283 Ga0373952_0058703 3300035092 Bacteria 935
284 Ga0373932_0020650 3300035112 Bacteria 1729
285 Ga0373936_0109834 3300035113 Bacteria 1170
286 Ga0373943_0009828 3300035170 Bacteria 4283
287 Ga0373943_0039219 3300035170 Unclassified 2281
288 Ga0373946_0026218 3300035171 Unclassified 2297
289 Ga0373955_0090650 3300035172 Bacteria 1742
290 Ga0373942_0006714 3300035207 Bacteria 2658
291 Ga0373961_0162143 3300035241 Bacteria 769
292 Ga0373924_0110049 3300035410 Bacteria 1190
293 Ga0373931_0003585 3300035691 Bacteria 7001
294 Ga0373935_0565709 3300035692 Unclassified 829
295 Ga0373935_1067799 3300035692 Bacteria 600
296 Ga0373927_0089853 3300035695 Bacteria 1994
297 Ga0373927_0090676 3300035695 Bacteria 1985
298 Ga0373927_0098105 3300035695 Bacteria 1905
299 Ga0373927_0107576 3300035695 Bacteria 1816
300 Ga0373927_0221773 3300035695 Bacteria 1242
301 Ga0373947_0013016 3300035725 Unclassified 4770
302 Ga0373947_0015865 3300035725 Bacteria 4326
303 Ga0373947_0027942 3300035725 Bacteria 3304
304 Ga0373947_0102685 3300035725 Bacteria 1798
305 Ga0373947_0157253 3300035725 Bacteria 1468
306 Ga0373947_0310769 3300035725 Bacteria 1052
307 Ga0373937_0019646 3300036401 Bacteria 6049
308 Ga0373925_0028570 3300037068 Bacteria 4086
309 Ga0373925_0060828 3300037068 Bacteria 2836
310 Ga0395905_0001030 3300037471 Bacteria 35512
311 Ga0395905_0001135 3300037471 Bacteria 33303
312 Ga0436360_1171271 3300039438 Bacteria 1829
313 Ga0451802_0666474 3300041460 Bacteria 1048
314 Ga0451807_0187441 3300041486 Bacteria 616
315 Ga0451853_1435927 3300041512 Bacteria 2192
316 Ga0439440_0060487 3300042993 Bacteria 966
317 Ga0466963_0542739 3300044694 Bacteria 821
318 Ga0466958_0297402 3300045836 Bacteria 1036
319 Ga0466967_0076583 3300045976 Bacteria 3009
320 Ga0466967_0452726 3300045976 Bacteria 1255
321 Ga0466967_0531019 3300045976 Bacteria 1157
322 Ga0495617_010885 3300046452 Unclassified 3114
323 Ga0495617_135578 3300046452 Bacteria 788
324 Ga0495592_0045034 3300046454 Unclassified 3293
325 Ga0495603_0011989 3300046455 Bacteria 5247
326 Ga0495603_0033725 3300046455 Unclassified 3079
327 Ga0495603_0106445 3300046455 Bacteria 1636
328 Ga0495603_0735885 3300046455 Bacteria 564
329 Ga0495590_0001787 3300046457 Bacteria 9120
330 Ga0495629_0022819 3300046459 Bacteria 4459
331 Ga0495629_0023009 3300046459 Bacteria 4441
332 Ga0495638_0195801 3300046460 Bacteria 1144
333 Ga0495641_0101377 3300046461 Bacteria 1285
334 Ga0495582_0034106 3300046473 Bacteria 2798
335 Ga0495582_0035701 3300046473 Unclassified 2734
336 Ga0495605_0239131 3300046474 Bacteria 780
337 Ga0495639_0015117 3300046475 Bacteria 3347
338 Ga0495662_0106988 3300046476 Bacteria 1370
339 Ga0495662_0400900 3300046476 Bacteria 674
340 Ga0495584_0012533 3300046491 Bacteria 4328
341 Ga0495584_0020896 3300046491 Bacteria 3323
342 Ga0495584_0056625 3300046491 Bacteria 1973
343 Ga0495584_0170499 3300046491 Bacteria 1106
344 Ga0495584_0385302 3300046491 Bacteria 712
345 Ga0495585_0002924 3300046492 Bacteria 11824
346 Ga0495585_0093673 3300046492 Bacteria 1615
347 Ga0495594_0013363 3300046499 Bacteria 4286
348 Ga0495607_0002323 3300046501 Bacteria 15587
349 Ga0495606_0007081 3300046507 Bacteria 10143
350 Ga0495616_0150972 3300046513 Bacteria 1051
351 Ga0495618_0104789 3300046514 Bacteria 1811
352 Ga0495620_0060536 3300046515 Bacteria 1578
353 Ga0495630_0006265 3300046517 Bacteria 8447
354 Ga0495630_0453352 3300046517 Bacteria 983
355 Ga0495630_0816369 3300046517 Bacteria 712
356 Ga0495631_0161323 3300046518 Bacteria 962
357 Ga0495631_0166412 3300046518 Bacteria 946
358 Ga0495637_0109157 3300046520 Bacteria 1074
359 Ga0495637_0128564 3300046520 Bacteria 969
360 Ga0495644_0000597 3300046523 Bacteria 15124
361 Ga0495644_0019181 3300046523 Bacteria 2611
362 Ga0495644_0065846 3300046523 Bacteria 1361
363 Ga0495648_0003381 3300046524 Bacteria 14040
364 Ga0495666_0324102 3300046526 Bacteria 695
365 Ga0495642_0001523 3300046528 Bacteria 10290
366 Ga0495652_0180097 3300046529 Bacteria 1623
367 Ga0495652_0406313 3300046529 Bacteria 963
368 Ga0495652_0471945 3300046529 Bacteria 875
369 Ga0495665_0378615 3300046531 Bacteria 719
370 Ga0495640_0075646 3300046533 Bacteria 2248
371 Ga0495621_0058667 3300046539 Bacteria 1393
372 Ga0495597_0032947 3300046542 Bacteria 2349
373 Ga0495622_0066310 3300046557 Unclassified 1669
374 Ga0495622_0188812 3300046557 Bacteria 922
375 Ga0495633_0002701 3300046558 Bacteria 12309
376 Ga0495667_0184580 3300046559 Bacteria 1338
377 Ga0495656_0004064 3300046615 Unclassified 4980
378 Ga0495656_0051782 3300046615 Bacteria 1758
379 Ga0495656_0177760 3300046615 Bacteria 1044
380 Ga0495656_0294685 3300046615 Bacteria 830
381 Ga0495668_0208500 3300046616 Bacteria 1070
382 Ga0495634_0236243 3300046642 Bacteria 1123
383 Ga0495611_0058462 3300046648 Unclassified 1748
384 Ga0495635_0111872 3300046663 Bacteria 1865
385 Ga0495659_0001980 3300046664 Bacteria 6736
386 Ga0495659_0014718 3300046664 Unclassified 2565
387 Ga0495659_0051806 3300046664 Bacteria 1496
388 Ga0495661_0145539 3300046665 Bacteria 1285
389 Ga0495646_0045631 3300046680 Bacteria 2676
390 Ga0495658_0012862 3300046683 Unclassified 4251
391 Ga0495658_0042242 3300046683 Bacteria 2544
392 Ga0495658_0239502 3300046683 Bacteria 1139
393 Ga0495658_0501532 3300046683 Bacteria 776
394 Ga0495658_0933736 3300046683 Bacteria 554
395 Ga0495613_0062216 3300046689 Bacteria 2732
396 Ga0495613_0472663 3300046689 Bacteria 847
397 Ga0495624_0044966 3300046690 Bacteria 2813
398 Ga0495624_0248034 3300046690 Bacteria 1077
399 Ga0495670_0002872 3300046691 Bacteria 8505
400 Ga0495649_0001737 3300046694 Bacteria 16085
401 Ga0495649_0274920 3300046694 Bacteria 861
402 Ga0495589_0286543 3300046794 Bacteria 765
403 Ga0495600_0082373 3300046809 Bacteria 2100
404 Ga0495660_0048874 3300046810 Bacteria 2312
405 Ga0495581_0165563 3300047315 Bacteria 1293
406 Ga0495581_0408545 3300047315 Bacteria 792
407 Ga0495604_0091454 3300047317 Bacteria 2257
408 Ga0495636_0129995 3300047318 Bacteria 1119
409 Ga0495674_0231930 3300047319 Bacteria 1523
410 Ga0495674_0371948 3300047319 Bacteria 1157
411 Ga0495674_0686329 3300047319 Bacteria 805
412 Ga0495672_0000153 3300047320 Bacteria 100183
413 Ga0495672_0250933 3300047320 Bacteria 859
414 Ga0495676_0091344 3300047321 Bacteria 2276
415 Ga0495676_0110979 3300047321 Unclassified 2012
416 Ga0495683_0000360 3300047323 Bacteria 37542
417 Ga0495687_011638 3300047443 Bacteria 4714
418 Ga0495677_0060600 3300047445 Unclassified 1403
419 Ga0495677_0109625 3300047445 Bacteria 1049
420 Ga0495679_048094 3300047446 Bacteria 1291
421 Ga0495685_081691 3300047447 Bacteria 1076
422 Ga0495684_0044460 3300047471 Bacteria 3401
423 Ga0495593_0013531 3300047673 Bacteria 4652
424 Ga0495626_0053882 3300048091 Bacteria 1849
425 Ga0496100_0464647 3300048903 Bacteria 971
426 Ga0496100_0529910 3300048903 Bacteria 910
427 Ga0496101_0001966 3300048904 Bacteria 12453
428 Ga0496101_0028328 3300048904 Bacteria 3909
429 Ga0496101_0029952 3300048904 Bacteria 3811
430 Ga0496101_0124983 3300048904 Bacteria 1948
431 Ga0496101_0359535 3300048904 Bacteria 1145
432 Ga0496102_0021029 3300048905 Bacteria 5770
433 Ga0496102_0137287 3300048905 Bacteria 2291
434 Ga0496102_0444181 3300048905 Bacteria 1217
435 Ga0496102_0796611 3300048905 Bacteria 867
436 Ga0496103_0035460 3300048906 Bacteria 3054
437 Ga0496103_0187567 3300048906 Bacteria 1329
438 Ga0496104_0000436 3300048907 Bacteria 36214
439 Ga0496104_0002453 3300048907 Bacteria 15971
440 Ga0496104_0004893 3300048907 Bacteria 11681
441 Ga0496104_0018828 3300048907 Bacteria 6306
442 Ga0496104_0041110 3300048907 Bacteria 4334
443 Ga0496105_0011507 3300048908 Bacteria 6994
444 Ga0496105_0017866 3300048908 Bacteria 5691
445 Ga0496105_0083468 3300048908 Bacteria 2638
446 Ga0496105_0170301 3300048908 Bacteria 1785
447 Ga0496105_0304464 3300048908 Bacteria 1280
448 Ga0496105_0368038 3300048908 Bacteria 1146
449 Ga0496106_0000032 3300048909 Bacteria 134707
450 Ga0496106_0126230 3300048909 Unclassified 2003
451 Ga0496106_0268969 3300048909 Bacteria 1364
452 Ga0496107_0042684 3300048910 Bacteria 3257
453 Ga0496107_0180252 3300048910 Bacteria 1568
454 Ga0496107_0460339 3300048910 Bacteria 944
455 Ga0496107_0462853 3300048910 Bacteria 941
456 Ga0496107_0632733 3300048910 Bacteria 789
457 Ga0496107_0736731 3300048910 Bacteria 724
458 Ga0496108_0010386 3300048911 Bacteria 7561
459 Ga0496108_0036535 3300048911 Bacteria 4087
460 Ga0496108_0167630 3300048911 Bacteria 1899
461 Ga0496108_0256954 3300048911 Bacteria 1520
462 Ga0496108_0713020 3300048911 Unclassified 869
463 Ga0496108_1099859 3300048911 Bacteria 675
464 Ga0496109_0017688 3300048912 Bacteria 6253
465 Ga0496109_0024349 3300048912 Bacteria 5381
466 Ga0496109_0039169 3300048912 Bacteria 4288
467 Ga0496109_0224325 3300048912 Bacteria 1768
468 Ga0496109_0245014 3300048912 Bacteria 1687
469 Ga0496110_0093710 3300048913 Bacteria 2688
470 Ga0496110_0157611 3300048913 Bacteria 2057
471 Ga0496110_0172675 3300048913 Bacteria 1961
472 Ga0496110_0592410 3300048913 Bacteria 1006
473 Ga0496110_1062376 3300048913 Bacteria 717
474 Ga0496111_0019844 3300048914 Bacteria 4673
475 Ga0496111_0038873 3300048914 Bacteria 3409
476 Ga0496111_0058934 3300048914 Bacteria 2781
477 Ga0496111_0624438 3300048914 Bacteria 788
478 Ga0496112_0004542 3300048915 Bacteria 11791
479 Ga0496112_0009481 3300048915 Bacteria 8776
480 Ga0496112_0271927 3300048915 Bacteria 1643
481 Ga0496112_0572472 3300048915 Bacteria 1062
482 Ga0496112_0756757 3300048915 Bacteria 897
483 Ga0496113_0013645 3300048916 Bacteria 5514
484 Ga0496113_0149376 3300048916 Bacteria 1842
485 Ga0496113_0366844 3300048916 Bacteria 1155
486 Ga0496113_0689803 3300048916 Bacteria 815
487 Ga0496114_0073911 3300048917 Bacteria 2869
488 Ga0496114_0123693 3300048917 Unclassified 2227
489 Ga0496114_0508778 3300048917 Bacteria 1065
490 Ga0496114_0744557 3300048917 Bacteria 857
491 Ga0496115_0004798 3300048918 Bacteria 9811
492 Ga0496115_0014451 3300048918 Bacteria 5976
493 Ga0496115_0053630 3300048918 Unclassified 3236
494 Ga0496115_0087196 3300048918 Bacteria 2547
495 Ga0496115_0173914 3300048918 Bacteria 1780
496 Ga0496115_0240328 3300048918 Bacteria 1492
497 Ga0496117_0047964 3300048920 Bacteria 3057
498 Ga0496118_0013136 3300048921 Bacteria 7861
499 Ga0496119_0051895 3300048922 Bacteria 2516
500 Ga0496121_0003588 3300048924 Bacteria 21901
501 Ga0496121_0005258 3300048924 Bacteria 16726
502 Ga0496123_0306238 3300048926 Bacteria 756
503 Ga0496126_0162405 3300048929 Bacteria 1908
504 Ga0496126_0365304 3300048929 Bacteria 1178
505 Ga0496126_0445410 3300048929 Bacteria 1043
506 Ga0501299_095057 3300049522 Bacteria 683
507 Ga0501073_0795726 3300049589 Bacteria 652
508 Ga0501233_200255 3300049668 Bacteria 581
509 Ga0501249_019609 3300049679 Bacteria 1469
510 Ga0501081_0817603 3300049743 Unclassified 702
511 nmdc:mga03683_105372_c1 3300050489 Bacteria 1242
512 nmdc:mga03683_347018_c1 3300050489 Bacteria 702
513 nmdc:mga03n38_1450_c1 3300050490 Bacteria 6803
514 nmdc:mga00v17_273163_c1 3300050491 Bacteria 1097
515 nmdc:mga00v17_317266_c1 3300050491 Bacteria 1013
516 nmdc:mga0yw44_12570_c1 3300050492 Bacteria 4420
517 nmdc:mga0yw44_19229_c1 3300050492 Bacteria 3761
518 nmdc:mga0yw44_224265_c1 3300050492 Bacteria 1246
519 nmdc:mga0yw44_38438_c1 3300050492 Bacteria 2832
520 nmdc:mga0yw44_408761_c1 3300050492 Bacteria 918
521 nmdc:mga0k408_42233_c1 3300050493 Bacteria 2626
522 nmdc:mga0k408_44753_c1 3300050493 Bacteria 2552
523 nmdc:mga06z11_115959_c1 3300050494 Bacteria 1489
524 nmdc:mga06z11_1647_c1 3300050494 Bacteria 8370
525 nmdc:mga06z11_340178_c1 3300050494 Bacteria 897
526 nmdc:mga07m45_6309_c1 3300050496 Bacteria 5988
527 nmdc:mga05p37_121409_c1 3300050507 Bacteria 3209
528 nmdc:mga05p37_159290_c1 3300050507 Bacteria 2757
529 nmdc:mga05p37_244225_c1 3300050507 Unclassified 2157
530 nmdc:mga05p37_25194_c1 3300050507 Bacteria 7234
531 nmdc:mga05p37_535253_c1 3300050507 Bacteria 1337
532 nmdc:mga09592_10752_c1 3300050508 Bacteria 7440
533 nmdc:mga09592_212748_c1 3300050508 Bacteria 1675
534 nmdc:mga09592_497904_c1 3300050508 Bacteria 1049
535 nmdc:mga0qj67_134652_c1 3300050509 Bacteria 2002
536 nmdc:mga0qj67_288458_c1 3300050509 Bacteria 1330
537 nmdc:mga06r32_1225569_c1 3300050510 Bacteria 696
538 nmdc:mga06r32_427838_c1 3300050510 Bacteria 1305
539 nmdc:mga06r32_487758_c1 3300050510 Bacteria 1210
540 nmdc:mga06r32_508710_c1 3300050510 Bacteria 1181
541 nmdc:mga08y16_273290_c1 3300050511 Bacteria 1744
542 nmdc:mga08y16_375216_c1 3300050511 Bacteria 1458
543 nmdc:mga08y16_834495_c1 3300050511 Bacteria 912
544 nmdc:mga0n895_103325_c1 3300050512 Unclassified 2861
545 nmdc:mga0n895_354142_c1 3300050512 Bacteria 1487
546 nmdc:mga0n895_61230_c1 3300050512 Bacteria 3715
547 nmdc:mga0n895_6320_c1 3300050512 Bacteria 10042
548 nmdc:mga0rr50_52062_c1 3300050513 Bacteria 3040
549 nmdc:mga08x19_103247_c1 3300050514 Bacteria 1894
550 nmdc:mga08x19_48316_c1 3300050514 Bacteria 2726
551 nmdc:mga0a205_48289_c1 3300050515 Unclassified 2834
552 nmdc:mga0a205_893980_c1 3300050515 Bacteria 735
553 Ga0495601_0015261 3300053077 Bacteria 4642
554 Ga0495601_0058512 3300053077 Bacteria 2442
555 Ga0495612_0006739 3300053078 Bacteria 4704
556 Ga0500635_0001053 3300053080 Bacteria 6605
557 Ga0495655_0014956 3300053083 Bacteria 1639
558 Ga0495655_0030512 3300053083 Bacteria 1304
559 Ga0495595_0046764 3300053084 Bacteria 1994
560 Ga0495595_0065053 3300053084 Bacteria 1715
561 Ga0495619_0000266 3300053085 Bacteria 38066
562 Ga0495619_0002930 3300053085 Bacteria 11092
563 Ga0495619_0152987 3300053085 Bacteria 1591
564 Ga0495619_0192925 3300053085 Bacteria 1410
565 Ga0495619_0218389 3300053085 Bacteria 1320
566 Ga0495619_0262585 3300053085 Bacteria 1196
567 Ga0500566_0143873 3300053094 Unclassified 1262
568 Ga0500566_0222555 3300053094 Bacteria 937
569 Ga0500554_010734 3300053102 Bacteria 2244
570 Ga0500595_010944 3300053119 Bacteria 3576
571 Ga0500595_018738 3300053119 Bacteria 2525
572 Ga0500652_000016 3300053131 Bacteria 126768
573 Ga0500603_000245 3300053150 Bacteria 14253
574 Ga0500636_0070231 3300053177 Bacteria 2032
575 Ga0466962_0717249 3300061719 Bacteria 513
576 2514047037 2513237166 Bacteria 10373764
577 2904486502 2904483920 Bacteria 7545285
578 Ga0496121_0332879
579 JGI24735J21928_10017376
580 JGI24745J21846_1042476
581 JGI24738J21930_10020907
582 JGI24744J21845_10019802
583 JGI24751J29686_10039331
584 JGI25404J52841_10002029
585 JGI25405J52794_10003580
586 Ga0065707_10504854
587 Ga0070676_10043756
588 Ga0070690_100061644
589 Ga0070690_100078608
590 Ga0070670_100078153
591 Ga0070670_100244713
592 Ga0070670_101591671
593 Ga0070666_10209764
594 Ga0070682_101075649
595 Ga0068868_100156071
596 Ga0068868_101514545
597 Ga0070660_100140000
598 Ga0070691_10034176
599 Ga0070687_100014219
600 Ga0070661_100131416
601 Ga0070661_100324424
602 Ga0070668_100210483
603 Ga0070669_100040898
604 Ga0070675_100052908
605 Ga0070675_101239731
606 Ga0070671_100213050
607 Ga0070671_101315898
608 Ga0070674_100558770
609 Ga0070673_100227298
610 Ga0070673_101250252
611 Ga0070688_100094156
612 Ga0070667_100445703
613 Ga0070667_100993167
614 Ga0070667_101529590
615 Ga0070709_10070204
616 Ga0070709_10157329
617 Ga0070709_10249539
618 Ga0070713_101494117
619 Ga0070710_10183026
620 Ga0070711_100365080
621 Ga0070705_100158134
622 Ga0070700_100032154
623 Ga0070708_100878252
624 Ga0070663_100040476
625 Ga0070678_100409387
626 Ga0070662_100192351
627 Ga0068867_100051720
628 Ga0070685_10007267
629 Ga0070698_100000549
630 Ga0070698_100377022
631 Ga0070699_100005284
632 Ga0070679_100413680
633 Ga0068853_100450357
634 Ga0070672_100112458
635 Ga0070686_100030005
636 Ga0070695_100059608
637 Ga0070696_100022850
638 Ga0070665_100003291
639 Ga0070665_100303009
640 Ga0070665_100533449
641 Ga0070704_100041427
642 Ga0068855_100209912
643 Ga0070664_100361817
644 Ga0070664_100362403
645 Ga0070664_100683338
646 Ga0068854_100009305
647 Ga0068856_100876217
648 Ga0070702_100010331
649 Ga0068852_100086168
650 Ga0068859_100318693
651 Ga0068859_101275783
652 Ga0068864_100130888
653 Ga0068864_100690401
654 Ga0068864_102054165
655 Ga0068861_100035421
656 Ga0068861_101994763
657 Ga0068851_10354338
658 Ga0068863_100097110
659 Ga0068858_100458280
660 Ga0068858_100830856
661 Ga0068860_100647350
662 Ga0068860_101064774
663 Ga0068862_100225430
664 Ga0081455_10026128
665 Ga0081538_10048875
666 Ga0081540_1000096
667 Ga0081540_1024793
668 Ga0070717_10548740
669 Ga0075365_10034017
670 Ga0075365_10271808
671 Ga0075368_10088816
672 Ga0075368_10357122
673 Ga0075363_100004439
674 Ga0075363_100692085
675 Ga0075364_10061332
676 Ga0075364_10266943
677 Ga0075432_10096719
678 Ga0070715_10037383
679 Ga0070712_100000645
680 Ga0070712_100382695
681 Ga0070712_100457447
682 Ga0075362_10051224
683 Ga0075362_10074433
684 Ga0075362_10097891
685 Ga0075362_10236980
686 Ga0075367_10018880
687 Ga0075367_10038185
688 Ga0075367_10494536
689 Ga0075366_10007424
690 Ga0097621_100066201
691 Ga0097621_100605152
692 Ga0075370_10042264
693 Ga0068871_100061038
694 Ga0075428_100040726
695 Ga0075428_100205746
696 Ga0075430_100201883
697 Ga0075430_100245548
698 Ga0075430_100728138
699 Ga0075431_100097466
700 Ga0075431_100624268
701 Ga0075434_100004479
702 Ga0075434_100024408
703 Ga0075434_100032115
704 Ga0075434_100109950
705 Ga0075434_100172984
706 Ga0075434_101489773
707 Ga0075429_100229999
708 Ga0075429_100261320
709 Ga0068865_100067191
710 Ga0075436_100006453
711 Ga0075436_100024183
712 Ga0075436_100152430
713 Ga0097620_100318697
714 Ga0097620_101275743
715 Ga0075435_100006329
716 Ga0075435_100011046
717 Ga0075435_100393379
718 Ga0099795_10011148
719 Ga0099795_10048957
720 Ga0111539_10063999
721 Ga0111539_10116031
722 Ga0111539_10233499
723 Ga0111539_10268201
724 Ga0111539_10473594
725 Ga0111539_11602197
726 Ga0105245_11088961
727 Ga0105245_11121608
728 Ga0105247_10152427
729 Ga0105247_10294281
730 Ga0114129_10024927
731 Ga0114129_10038065
732 Ga0114129_10383174
733 Ga0105243_10275770
734 Ga0105241_10409299
735 Ga0105241_10698018
736 Ga0105242_10241767
737 Ga0105242_11180872
738 Ga0105248_10245468
739 Ga0105248_11318134
740 Ga0105248_11651635
741 Ga0105237_10059075
742 Ga0105238_10093250
743 Ga0105249_10095187
744 Ga0105249_10333499
745 Ga0105249_12162413
746 Ga0099796_10017862
747 Ga0099796_10066205
748 Ga0105239_10086249
749 Ga0105239_10135402
750 Ga0105239_10565603
751 Ga0105239_11011916
752 Ga0105246_10612753
753 Ga0157371_10224503
754 Ga0157374_10036956
755 Ga0163162_10229489
756 Ga0157375_10961026
757 Ga0163163_10130795
758 Ga0163163_10171731
759 Ga0157380_10057187
760 Ga0157377_10001914
761 Ga0157376_11354977
762 Ga0163161_10040395
763 Ga0209758_1003980
764 Ga0207642_10132689
765 Ga0207688_10002461
766 Ga0207647_10114777
767 Ga0207685_10075139
768 Ga0207685_10422351
769 Ga0207699_10036813
770 Ga0207645_10119595
771 Ga0207643_10000233
772 Ga0207693_10002646
773 Ga0207693_10063975
774 Ga0207663_10080625
775 Ga0207657_10034859
776 Ga0207649_10548008
777 Ga0207694_10417667
778 Ga0207650_10094737
779 Ga0207650_10871253
780 Ga0207659_10056393
781 Ga0207659_10189884
782 Ga0207687_10308523
783 Ga0207700_10550438
784 Ga0207700_11588277
785 Ga0207664_10525130
786 Ga0207644_10306933
787 Ga0207690_10268213
788 Ga0207690_10500818
789 Ga0207690_10729789
790 Ga0207706_10003937
791 Ga0207686_10168038
792 Ga0207709_10024046
793 Ga0207709_10163907
794 Ga0207670_10242861
795 Ga0207704_10029265
796 Ga0207691_10032224
797 Ga0207689_10029489
798 Ga0207661_10070914
799 Ga0207679_10241789
800 Ga0207679_10954996
801 Ga0207651_10219892
802 Ga0207712_10018184
803 Ga0207712_10060456
804 Ga0207712_10434047
805 Ga0207668_10080841
806 Ga0207668_11941069
807 Ga0207677_10058378
808 Ga0207703_10033883
809 Ga0207703_10799176
810 Ga0207639_10046958
811 Ga0207678_10000904
812 Ga0207678_10015183
813 Ga0207708_10000911
814 Ga0207708_10207410
815 Ga0207702_10778109
816 Ga0207702_11064991
817 Ga0207648_10032057
818 Ga0207676_10118123
819 Ga0207676_10299433
820 Ga0207675_100005973
821 Ga0207683_10004734
822 Ga0207698_10056130
823 Ga0209179_1041977
824 Ga0207428_10085020
825 Ga0207428_10459026
826 Ga0268266_10001331
827 Ga0268266_10058883
828 Ga0268266_10251009
829 Ga0268266_11373251
830 Ga0268265_10247281
831 Ga0268264_10230968
832 Ga0265324_10070911
833 Ga0265332_10000658
834 Ga0265325_10060947
835 Ga0265340_10016582
836 Ga0265331_10018707
837 Ga0265316_10390578
838 Ga0307408_100343992
839 Ga0265314_10022894
840 Ga0265342_10000354
841 Ga0307405_10002795
842 Ga0307413_11592505
843 Ga0307410_10325912
844 Ga0307406_10261301
845 Ga0307412_10208531
846 Ga0307409_100095083
847 Ga0307416_100002236
848 Ga0307415_100059732
849 Ga0307510_10035032
850 Ga0373930_0060534
851 Ga0373958_0007847
852 Ga0373959_0010011
853 Ga0373938_0053781
854 Ga0373926_0033108
855 Ga0373928_0049399
856 Ga0373929_0088942
857 Ga0373940_0014659
858 Ga0373944_0000852
859 Ga0373944_0030548
860 Ga0373952_0058703
861 Ga0373932_0020650
862 Ga0373936_0109834
863 Ga0373943_0009828
864 Ga0373943_0039219
865 Ga0373946_0026218
866 Ga0373955_0090650
867 Ga0373942_0006714
868 Ga0373961_0162143
869 Ga0373924_0110049
870 Ga0373931_0003585
871 Ga0373935_0565709
872 Ga0373935_1067799
873 Ga0373927_0089853
874 Ga0373927_0090676
875 Ga0373927_0098105
876 Ga0373927_0107576
877 Ga0373927_0221773
878 Ga0373947_0013016
879 Ga0373947_0015865
880 Ga0373947_0027942
881 Ga0373947_0102685
882 Ga0373947_0157253
883 Ga0373947_0310769
884 Ga0373937_0019646
885 Ga0373925_0028570
886 Ga0373925_0060828
887 Ga0395905_0001030
888 Ga0395905_0001135
889 Ga0436360_1171271
890 Ga0451802_0666474
891 Ga0451807_0187441
892 Ga0451853_1435927
893 Ga0439440_0060487
894 Ga0466963_0542739
895 Ga0466958_0297402
896 Ga0466967_0076583
897 Ga0466967_0452726
898 Ga0466967_0531019
899 Ga0495617_010885
900 Ga0495617_135578
901 Ga0495592_0045034
902 Ga0495603_0011989
903 Ga0495603_0033725
904 Ga0495603_0106445
905 Ga0495603_0735885
906 Ga0495590_0001787
907 Ga0495629_0022819
908 Ga0495629_0023009
909 Ga0495638_0195801
910 Ga0495641_0101377
911 Ga0495582_0034106
912 Ga0495582_0035701
913 Ga0495605_0239131
914 Ga0495639_0015117
915 Ga0495662_0106988
916 Ga0495662_0400900
917 Ga0495584_0012533
918 Ga0495584_0020896
919 Ga0495584_0056625
920 Ga0495584_0170499
921 Ga0495584_0385302
922 Ga0495585_0002924
923 Ga0495585_0093673
924 Ga0495594_0013363
925 Ga0495607_0002323
926 Ga0495606_0007081
927 Ga0495616_0150972
928 Ga0495618_0104789
929 Ga0495620_0060536
930 Ga0495630_0006265
931 Ga0495630_0453352
932 Ga0495630_0816369
933 Ga0495631_0161323
934 Ga0495631_0166412
935 Ga0495637_0109157
936 Ga0495637_0128564
937 Ga0495644_0000597
938 Ga0495644_0019181
939 Ga0495644_0065846
940 Ga0495648_0003381
941 Ga0495666_0324102
942 Ga0495642_0001523
943 Ga0495652_0180097
944 Ga0495652_0406313
945 Ga0495652_0471945
946 Ga0495665_0378615
947 Ga0495640_0075646
948 Ga0495621_0058667
949 Ga0495597_0032947
950 Ga0495622_0066310
951 Ga0495622_0188812
952 Ga0495633_0002701
953 Ga0495667_0184580
954 Ga0495656_0004064
955 Ga0495656_0051782
956 Ga0495656_0177760
957 Ga0495656_0294685
958 Ga0495668_0208500
959 Ga0495634_0236243
960 Ga0495611_0058462
961 Ga0495635_0111872
962 Ga0495659_0001980
963 Ga0495659_0014718
964 Ga0495659_0051806
965 Ga0495661_0145539
966 Ga0495646_0045631
967 Ga0495658_0012862
968 Ga0495658_0042242
969 Ga0495658_0239502
970 Ga0495658_0501532
971 Ga0495658_0933736
972 Ga0495613_0062216
973 Ga0495613_0472663
974 Ga0495624_0044966
975 Ga0495624_0248034
976 Ga0495670_0002872
977 Ga0495649_0001737
978 Ga0495649_0274920
979 Ga0495589_0286543
980 Ga0495600_0082373
981 Ga0495660_0048874
982 Ga0495581_0165563
983 Ga0495581_0408545
984 Ga0495604_0091454
985 Ga0495636_0129995
986 Ga0495674_0231930
987 Ga0495674_0371948
988 Ga0495674_0686329
989 Ga0495672_0000153
990 Ga0495672_0250933
991 Ga0495676_0091344
992 Ga0495676_0110979
993 Ga0495683_0000360
994 Ga0495687_011638
995 Ga0495677_0060600
996 Ga0495677_0109625
997 Ga0495679_048094
998 Ga0495685_081691
999 Ga0495684_0044460
1000 Ga0495593_0013531
1001 Ga0495626_0053882
1002 Ga0496100_0464647
1003 Ga0496100_0529910
1004 Ga0496101_0001966
1005 Ga0496101_0028328
1006 Ga0496101_0029952
1007 Ga0496101_0124983
1008 Ga0496101_0359535
1009 Ga0496102_0021029
1010 Ga0496102_0137287
1011 Ga0496102_0444181
1012 Ga0496102_0796611
1013 Ga0496103_0035460
1014 Ga0496103_0187567
1015 Ga0496104_0000436
1016 Ga0496104_0002453
1017 Ga0496104_0004893
1018 Ga0496104_0018828
1019 Ga0496104_0041110
1020 Ga0496105_0011507
1021 Ga0496105_0017866
1022 Ga0496105_0083468
1023 Ga0496105_0170301
1024 Ga0496105_0304464
1025 Ga0496105_0368038
1026 Ga0496106_0000032
1027 Ga0496106_0126230
1028 Ga0496106_0268969
1029 Ga0496107_0042684
1030 Ga0496107_0180252
1031 Ga0496107_0460339
1032 Ga0496107_0462853
1033 Ga0496107_0632733
1034 Ga0496107_0736731
1035 Ga0496108_0010386
1036 Ga0496108_0036535
1037 Ga0496108_0167630
1038 Ga0496108_0256954
1039 Ga0496108_0713020
1040 Ga0496108_1099859
1041 Ga0496109_0017688
1042 Ga0496109_0024349
1043 Ga0496109_0039169
1044 Ga0496109_0224325
1045 Ga0496109_0245014
1046 Ga0496110_0093710
1047 Ga0496110_0157611
1048 Ga0496110_0172675
1049 Ga0496110_0592410
1050 Ga0496110_1062376
1051 Ga0496111_0019844
1052 Ga0496111_0038873
1053 Ga0496111_0058934
1054 Ga0496111_0624438
1055 Ga0496112_0004542
1056 Ga0496112_0009481
1057 Ga0496112_0271927
1058 Ga0496112_0572472
1059 Ga0496112_0756757
1060 Ga0496113_0013645
1061 Ga0496113_0149376
1062 Ga0496113_0366844
1063 Ga0496113_0689803
1064 Ga0496114_0073911
1065 Ga0496114_0123693
1066 Ga0496114_0508778
1067 Ga0496114_0744557
1068 Ga0496115_0004798
1069 Ga0496115_0014451
1070 Ga0496115_0053630
1071 Ga0496115_0087196
1072 Ga0496115_0173914
1073 Ga0496115_0240328
1074 Ga0496117_0047964
1075 Ga0496118_0013136
1076 Ga0496119_0051895
1077 Ga0496121_0003588
1078 Ga0496121_0005258
1079 Ga0496123_0306238
1080 Ga0496126_0162405
1081 Ga0496126_0365304
1082 Ga0496126_0445410
1083 Ga0501299_095057
1084 Ga0501073_0795726
1085 Ga0501233_200255
1086 Ga0501249_019609
1087 Ga0501081_0817603
1088 nmdc:mga03683_105372_c1
1089 nmdc:mga03683_347018_c1
1090 nmdc:mga03n38_1450_c1
1091 nmdc:mga00v17_273163_c1
1092 nmdc:mga00v17_317266_c1
1093 nmdc:mga0yw44_12570_c1
1094 nmdc:mga0yw44_19229_c1
1095 nmdc:mga0yw44_224265_c1
1096 nmdc:mga0yw44_38438_c1
1097 nmdc:mga0yw44_408761_c1
1098 nmdc:mga0k408_42233_c1
1099 nmdc:mga0k408_44753_c1
1100 nmdc:mga06z11_115959_c1
1101 nmdc:mga06z11_1647_c1
1102 nmdc:mga06z11_340178_c1
1103 nmdc:mga07m45_6309_c1
1104 nmdc:mga05p37_121409_c1
1105 nmdc:mga05p37_159290_c1
1106 nmdc:mga05p37_244225_c1
1107 nmdc:mga05p37_25194_c1
1108 nmdc:mga05p37_535253_c1
1109 nmdc:mga09592_10752_c1
1110 nmdc:mga09592_212748_c1
1111 nmdc:mga09592_497904_c1
1112 nmdc:mga0qj67_134652_c1
1113 nmdc:mga0qj67_288458_c1
1114 nmdc:mga06r32_1225569_c1
1115 nmdc:mga06r32_427838_c1
1116 nmdc:mga06r32_487758_c1
1117 nmdc:mga06r32_508710_c1
1118 nmdc:mga08y16_273290_c1
1119 nmdc:mga08y16_375216_c1
1120 nmdc:mga08y16_834495_c1
1121 nmdc:mga0n895_103325_c1
1122 nmdc:mga0n895_354142_c1
1123 nmdc:mga0n895_61230_c1
1124 nmdc:mga0n895_6320_c1
1125 nmdc:mga0rr50_52062_c1
1126 nmdc:mga08x19_103247_c1
1127 nmdc:mga08x19_48316_c1
1128 nmdc:mga0a205_48289_c1
1129 nmdc:mga0a205_893980_c1
1130 Ga0495601_0015261
1131 Ga0495601_0058512
1132 Ga0495612_0006739
1133 Ga0500635_0001053
1134 Ga0495655_0014956
1135 Ga0495655_0030512
1136 Ga0495595_0046764
1137 Ga0495595_0065053
1138 Ga0495619_0000266
1139 Ga0495619_0002930
1140 Ga0495619_0152987
1141 Ga0495619_0192925
1142 Ga0495619_0218389
1143 Ga0495619_0262585
1144 Ga0500566_0143873
1145 Ga0500566_0222555
1146 Ga0500554_010734
1147 Ga0500595_010944
1148 Ga0500595_018738
1149 Ga0500652_000016
1150 Ga0500603_000245
1151 Ga0500636_0070231
1152 Ga0466962_0717249
1153 2514047037
1154 2904486502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

77

151

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

9

82

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9625 6 156
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9597 6 157
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9555 6 157
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9541 4 155
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.948 4 156
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9769 86 154 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9688 86 154 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9674 86 157 1.10.150.120
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9596 6 79 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9558 84 155 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A2Z3UTC8-F1-model_v4 (2Fe-2S)-binding protein 0.9744 4 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A2A9ES86-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9717 3 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A2D6T2M5-F1-model_v4 Ferredoxin 0.971 5 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A800F632-F1-model_v4 (2Fe-2S)-binding protein 0.9705 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A6N8Z3J8-F1-model_v4 (2Fe-2S)-binding protein 0.9704 4 155 GO:0016491
GO:0046872
GO:0051537

Map