F465601

General Info

Members Datasets Scaffolds Average Seq Length
577 296 1154 247

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100003052|Ga0075434_10000305211
Length 284
Sequence VDESEIDSANERAASGPPFRIDEGAFLYGLPVPGDAQRLGLPSGTRACLFDLDGVLTQTAKVHAAAWKEMFDAYLRERAKQTGDEFVPFDPVADYDQYVDGKPRYDGVRSFLASRGIELPEGDPSDPPSAETVHGLGNRKNELVLALLKRDGVESYEGSVRYVHAVREAGLDTAVVSASANCREVLEAAGIEDLFEVRIDGVVVEERHLRGKPAPDTFLAAAKELGVEPGGAAVFEDALAGVEAGRAGNFGFVVGVDRTGQRDALREHGADIVVSDLAELLEHT

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 2558860280 Kutzneria sp. 744 Isolate Unclassified
287 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
288 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
289 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
290 2867428634 Streptomyces sp. RP5T Isolate Unclassified
291 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
292 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
293 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
294 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
295 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
296 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0.69
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0.17
Rhizoplane 9.19
Rhizosphere 86.66
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100003052 3300006871 Bacteria 14898
2 JGI24740J21852_10053412 3300001979 Bacteria 1146
3 JGI24739J22299_10062820 3300001989 Bacteria 1170
4 JGI24737J22298_10041495 3300001990 Bacteria 1411
5 rootH1_10290883 3300003323 Bacteria 1552
6 JGI25407J50210_10016693 3300003373 Bacteria 1902
7 Ga0070683_100119908 3300005329 Bacteria 2484
8 Ga0070683_100216460 3300005329 Bacteria 1820
9 Ga0070690_100066730 3300005330 Bacteria 2330
10 Ga0070666_10090015 3300005335 Bacteria 2107
11 Ga0070666_10356874 3300005335 Bacteria 1047
12 Ga0070682_100154340 3300005337 Unclassified 1579
13 Ga0068868_100215133 3300005338 Bacteria 1607
14 Ga0070689_100445096 3300005340 Bacteria 1101
15 Ga0070675_100167127 3300005354 Bacteria 1895
16 Ga0070671_100197513 3300005355 Bacteria 1705
17 Ga0070671_100423047 3300005355 Bacteria 1141
18 Ga0070673_100119538 3300005364 Bacteria 2196
19 Ga0070688_100054510 3300005365 Bacteria 2505
20 Ga0070667_100486541 3300005367 Bacteria 1130
21 Ga0070709_10086754 3300005434 Bacteria 2055
22 Ga0070709_10397344 3300005434 Bacteria 1028
23 Ga0070714_100011770 3300005435 Bacteria 6952
24 Ga0070714_100058757 3300005435 Bacteria 3296
25 Ga0070714_100098822 3300005435 Bacteria 2568
26 Ga0070714_100104496 3300005435 Bacteria 2499
27 Ga0070714_100107099 3300005435 Bacteria 2470
28 Ga0070714_100409112 3300005435 Bacteria 1284
29 Ga0070713_100076462 3300005436 Bacteria 2843
30 Ga0070713_100134114 3300005436 Bacteria 2186
31 Ga0070713_100175169 3300005436 Bacteria 1924
32 Ga0070710_10171374 3300005437 Bacteria 1352
33 Ga0070711_100039060 3300005439 Bacteria 3194
34 Ga0070705_100172069 3300005440 Bacteria 1459
35 Ga0070705_100404247 3300005440 Bacteria 1012
36 Ga0070694_100013222 3300005444 Bacteria 5151
37 Ga0070694_100234269 3300005444 Bacteria 1382
38 Ga0070708_100002568 3300005445 Bacteria 14054
39 Ga0070708_100041614 3300005445 Bacteria 4029
40 Ga0070663_100205994 3300005455 Bacteria 1538
41 Ga0070678_100000829 3300005456 Bacteria 15677
42 Ga0070678_100006720 3300005456 Bacteria 6774
43 Ga0070678_100081543 3300005456 Bacteria 2453
44 Ga0070681_10027583 3300005458 Bacteria 5709
45 Ga0070706_100002130 3300005467 Bacteria 20170
46 Ga0070706_100069427 3300005467 Bacteria 3258
47 Ga0070706_100344891 3300005467 Bacteria 1388
48 Ga0070706_100402926 3300005467 Bacteria 1273
49 Ga0070707_100009600 3300005468 Bacteria 8990
50 Ga0070698_100002524 3300005471 Bacteria 20162
51 Ga0070698_100017769 3300005471 Bacteria 7490
52 Ga0070698_100021394 3300005471 Bacteria 6775
53 Ga0070699_100155075 3300005518 Bacteria 2026
54 Ga0070699_100257234 3300005518 Bacteria 1561
55 Ga0070699_100844823 3300005518 Bacteria 838
56 Ga0070679_100194519 3300005530 Bacteria 1996
57 Ga0070684_100014845 3300005535 Bacteria 6320
58 Ga0070684_100449671 3300005535 Bacteria 1191
59 Ga0070697_100077052 3300005536 Bacteria 2742
60 Ga0070697_100417837 3300005536 Bacteria 1165
61 Ga0070686_100182048 3300005544 Bacteria 1494
62 Ga0070695_100193961 3300005545 Bacteria 1447
63 Ga0070696_100010205 3300005546 Bacteria 6285
64 Ga0070665_100865513 3300005548 Bacteria 917
65 Ga0070704_100178463 3300005549 Bacteria 1696
66 Ga0068855_100196958 3300005563 Bacteria 2269
67 Ga0068855_100280206 3300005563 Bacteria 1851
68 Ga0068857_100292333 3300005577 Bacteria 1501
69 Ga0068854_100108419 3300005578 Bacteria 2091
70 Ga0068856_100172238 3300005614 Bacteria 2177
71 Ga0068856_100187210 3300005614 Bacteria 2084
72 Ga0068856_100292576 3300005614 Bacteria 1645
73 Ga0068856_100836030 3300005614 Bacteria 940
74 Ga0070702_100001599 3300005615 Bacteria 9352
75 Ga0070702_100033290 3300005615 Bacteria 2833
76 Ga0070702_100268160 3300005615 Bacteria 1166
77 Ga0068852_100026858 3300005616 Bacteria 4686
78 Ga0068859_100035423 3300005617 Bacteria 5008
79 Ga0068864_100031440 3300005618 Bacteria 4504
80 Ga0068864_100247040 3300005618 Bacteria 1655
81 Ga0068861_100155481 3300005719 Bacteria 1881
82 Ga0068861_100660436 3300005719 Bacteria 967
83 Ga0068863_100222462 3300005841 Bacteria 1819
84 Ga0068858_100097594 3300005842 Bacteria 2739
85 Ga0081455_10000239 3300005937 Bacteria 71193
86 Ga0081455_10030930 3300005937 Bacteria 4854
87 Ga0081538_10001690 3300005981 Bacteria 22493
88 Ga0081538_10008143 3300005981 Bacteria 8943
89 Ga0081539_10020148 3300005985 Bacteria 4526
90 Ga0070717_10007315 3300006028 Bacteria 8191
91 Ga0070717_10019348 3300006028 Bacteria 5338
92 Ga0070717_10375939 3300006028 Bacteria 1273
93 Ga0075365_10003918 3300006038 Bacteria 7794
94 Ga0075364_10008666 3300006051 Bacteria 6081
95 Ga0075432_10039381 3300006058 Bacteria 1648
96 Ga0070715_10045237 3300006163 Bacteria 1865
97 Ga0070715_10060522 3300006163 Bacteria 1661
98 Ga0070716_100008653 3300006173 Bacteria 5056
99 Ga0070712_100009938 3300006175 Bacteria 5998
100 Ga0070712_100129008 3300006175 Bacteria 1914
101 Ga0070712_100151831 3300006175 Bacteria 1779
102 Ga0070712_100244241 3300006175 Bacteria 1431
103 Ga0097621_100018088 3300006237 Bacteria 5374
104 Ga0075428_100050230 3300006844 Bacteria 4575
105 Ga0075428_100105644 3300006844 Bacteria 3070
106 Ga0075428_100284063 3300006844 Bacteria 1781
107 Ga0075431_100047096 3300006847 Bacteria 4445
108 Ga0075431_100091455 3300006847 Bacteria 3141
109 Ga0075433_10041098 3300006852 Bacteria 4005
110 Ga0075433_10206504 3300006852 Bacteria 1746
111 Ga0075433_10315048 3300006852 Bacteria 1384
112 Ga0075434_100192619 3300006871 Bacteria 2059
113 Ga0075434_100414282 3300006871 Bacteria 1368
114 Ga0075434_100495129 3300006871 Bacteria 1243
115 Ga0075434_100644756 3300006871 Bacteria 1077
116 Ga0075436_100004941 3300006914 Bacteria 9163
117 Ga0075436_100004998 3300006914 Bacteria 9111
118 Ga0075436_100014416 3300006914 Bacteria 5412
119 Ga0075436_100045063 3300006914 Bacteria 3042
120 Ga0075436_100149460 3300006914 Bacteria 1643
121 Ga0097620_100035420 3300006931 Bacteria 5008
122 Ga0075435_100053652 3300007076 Bacteria 3251
123 Ga0075435_100099894 3300007076 Bacteria 2403
124 Ga0075435_100317360 3300007076 Bacteria 1334
125 Ga0105240_10127812 3300009093 Bacteria 3052
126 Ga0105240_10130838 3300009093 Bacteria 3010
127 Ga0105240_10246209 3300009093 Bacteria 2070
128 Ga0105240_10820640 3300009093 Bacteria 1006
129 Ga0111539_10077573 3300009094 Bacteria 3910
130 Ga0111539_10158959 3300009094 Bacteria 2643
131 Ga0111539_10182446 3300009094 Bacteria 2451
132 Ga0111539_10951123 3300009094 Bacteria 999
133 Ga0105245_10117845 3300009098 Bacteria 2477
134 Ga0105245_10427632 3300009098 Bacteria 1328
135 Ga0105247_10082034 3300009101 Bacteria 2034
136 Ga0114129_10012458 3300009147 Bacteria 12108
137 Ga0114129_10051420 3300009147 Bacteria 5785
138 Ga0114129_10061278 3300009147 Bacteria 5257
139 Ga0114129_10329796 3300009147 Bacteria 2027
140 Ga0114129_10373519 3300009147 Bacteria 1884
141 Ga0114129_10961820 3300009147 Bacteria 1078
142 Ga0105243_10093753 3300009148 Bacteria 2478
143 Ga0105243_10497719 3300009148 Bacteria 1154
144 Ga0105241_10014308 3300009174 Bacteria 5809
145 Ga0105241_10086065 3300009174 Bacteria 2471
146 Ga0105241_10288035 3300009174 Bacteria 1405
147 Ga0105242_10270075 3300009176 Bacteria 1540
148 Ga0105242_10446854 3300009176 Bacteria 1218
149 Ga0105237_10006472 3300009545 Bacteria 12984
150 Ga0105237_10305835 3300009545 Bacteria 1593
151 Ga0105238_10257957 3300009551 Bacteria 1722
152 Ga0105238_10558783 3300009551 Bacteria 1149
153 Ga0105249_10161575 3300009553 Bacteria 2165
154 Ga0105249_11030773 3300009553 Bacteria 892
155 Ga0105239_10571024 3300010375 Bacteria 1289
156 Ga0157373_10043298 3300013100 Bacteria 3216
157 Ga0157369_10026251 3300013105 Bacteria 6464
158 Ga0157369_10521186 3300013105 Bacteria 1229
159 Ga0157369_10744364 3300013105 Bacteria 1009
160 Ga0157374_10011091 3300013296 Bacteria 7787
161 Ga0157374_10380528 3300013296 Bacteria 1406
162 Ga0157378_10000748 3300013297 Bacteria 30392
163 Ga0157378_10129460 3300013297 Bacteria 2335
164 Ga0163162_10097450 3300013306 Bacteria 3029
165 Ga0163162_10178704 3300013306 Bacteria 2248
166 Ga0157372_10289327 3300013307 Bacteria 1905
167 Ga0157372_10516366 3300013307 Bacteria 1393
168 Ga0157375_10072073 3300013308 Bacteria 3470
169 Ga0163163_10009475 3300014325 Bacteria 8695
170 Ga0157379_10026701 3300014968 Bacteria 5140
171 Ga0157376_10010594 3300014969 Bacteria 6752
172 Ga0197907_10286942 3300020069 Bacteria 1199
173 Ga0206350_10692687 3300020080 Bacteria 1922
174 Ga0206353_10916800 3300020082 Bacteria 1276
175 Ga0213876_10034983 3300021384 Bacteria 2650
176 Ga0224712_10022527 3300022467 Bacteria 2173
177 Ga0207692_10034358 3300025898 Bacteria 2454
178 Ga0207692_10264541 3300025898 Bacteria 1035
179 Ga0207688_10054874 3300025901 Bacteria 2236
180 Ga0207680_10249105 3300025903 Bacteria 1226
181 Ga0207680_10289023 3300025903 Bacteria 1141
182 Ga0207647_10202566 3300025904 Bacteria 1147
183 Ga0207685_10067726 3300025905 Bacteria 1436
184 Ga0207699_10319235 3300025906 Bacteria 1089
185 Ga0207705_10051775 3300025909 Bacteria 2955
186 Ga0207684_10002157 3300025910 Bacteria 20173
187 Ga0207684_10230362 3300025910 Bacteria 1598
188 Ga0207684_10296778 3300025910 Bacteria 1393
189 Ga0207684_10425658 3300025910 Bacteria 1140
190 Ga0207707_10007436 3300025912 Bacteria 9542
191 Ga0207695_10102045 3300025913 Bacteria 2862
192 Ga0207695_10116613 3300025913 Bacteria 2644
193 Ga0207693_10004161 3300025915 Bacteria 12275
194 Ga0207693_10007250 3300025915 Bacteria 9125
195 Ga0207693_10010770 3300025915 Bacteria 7424
196 Ga0207663_10017509 3300025916 Bacteria 3994
197 Ga0207663_10022461 3300025916 Bacteria 3606
198 Ga0207663_10032504 3300025916 Bacteria 3098
199 Ga0207663_10323751 3300025916 Bacteria 1159
200 Ga0207660_10350143 3300025917 Bacteria 1184
201 Ga0207652_10033748 3300025921 Bacteria 4310
202 Ga0207646_10000051 3300025922 Bacteria 170502
203 Ga0207646_10013700 3300025922 Bacteria 7745
204 Ga0207646_10390029 3300025922 Bacteria 1258
205 Ga0207659_10024288 3300025926 Bacteria 4059
206 Ga0207687_10039956 3300025927 Bacteria 3214
207 Ga0207700_10195085 3300025928 Bacteria 1703
208 Ga0207700_10284014 3300025928 Bacteria 1424
209 Ga0207700_10456020 3300025928 Bacteria 1127
210 Ga0207664_10217681 3300025929 Bacteria 1655
211 Ga0207664_10238974 3300025929 Bacteria 1581
212 Ga0207690_10238996 3300025932 Bacteria 1398
213 Ga0207686_10193497 3300025934 Bacteria 1451
214 Ga0207665_10003261 3300025939 Bacteria 10867
215 Ga0207665_10011004 3300025939 Bacteria 5938
216 Ga0207665_10042113 3300025939 Bacteria 3052
217 Ga0207691_10043035 3300025940 Bacteria 4163
218 Ga0207689_10067022 3300025942 Bacteria 2951
219 Ga0207661_10238531 3300025944 Bacteria 1613
220 Ga0207661_10391757 3300025944 Bacteria 1259
221 Ga0207661_10475693 3300025944 Bacteria 1140
222 Ga0207667_10207295 3300025949 Bacteria 2010
223 Ga0207651_10031715 3300025960 Bacteria 3383
224 Ga0207651_10040342 3300025960 Bacteria 3088
225 Ga0207712_10259712 3300025961 Bacteria 1408
226 Ga0207668_10082653 3300025972 Bacteria 2334
227 Ga0207668_10470577 3300025972 Bacteria 1076
228 Ga0207640_10311046 3300025981 Bacteria 1250
229 Ga0207658_10216754 3300025986 Bacteria 1608
230 Ga0207677_10375429 3300026023 Bacteria 1199
231 Ga0207703_10068963 3300026035 Bacteria 2915
232 Ga0207678_10026288 3300026067 Bacteria 5078
233 Ga0207678_10029184 3300026067 Bacteria 4814
234 Ga0207678_10048133 3300026067 Bacteria 3686
235 Ga0207708_10010625 3300026075 Bacteria 6837
236 Ga0207702_10192677 3300026078 Bacteria 1885
237 Ga0207641_10261005 3300026088 Bacteria 1622
238 Ga0207648_10428116 3300026089 Bacteria 1202
239 Ga0207676_10024761 3300026095 Bacteria 4445
240 Ga0207674_10165782 3300026116 Bacteria 2164
241 Ga0207674_10329649 3300026116 Bacteria 1476
242 Ga0207675_100295283 3300026118 Bacteria 1577
243 Ga0207675_100656871 3300026118 Bacteria 1055
244 Ga0207683_10000695 3300026121 Bacteria 30863
245 Ga0207683_10002135 3300026121 Bacteria 17379
246 Ga0207683_10165175 3300026121 Bacteria 2003
247 Ga0209998_10018793 3300027717 Bacteria 1470
248 Ga0207428_10028168 3300027907 Bacteria 4670
249 Ga0207428_10092658 3300027907 Bacteria 2345
250 Ga0268265_10294757 3300028380 Bacteria 1458
251 Ga0268264_10384724 3300028381 Bacteria 1344
252 Ga0265334_10042680 3300028573 Bacteria 1767
253 Ga0265338_10019520 3300028800 Bacteria 7185
254 Ga0265338_10297504 3300028800 Bacteria 1174
255 Ga0307511_10000059 3300030521 Bacteria 93044
256 Ga0265320_10022518 3300031240 Bacteria 3369
257 Ga0265325_10031210 3300031241 Bacteria 2853
258 Ga0265331_10095702 3300031250 Bacteria 1370
259 Ga0265316_10036952 3300031344 Bacteria 3948
260 Ga0307513_10074556 3300031456 Bacteria 3528
261 Ga0307408_100053933 3300031548 Bacteria 2906
262 Ga0307408_100248053 3300031548 Bacteria 1467
263 Ga0265313_10017729 3300031595 Bacteria 4029
264 Ga0307508_10188161 3300031616 Bacteria 1666
265 Ga0265314_10039717 3300031711 Bacteria 3386
266 Ga0307410_10060183 3300031852 Bacteria 2595
267 Ga0307409_100113342 3300031995 Bacteria 2279
268 Ga0307416_101029009 3300032002 Bacteria 927
269 Ga0307414_10243209 3300032004 Bacteria 1491
270 Ga0307510_10095564 3300033180 Bacteria 2791
271 Ga0373948_0009949 3300034817 Bacteria 1650
272 Ga0373958_0010554 3300034819 Bacteria 1544
273 Ga0373938_0010132 3300034957 Bacteria 1724
274 Ga0373928_0001507 3300035084 Bacteria 4531
275 Ga0373929_0010805 3300035085 Bacteria 1712
276 Ga0373940_0017992 3300035088 Bacteria 1767
277 Ga0373949_0010220 3300035090 Bacteria 2056
278 Ga0373951_0000965 3300035091 Bacteria 7740
279 Ga0373952_0001667 3300035092 Bacteria 4040
280 Ga0373923_0196913 3300035111 Bacteria 930
281 Ga0373932_0002601 3300035112 Bacteria 4501
282 Ga0373939_0009827 3300035114 Bacteria 2379
283 Ga0373941_0001722 3300035115 Bacteria 4699
284 Ga0373941_0010193 3300035115 Bacteria 2392
285 Ga0373953_0000062 3300035117 Bacteria 27440
286 Ga0373956_0000061 3300035119 Bacteria 37279
287 Ga0373957_0000042 3300035120 Bacteria 33397
288 Ga0373960_0000888 3300035121 Bacteria 6348
289 Ga0373955_0000106 3300035172 Bacteria 33578
290 Ga0373962_0001812 3300035242 Bacteria 5090
291 Ga0373924_0000794 3300035410 Bacteria 9847
292 Ga0373931_0010730 3300035691 Bacteria 4410
293 Ga0373931_0050412 3300035691 Bacteria 2215
294 Ga0373933_0000046 3300035724 Bacteria 76647
295 Ga0373937_0000115 3300036401 Bacteria 76660
296 Ga0373937_0791927 3300036401 Bacteria 896
297 Ga0373925_0146684 3300037068 Bacteria 1850
298 Ga0373925_0375268 3300037068 Bacteria 1157
299 Ga0395899_0001671 3300037312 Bacteria 18485
300 Ga0395899_0012342 3300037312 Bacteria 6543
301 Ga0395899_0114245 3300037312 Bacteria 1939
302 Ga0395899_0159275 3300037312 Bacteria 1596
303 Ga0395899_0345387 3300037312 Bacteria 997
304 Ga0395900_0004632 3300037418 Bacteria 14505
305 Ga0395900_0022529 3300037418 Bacteria 6444
306 Ga0395900_0061243 3300037418 Bacteria 3870
307 Ga0395900_0176668 3300037418 Bacteria 2172
308 Ga0395900_0220218 3300037418 Bacteria 1913
309 Ga0395900_0319292 3300037418 Bacteria 1534
310 Ga0395900_0502938 3300037418 Bacteria 1162
311 Ga0395900_0572327 3300037418 Bacteria 1072
312 Ga0395900_0619395 3300037418 Bacteria 1021
313 Ga0395898_0005144 3300037466 Bacteria 14152
314 Ga0395898_0014039 3300037466 Bacteria 8231
315 Ga0395898_0020510 3300037466 Bacteria 6712
316 Ga0395898_0140161 3300037466 Bacteria 2315
317 Ga0395898_0181953 3300037466 Bacteria 2009
318 Ga0395905_0003225 3300037471 Bacteria 17539
319 Ga0395905_0005706 3300037471 Bacteria 12649
320 Ga0395905_0042603 3300037471 Bacteria 4260
321 Ga0395905_0057957 3300037471 Bacteria 3623
322 Ga0395905_0137204 3300037471 Bacteria 2302
323 Ga0395901_0001805 3300038443 Bacteria 22118
324 Ga0395901_0074413 3300038443 Bacteria 3543
325 Ga0395901_0096226 3300038443 Bacteria 3103
326 Ga0395901_0195010 3300038443 Bacteria 2124
327 Ga0395901_0308493 3300038443 Bacteria 1639
328 Ga0395901_0397382 3300038443 Bacteria 1416
329 Ga0395901_0467943 3300038443 Bacteria 1287
330 Ga0395901_0568509 3300038443 Bacteria 1147
331 Ga0395901_0664696 3300038443 Unclassified 1043
332 Ga0242420_027052 3300038996 Bacteria 1049
333 Ga0436365_0179487 3300039437 Bacteria 4915
334 Ga0439448_0009792 3300042005 Bacteria 2830
335 Ga0439459_0006556 3300042438 Bacteria 1942
336 Ga0466969_0000788 3300044656 Bacteria 17333
337 Ga0466969_0008420 3300044656 Bacteria 5470
338 Ga0466969_0008861 3300044656 Bacteria 5337
339 Ga0466972_0005531 3300044658 Bacteria 6328
340 Ga0466972_0006071 3300044658 Bacteria 6068
341 Ga0466965_0001950 3300044683 Bacteria 8619
342 Ga0466965_0033560 3300044683 Bacteria 2509
343 Ga0466965_0044118 3300044683 Bacteria 2203
344 Ga0466965_0076161 3300044683 Bacteria 1693
345 Ga0466965_0118547 3300044683 Bacteria 1365
346 Ga0466965_0183179 3300044683 Bacteria 1105
347 Ga0466966_0000652 3300044684 Bacteria 22095
348 Ga0466966_0023203 3300044684 Bacteria 4064
349 Ga0466966_0077138 3300044684 Bacteria 2080
350 Ga0466966_0419163 3300044684 Bacteria 805
351 Ga0466961_0001821 3300044693 Bacteria 13226
352 Ga0466961_0040352 3300044693 Bacteria 2993
353 Ga0466961_0058392 3300044693 Bacteria 2455
354 Ga0466963_0001564 3300044694 Bacteria 12409
355 Ga0466963_0046034 3300044694 Bacteria 2875
356 Ga0466963_0076882 3300044694 Bacteria 2255
357 Ga0466963_0107722 3300044694 Bacteria 1911
358 Ga0466963_0142032 3300044694 Bacteria 1664
359 Ga0466963_0263784 3300044694 Bacteria 1209
360 Ga0466963_0300867 3300044694 Bacteria 1128
361 Ga0466963_0537583 3300044694 Bacteria 825
362 Ga0466964_0003572 3300044706 Bacteria 5683
363 Ga0466964_0037629 3300044706 Bacteria 1944
364 Ga0466964_0328069 3300044706 Bacteria 780
365 Ga0466971_0022311 3300044719 Bacteria 2820
366 Ga0466971_0301304 3300044719 Bacteria 770
367 Ga0466968_0125736 3300044735 Bacteria 1163
368 Ga0466970_0006804 3300044765 Bacteria 5723
369 Ga0466970_0058683 3300044765 Bacteria 2060
370 Ga0466970_0099349 3300044765 Bacteria 1584
371 Ga0466957_0015353 3300044842 Bacteria 4474
372 Ga0466957_0083215 3300044842 Bacteria 1996
373 Ga0466957_0446101 3300044842 Bacteria 891
374 Ga0466960_0000120 3300044901 Bacteria 25889
375 Ga0466960_0012290 3300044901 Bacteria 3608
376 Ga0466960_0103091 3300044901 Bacteria 1472
377 Ga0466960_0127533 3300044901 Bacteria 1339
378 Ga0466959_0000441 3300045049 Bacteria 24148
379 Ga0466959_0014448 3300045049 Bacteria 5737
380 Ga0466959_0032069 3300045049 Bacteria 3889
381 Ga0466959_0129649 3300045049 Bacteria 1788
382 Ga0451576_0191963 3300045051 Bacteria 2133
383 Ga0466958_0001809 3300045836 Bacteria 10374
384 Ga0466958_0004886 3300045836 Bacteria 7137
385 Ga0466958_0015567 3300045836 Bacteria 4360
386 Ga0466958_0090740 3300045836 Bacteria 1891
387 Ga0466958_0108950 3300045836 Bacteria 1728
388 Ga0466958_0185989 3300045836 Bacteria 1319
389 Ga0466958_0239090 3300045836 Bacteria 1160
390 Ga0466967_0001365 3300045976 Bacteria 14053
391 Ga0466967_0005333 3300045976 Bacteria 8884
392 Ga0466967_0016509 3300045976 Bacteria 5826
393 Ga0466967_0022518 3300045976 Bacteria 5143
394 Ga0466967_0053735 3300045976 Bacteria 3541
395 Ga0466967_0083140 3300045976 Bacteria 2895
396 Ga0466967_0167493 3300045976 Bacteria 2065
397 Ga0466967_0294206 3300045976 Bacteria 1560
398 Ga0466967_0414884 3300045976 Bacteria 1311
399 Ga0466967_0750865 3300045976 Bacteria 967
400 Ga0466967_1106236 3300045976 Bacteria 789
401 Ga0495592_0000166 3300046454 Bacteria 58865
402 Ga0495592_0004310 3300046454 Bacteria 10406
403 Ga0495629_0006157 3300046459 Bacteria 8907
404 Ga0495629_0033605 3300046459 Bacteria 3627
405 Ga0495651_0000067 3300046462 Bacteria 76665
406 Ga0495651_0070045 3300046462 Bacteria 2669
407 Ga0495653_0113235 3300046463 Bacteria 1946
408 Ga0495582_0030812 3300046473 Bacteria 2946
409 Ga0495605_0058987 3300046474 Bacteria 1844
410 Ga0495664_0150819 3300046477 Bacteria 1410
411 Ga0495594_0020552 3300046499 Bacteria 3517
412 Ga0495608_0000095 3300046511 Bacteria 64067
413 Ga0495608_0103830 3300046511 Bacteria 1831
414 Ga0495618_0178112 3300046514 Bacteria 1351
415 Ga0495618_0439965 3300046514 Bacteria 792
416 Ga0495628_0000226 3300046516 Bacteria 49494
417 Ga0495628_0373760 3300046516 Bacteria 1045
418 Ga0495666_0079533 3300046526 Bacteria 1552
419 Ga0495652_0000337 3300046529 Bacteria 55658
420 Ga0495652_0173890 3300046529 Bacteria 1660
421 Ga0495640_0003462 3300046533 Bacteria 12706
422 Ga0495587_0000078 3300046536 Bacteria 76639
423 Ga0495587_0099024 3300046536 Bacteria 1681
424 Ga0495645_0482667 3300046543 Bacteria 777
425 Ga0495667_0000122 3300046559 Bacteria 56141
426 Ga0495667_0094374 3300046559 Bacteria 1937
427 Ga0495667_0276831 3300046559 Bacteria 1065
428 Ga0495634_0005184 3300046642 Bacteria 10065
429 Ga0495634_0027061 3300046642 Bacteria 3994
430 Ga0495657_0000098 3300046675 Bacteria 76618
431 Ga0495657_0002708 3300046675 Bacteria 14785
432 Ga0495599_0000115 3300046678 Bacteria 53313
433 Ga0495599_0233241 3300046678 Bacteria 1123
434 Ga0495623_0000184 3300046679 Bacteria 39482
435 Ga0495646_0008267 3300046680 Bacteria 6615
436 Ga0495646_0018401 3300046680 Bacteria 4425
437 Ga0495613_0005390 3300046689 Bacteria 9610
438 Ga0495613_0008899 3300046689 Bacteria 7449
439 Ga0495613_0384914 3300046689 Bacteria 959
440 Ga0495624_0171022 3300046690 Bacteria 1325
441 Ga0495600_0209221 3300046809 Bacteria 1250
442 Ga0495581_0043491 3300047315 Bacteria 2598
443 Ga0495604_0000142 3300047317 Bacteria 61620
444 Ga0495674_0010720 3300047319 Bacteria 8669
445 Ga0495674_0081970 3300047319 Bacteria 2766
446 Ga0495674_0096671 3300047319 Bacteria 2517
447 Ga0495676_0004939 3300047321 Bacteria 12228
448 Ga0495676_0222679 3300047321 Bacteria 1299
449 Ga0495680_0000111 3300047322 Bacteria 76638
450 Ga0495680_0221835 3300047322 Bacteria 1349
451 Ga0495675_0000833 3300047444 Bacteria 18831
452 Ga0495684_0053954 3300047471 Bacteria 3066
453 Ga0495593_0047861 3300047673 Bacteria 2273
454 Ga0495602_0000686 3300048088 Bacteria 31781
455 Ga0496100_0011062 3300048903 Bacteria 5121
456 Ga0496100_0315803 3300048903 Bacteria 1172
457 Ga0496101_0032185 3300048904 Bacteria 3689
458 Ga0496101_0036962 3300048904 Bacteria 3461
459 Ga0496101_0088937 3300048904 Bacteria 2294
460 Ga0496101_0101496 3300048904 Bacteria 2154
461 Ga0496102_0011254 3300048905 Bacteria 7708
462 Ga0496102_0024724 3300048905 Bacteria 5342
463 Ga0496103_0014675 3300048906 Bacteria 4655
464 Ga0496103_0243209 3300048906 Bacteria 1158
465 Ga0496103_0243304 3300048906 Bacteria 1157
466 Ga0496103_0313043 3300048906 Bacteria 1010
467 Ga0496104_0007732 3300048907 Bacteria 9520
468 Ga0496104_0027003 3300048907 Bacteria 5308
469 Ga0496104_0076373 3300048907 Bacteria 3191
470 Ga0496105_0011378 3300048908 Bacteria 7029
471 Ga0496105_0017151 3300048908 Bacteria 5799
472 Ga0496106_0002651 3300048909 Bacteria 13317
473 Ga0496106_0009576 3300048909 Bacteria 7153
474 Ga0496106_0028912 3300048909 Bacteria 4130
475 Ga0496107_0008123 3300048910 Bacteria 7255
476 Ga0496107_0009492 3300048910 Bacteria 6748
477 Ga0496107_0013570 3300048910 Bacteria 5696
478 Ga0496107_0178109 3300048910 Bacteria 1578
479 Ga0496108_0000493 3300048911 Bacteria 31469
480 Ga0496108_0033427 3300048911 Bacteria 4273
481 Ga0496108_0243976 3300048911 Bacteria 1563
482 Ga0496109_0005896 3300048912 Bacteria 10277
483 Ga0496109_0038683 3300048912 Bacteria 4313
484 Ga0496109_0278072 3300048912 Bacteria 1578
485 Ga0496109_0389934 3300048912 Bacteria 1316
486 Ga0496110_0040185 3300048913 Bacteria 4076
487 Ga0496110_0343272 3300048913 Bacteria 1360
488 Ga0496111_0154569 3300048914 Bacteria 1702
489 Ga0496111_0279980 3300048914 Bacteria 1237
490 Ga0496112_0031489 3300048915 Bacteria 5146
491 Ga0496112_0061134 3300048915 Bacteria 3713
492 Ga0496112_0091504 3300048915 Bacteria 3011
493 Ga0496112_0104746 3300048915 Bacteria 2799
494 Ga0496112_0154379 3300048915 Bacteria 2263
495 Ga0496112_0169836 3300048915 Bacteria 2146
496 Ga0496112_0186092 3300048915 Bacteria 2040
497 Ga0496112_0249041 3300048915 Bacteria 1728
498 Ga0496112_0385797 3300048915 Bacteria 1341
499 Ga0496113_0064604 3300048916 Bacteria 2767
500 Ga0496113_0174127 3300048916 Bacteria 1705
501 Ga0496113_0175330 3300048916 Bacteria 1699
502 Ga0496113_0382414 3300048916 Bacteria 1130
503 Ga0496114_0023250 3300048917 Bacteria 5057
504 Ga0496114_0247724 3300048917 Bacteria 1567
505 Ga0496115_0007166 3300048918 Bacteria 8187
506 Ga0496115_0147431 3300048918 Bacteria 1942
507 Ga0496115_0376657 3300048918 Bacteria 1155
508 Ga0496121_0021901 3300048924 Bacteria 6237
509 Ga0496122_0146439 3300048925 Bacteria 1467
510 Ga0501047_0042514 3300049581 Bacteria 4391
511 Ga0501067_0026380 3300049583 Bacteria 3218
512 Ga0501069_0000302 3300049585 Bacteria 22415
513 Ga0501069_0075769 3300049585 Bacteria 1890
514 Ga0501069_0120219 3300049585 Bacteria 1500
515 Ga0501070_0000001 3300049586 Bacteria 519187
516 Ga0501074_0335627 3300049590 Bacteria 1073
517 Ga0501079_0234174 3300049741 Bacteria 1435
518 Ga0501080_0021436 3300049742 Bacteria 5981
519 Ga0501080_0209879 3300049742 Bacteria 1785
520 Ga0501035_0146092 3300049822 Bacteria 2054
521 Ga0501044_0001172 3300049823 Bacteria 31088
522 Ga0501044_0084029 3300049823 Bacteria 3218
523 Ga0501045_0237905 3300049824 Bacteria 1356
524 nmdc:mga00v17_2084_c1 3300050491 Bacteria 10291
525 nmdc:mga05p37_15992_c1 3300050507 Bacteria 9028
526 nmdc:mga05p37_232581_c1 3300050507 Bacteria 2220
527 nmdc:mga05p37_25563_c1 3300050507 Bacteria 7183
528 nmdc:mga05p37_313749_c1 3300050507 Bacteria 1858
529 nmdc:mga05p37_652881_c1 3300050507 Bacteria 1178
530 nmdc:mga05p37_699283_c1 3300050507 Bacteria 1126
531 nmdc:mga06r32_119395_c1 3300050510 Bacteria 2600
532 nmdc:mga06r32_6290_c1 3300050510 Bacteria 10664
533 nmdc:mga08y16_122105_c1 3300050511 Bacteria 2711
534 nmdc:mga08y16_297948_c1 3300050511 Bacteria 1663
535 nmdc:mga08y16_70426_c1 3300050511 Bacteria 3646
536 nmdc:mga0n895_105201_c1 3300050512 Bacteria 2835
537 nmdc:mga0n895_109123_c1 3300050512 Bacteria 2783
538 nmdc:mga0n895_16635_c1 3300050512 Bacteria 6755
539 nmdc:mga0n895_167420_c1 3300050512 Bacteria 2230
540 nmdc:mga0n895_534895_c1 3300050512 Bacteria 1179
541 nmdc:mga0n895_53632_c1 3300050512 Bacteria 3962
542 nmdc:mga0n895_60535_c1 3300050512 Bacteria 3736
543 nmdc:mga0rr50_143229_c1 3300050513 Bacteria 1925
544 nmdc:mga0rr50_174266_c1 3300050513 Bacteria 1755
545 nmdc:mga0rr50_195055_c1 3300050513 Bacteria 1662
546 nmdc:mga0rr50_252350_c1 3300050513 Bacteria 1466
547 nmdc:mga08x19_12195_c1 3300050514 Bacteria 5174
548 nmdc:mga08x19_19318_c1 3300050514 Bacteria 4180
549 nmdc:mga08x19_6432_c1 3300050514 Bacteria 6957
550 nmdc:mga08x19_82866_c1 3300050514 Bacteria 2108
551 nmdc:mga0a205_101107_c1 3300050515 Bacteria 2782
552 nmdc:mga0a205_92918_c2 3300050515 Bacteria 889
553 nmdc:mga0a205_9742_c1 3300050515 Bacteria 8802
554 Ga0495601_0004601 3300053077 Bacteria 7984
555 Ga0495601_0101685 3300053077 Bacteria 1857
556 Ga0495601_0115512 3300053077 Bacteria 1740
557 Ga0495595_0010758 3300053084 Bacteria 3811
558 Ga0495595_0144172 3300053084 Bacteria 1170
559 Ga0495595_0226933 3300053084 Bacteria 932
560 Ga0495619_0228993 3300053085 Bacteria 1287
561 Ga0500556_0000473 3300053104 Bacteria 28229
562 Ga0500559_0021411 3300053136 Bacteria 2740
563 Ga0500616_0007064 3300053153 Bacteria 7204
564 Ga0501084_0015791 3300054114 Bacteria 6262
565 Ga0466962_0018576 3300061719 Bacteria 3344
566 Ga0466962_0091451 3300061719 Bacteria 1458
567 2559424113 2558860280 Bacteria 11429938
568 2799184498 2799112218 Bacteria 4315149
569 2812353791 2811994879 Bacteria 9313447
570 2842136918 2842134933 Bacteria 5847019
571 2867431672 2867428634 Bacteria 9590268
572 2891332324 2891326441 Bacteria 6439512
573 2902813509 2902810491 Bacteria 6794147
574 2946071906 2946064051 Bacteria 8957905
575 2990088891 2990088156 Bacteria 6657676
576 2995464050 2995463766 Bacteria 8577691
577 8047712810 8047710418 Bacteria 11023148
578 Ga0075434_100003052
579 JGI24740J21852_10053412
580 JGI24739J22299_10062820
581 JGI24737J22298_10041495
582 rootH1_10290883
583 JGI25407J50210_10016693
584 Ga0070683_100119908
585 Ga0070683_100216460
586 Ga0070690_100066730
587 Ga0070666_10090015
588 Ga0070666_10356874
589 Ga0070682_100154340
590 Ga0068868_100215133
591 Ga0070689_100445096
592 Ga0070675_100167127
593 Ga0070671_100197513
594 Ga0070671_100423047
595 Ga0070673_100119538
596 Ga0070688_100054510
597 Ga0070667_100486541
598 Ga0070709_10086754
599 Ga0070709_10397344
600 Ga0070714_100011770
601 Ga0070714_100058757
602 Ga0070714_100098822
603 Ga0070714_100104496
604 Ga0070714_100107099
605 Ga0070714_100409112
606 Ga0070713_100076462
607 Ga0070713_100134114
608 Ga0070713_100175169
609 Ga0070710_10171374
610 Ga0070711_100039060
611 Ga0070705_100172069
612 Ga0070705_100404247
613 Ga0070694_100013222
614 Ga0070694_100234269
615 Ga0070708_100002568
616 Ga0070708_100041614
617 Ga0070663_100205994
618 Ga0070678_100000829
619 Ga0070678_100006720
620 Ga0070678_100081543
621 Ga0070681_10027583
622 Ga0070706_100002130
623 Ga0070706_100069427
624 Ga0070706_100344891
625 Ga0070706_100402926
626 Ga0070707_100009600
627 Ga0070698_100002524
628 Ga0070698_100017769
629 Ga0070698_100021394
630 Ga0070699_100155075
631 Ga0070699_100257234
632 Ga0070699_100844823
633 Ga0070679_100194519
634 Ga0070684_100014845
635 Ga0070684_100449671
636 Ga0070697_100077052
637 Ga0070697_100417837
638 Ga0070686_100182048
639 Ga0070695_100193961
640 Ga0070696_100010205
641 Ga0070665_100865513
642 Ga0070704_100178463
643 Ga0068855_100196958
644 Ga0068855_100280206
645 Ga0068857_100292333
646 Ga0068854_100108419
647 Ga0068856_100172238
648 Ga0068856_100187210
649 Ga0068856_100292576
650 Ga0068856_100836030
651 Ga0070702_100001599
652 Ga0070702_100033290
653 Ga0070702_100268160
654 Ga0068852_100026858
655 Ga0068859_100035423
656 Ga0068864_100031440
657 Ga0068864_100247040
658 Ga0068861_100155481
659 Ga0068861_100660436
660 Ga0068863_100222462
661 Ga0068858_100097594
662 Ga0081455_10000239
663 Ga0081455_10030930
664 Ga0081538_10001690
665 Ga0081538_10008143
666 Ga0081539_10020148
667 Ga0070717_10007315
668 Ga0070717_10019348
669 Ga0070717_10375939
670 Ga0075365_10003918
671 Ga0075364_10008666
672 Ga0075432_10039381
673 Ga0070715_10045237
674 Ga0070715_10060522
675 Ga0070716_100008653
676 Ga0070712_100009938
677 Ga0070712_100129008
678 Ga0070712_100151831
679 Ga0070712_100244241
680 Ga0097621_100018088
681 Ga0075428_100050230
682 Ga0075428_100105644
683 Ga0075428_100284063
684 Ga0075431_100047096
685 Ga0075431_100091455
686 Ga0075433_10041098
687 Ga0075433_10206504
688 Ga0075433_10315048
689 Ga0075434_100192619
690 Ga0075434_100414282
691 Ga0075434_100495129
692 Ga0075434_100644756
693 Ga0075436_100004941
694 Ga0075436_100004998
695 Ga0075436_100014416
696 Ga0075436_100045063
697 Ga0075436_100149460
698 Ga0097620_100035420
699 Ga0075435_100053652
700 Ga0075435_100099894
701 Ga0075435_100317360
702 Ga0105240_10127812
703 Ga0105240_10130838
704 Ga0105240_10246209
705 Ga0105240_10820640
706 Ga0111539_10077573
707 Ga0111539_10158959
708 Ga0111539_10182446
709 Ga0111539_10951123
710 Ga0105245_10117845
711 Ga0105245_10427632
712 Ga0105247_10082034
713 Ga0114129_10012458
714 Ga0114129_10051420
715 Ga0114129_10061278
716 Ga0114129_10329796
717 Ga0114129_10373519
718 Ga0114129_10961820
719 Ga0105243_10093753
720 Ga0105243_10497719
721 Ga0105241_10014308
722 Ga0105241_10086065
723 Ga0105241_10288035
724 Ga0105242_10270075
725 Ga0105242_10446854
726 Ga0105237_10006472
727 Ga0105237_10305835
728 Ga0105238_10257957
729 Ga0105238_10558783
730 Ga0105249_10161575
731 Ga0105249_11030773
732 Ga0105239_10571024
733 Ga0157373_10043298
734 Ga0157369_10026251
735 Ga0157369_10521186
736 Ga0157369_10744364
737 Ga0157374_10011091
738 Ga0157374_10380528
739 Ga0157378_10000748
740 Ga0157378_10129460
741 Ga0163162_10097450
742 Ga0163162_10178704
743 Ga0157372_10289327
744 Ga0157372_10516366
745 Ga0157375_10072073
746 Ga0163163_10009475
747 Ga0157379_10026701
748 Ga0157376_10010594
749 Ga0197907_10286942
750 Ga0206350_10692687
751 Ga0206353_10916800
752 Ga0213876_10034983
753 Ga0224712_10022527
754 Ga0207692_10034358
755 Ga0207692_10264541
756 Ga0207688_10054874
757 Ga0207680_10249105
758 Ga0207680_10289023
759 Ga0207647_10202566
760 Ga0207685_10067726
761 Ga0207699_10319235
762 Ga0207705_10051775
763 Ga0207684_10002157
764 Ga0207684_10230362
765 Ga0207684_10296778
766 Ga0207684_10425658
767 Ga0207707_10007436
768 Ga0207695_10102045
769 Ga0207695_10116613
770 Ga0207693_10004161
771 Ga0207693_10007250
772 Ga0207693_10010770
773 Ga0207663_10017509
774 Ga0207663_10022461
775 Ga0207663_10032504
776 Ga0207663_10323751
777 Ga0207660_10350143
778 Ga0207652_10033748
779 Ga0207646_10000051
780 Ga0207646_10013700
781 Ga0207646_10390029
782 Ga0207659_10024288
783 Ga0207687_10039956
784 Ga0207700_10195085
785 Ga0207700_10284014
786 Ga0207700_10456020
787 Ga0207664_10217681
788 Ga0207664_10238974
789 Ga0207690_10238996
790 Ga0207686_10193497
791 Ga0207665_10003261
792 Ga0207665_10011004
793 Ga0207665_10042113
794 Ga0207691_10043035
795 Ga0207689_10067022
796 Ga0207661_10238531
797 Ga0207661_10391757
798 Ga0207661_10475693
799 Ga0207667_10207295
800 Ga0207651_10031715
801 Ga0207651_10040342
802 Ga0207712_10259712
803 Ga0207668_10082653
804 Ga0207668_10470577
805 Ga0207640_10311046
806 Ga0207658_10216754
807 Ga0207677_10375429
808 Ga0207703_10068963
809 Ga0207678_10026288
810 Ga0207678_10029184
811 Ga0207678_10048133
812 Ga0207708_10010625
813 Ga0207702_10192677
814 Ga0207641_10261005
815 Ga0207648_10428116
816 Ga0207676_10024761
817 Ga0207674_10165782
818 Ga0207674_10329649
819 Ga0207675_100295283
820 Ga0207675_100656871
821 Ga0207683_10000695
822 Ga0207683_10002135
823 Ga0207683_10165175
824 Ga0209998_10018793
825 Ga0207428_10028168
826 Ga0207428_10092658
827 Ga0268265_10294757
828 Ga0268264_10384724
829 Ga0265334_10042680
830 Ga0265338_10019520
831 Ga0265338_10297504
832 Ga0307511_10000059
833 Ga0265320_10022518
834 Ga0265325_10031210
835 Ga0265331_10095702
836 Ga0265316_10036952
837 Ga0307513_10074556
838 Ga0307408_100053933
839 Ga0307408_100248053
840 Ga0265313_10017729
841 Ga0307508_10188161
842 Ga0265314_10039717
843 Ga0307410_10060183
844 Ga0307409_100113342
845 Ga0307416_101029009
846 Ga0307414_10243209
847 Ga0307510_10095564
848 Ga0373948_0009949
849 Ga0373958_0010554
850 Ga0373938_0010132
851 Ga0373928_0001507
852 Ga0373929_0010805
853 Ga0373940_0017992
854 Ga0373949_0010220
855 Ga0373951_0000965
856 Ga0373952_0001667
857 Ga0373923_0196913
858 Ga0373932_0002601
859 Ga0373939_0009827
860 Ga0373941_0001722
861 Ga0373941_0010193
862 Ga0373953_0000062
863 Ga0373956_0000061
864 Ga0373957_0000042
865 Ga0373960_0000888
866 Ga0373955_0000106
867 Ga0373962_0001812
868 Ga0373924_0000794
869 Ga0373931_0010730
870 Ga0373931_0050412
871 Ga0373933_0000046
872 Ga0373937_0000115
873 Ga0373937_0791927
874 Ga0373925_0146684
875 Ga0373925_0375268
876 Ga0395899_0001671
877 Ga0395899_0012342
878 Ga0395899_0114245
879 Ga0395899_0159275
880 Ga0395899_0345387
881 Ga0395900_0004632
882 Ga0395900_0022529
883 Ga0395900_0061243
884 Ga0395900_0176668
885 Ga0395900_0220218
886 Ga0395900_0319292
887 Ga0395900_0502938
888 Ga0395900_0572327
889 Ga0395900_0619395
890 Ga0395898_0005144
891 Ga0395898_0014039
892 Ga0395898_0020510
893 Ga0395898_0140161
894 Ga0395898_0181953
895 Ga0395905_0003225
896 Ga0395905_0005706
897 Ga0395905_0042603
898 Ga0395905_0057957
899 Ga0395905_0137204
900 Ga0395901_0001805
901 Ga0395901_0074413
902 Ga0395901_0096226
903 Ga0395901_0195010
904 Ga0395901_0308493
905 Ga0395901_0397382
906 Ga0395901_0467943
907 Ga0395901_0568509
908 Ga0395901_0664696
909 Ga0242420_027052
910 Ga0436365_0179487
911 Ga0439448_0009792
912 Ga0439459_0006556
913 Ga0466969_0000788
914 Ga0466969_0008420
915 Ga0466969_0008861
916 Ga0466972_0005531
917 Ga0466972_0006071
918 Ga0466965_0001950
919 Ga0466965_0033560
920 Ga0466965_0044118
921 Ga0466965_0076161
922 Ga0466965_0118547
923 Ga0466965_0183179
924 Ga0466966_0000652
925 Ga0466966_0023203
926 Ga0466966_0077138
927 Ga0466966_0419163
928 Ga0466961_0001821
929 Ga0466961_0040352
930 Ga0466961_0058392
931 Ga0466963_0001564
932 Ga0466963_0046034
933 Ga0466963_0076882
934 Ga0466963_0107722
935 Ga0466963_0142032
936 Ga0466963_0263784
937 Ga0466963_0300867
938 Ga0466963_0537583
939 Ga0466964_0003572
940 Ga0466964_0037629
941 Ga0466964_0328069
942 Ga0466971_0022311
943 Ga0466971_0301304
944 Ga0466968_0125736
945 Ga0466970_0006804
946 Ga0466970_0058683
947 Ga0466970_0099349
948 Ga0466957_0015353
949 Ga0466957_0083215
950 Ga0466957_0446101
951 Ga0466960_0000120
952 Ga0466960_0012290
953 Ga0466960_0103091
954 Ga0466960_0127533
955 Ga0466959_0000441
956 Ga0466959_0014448
957 Ga0466959_0032069
958 Ga0466959_0129649
959 Ga0451576_0191963
960 Ga0466958_0001809
961 Ga0466958_0004886
962 Ga0466958_0015567
963 Ga0466958_0090740
964 Ga0466958_0108950
965 Ga0466958_0185989
966 Ga0466958_0239090
967 Ga0466967_0001365
968 Ga0466967_0005333
969 Ga0466967_0016509
970 Ga0466967_0022518
971 Ga0466967_0053735
972 Ga0466967_0083140
973 Ga0466967_0167493
974 Ga0466967_0294206
975 Ga0466967_0414884
976 Ga0466967_0750865
977 Ga0466967_1106236
978 Ga0495592_0000166
979 Ga0495592_0004310
980 Ga0495629_0006157
981 Ga0495629_0033605
982 Ga0495651_0000067
983 Ga0495651_0070045
984 Ga0495653_0113235
985 Ga0495582_0030812
986 Ga0495605_0058987
987 Ga0495664_0150819
988 Ga0495594_0020552
989 Ga0495608_0000095
990 Ga0495608_0103830
991 Ga0495618_0178112
992 Ga0495618_0439965
993 Ga0495628_0000226
994 Ga0495628_0373760
995 Ga0495666_0079533
996 Ga0495652_0000337
997 Ga0495652_0173890
998 Ga0495640_0003462
999 Ga0495587_0000078
1000 Ga0495587_0099024
1001 Ga0495645_0482667
1002 Ga0495667_0000122
1003 Ga0495667_0094374
1004 Ga0495667_0276831
1005 Ga0495634_0005184
1006 Ga0495634_0027061
1007 Ga0495657_0000098
1008 Ga0495657_0002708
1009 Ga0495599_0000115
1010 Ga0495599_0233241
1011 Ga0495623_0000184
1012 Ga0495646_0008267
1013 Ga0495646_0018401
1014 Ga0495613_0005390
1015 Ga0495613_0008899
1016 Ga0495613_0384914
1017 Ga0495624_0171022
1018 Ga0495600_0209221
1019 Ga0495581_0043491
1020 Ga0495604_0000142
1021 Ga0495674_0010720
1022 Ga0495674_0081970
1023 Ga0495674_0096671
1024 Ga0495676_0004939
1025 Ga0495676_0222679
1026 Ga0495680_0000111
1027 Ga0495680_0221835
1028 Ga0495675_0000833
1029 Ga0495684_0053954
1030 Ga0495593_0047861
1031 Ga0495602_0000686
1032 Ga0496100_0011062
1033 Ga0496100_0315803
1034 Ga0496101_0032185
1035 Ga0496101_0036962
1036 Ga0496101_0088937
1037 Ga0496101_0101496
1038 Ga0496102_0011254
1039 Ga0496102_0024724
1040 Ga0496103_0014675
1041 Ga0496103_0243209
1042 Ga0496103_0243304
1043 Ga0496103_0313043
1044 Ga0496104_0007732
1045 Ga0496104_0027003
1046 Ga0496104_0076373
1047 Ga0496105_0011378
1048 Ga0496105_0017151
1049 Ga0496106_0002651
1050 Ga0496106_0009576
1051 Ga0496106_0028912
1052 Ga0496107_0008123
1053 Ga0496107_0009492
1054 Ga0496107_0013570
1055 Ga0496107_0178109
1056 Ga0496108_0000493
1057 Ga0496108_0033427
1058 Ga0496108_0243976
1059 Ga0496109_0005896
1060 Ga0496109_0038683
1061 Ga0496109_0278072
1062 Ga0496109_0389934
1063 Ga0496110_0040185
1064 Ga0496110_0343272
1065 Ga0496111_0154569
1066 Ga0496111_0279980
1067 Ga0496112_0031489
1068 Ga0496112_0061134
1069 Ga0496112_0091504
1070 Ga0496112_0104746
1071 Ga0496112_0154379
1072 Ga0496112_0169836
1073 Ga0496112_0186092
1074 Ga0496112_0249041
1075 Ga0496112_0385797
1076 Ga0496113_0064604
1077 Ga0496113_0174127
1078 Ga0496113_0175330
1079 Ga0496113_0382414
1080 Ga0496114_0023250
1081 Ga0496114_0247724
1082 Ga0496115_0007166
1083 Ga0496115_0147431
1084 Ga0496115_0376657
1085 Ga0496121_0021901
1086 Ga0496122_0146439
1087 Ga0501047_0042514
1088 Ga0501067_0026380
1089 Ga0501069_0000302
1090 Ga0501069_0075769
1091 Ga0501069_0120219
1092 Ga0501070_0000001
1093 Ga0501074_0335627
1094 Ga0501079_0234174
1095 Ga0501080_0021436
1096 Ga0501080_0209879
1097 Ga0501035_0146092
1098 Ga0501044_0001172
1099 Ga0501044_0084029
1100 Ga0501045_0237905
1101 nmdc:mga00v17_2084_c1
1102 nmdc:mga05p37_15992_c1
1103 nmdc:mga05p37_232581_c1
1104 nmdc:mga05p37_25563_c1
1105 nmdc:mga05p37_313749_c1
1106 nmdc:mga05p37_652881_c1
1107 nmdc:mga05p37_699283_c1
1108 nmdc:mga06r32_119395_c1
1109 nmdc:mga06r32_6290_c1
1110 nmdc:mga08y16_122105_c1
1111 nmdc:mga08y16_297948_c1
1112 nmdc:mga08y16_70426_c1
1113 nmdc:mga0n895_105201_c1
1114 nmdc:mga0n895_109123_c1
1115 nmdc:mga0n895_16635_c1
1116 nmdc:mga0n895_167420_c1
1117 nmdc:mga0n895_534895_c1
1118 nmdc:mga0n895_53632_c1
1119 nmdc:mga0n895_60535_c1
1120 nmdc:mga0rr50_143229_c1
1121 nmdc:mga0rr50_174266_c1
1122 nmdc:mga0rr50_195055_c1
1123 nmdc:mga0rr50_252350_c1
1124 nmdc:mga08x19_12195_c1
1125 nmdc:mga08x19_19318_c1
1126 nmdc:mga08x19_6432_c1
1127 nmdc:mga08x19_82866_c1
1128 nmdc:mga0a205_101107_c1
1129 nmdc:mga0a205_92918_c2
1130 nmdc:mga0a205_9742_c1
1131 Ga0495601_0004601
1132 Ga0495601_0101685
1133 Ga0495601_0115512
1134 Ga0495595_0010758
1135 Ga0495595_0144172
1136 Ga0495595_0226933
1137 Ga0495619_0228993
1138 Ga0500556_0000473
1139 Ga0500559_0021411
1140 Ga0500616_0007064
1141 Ga0501084_0015791
1142 Ga0466962_0018576
1143 Ga0466962_0091451
1144 2559424113
1145 2799184498
1146 2812353791
1147 2842136918
1148 2867431672
1149 2891332324
1150 2902813509
1151 2946071906
1152 2990088891
1153 2995464050
1154 8047712810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

128

254

0.87

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

45

249

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h5s-assembly1.cif.gz_A crystal structure of rv3400 from mycobacterium tuberculosis 0.9676 1 243
8h5s-assembly1.cif.gz_A crystal structure of rv3400 from mycobacterium tuberculosis 0.9485 1 243
7ocq-assembly1.cif.gz_B nadh bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8819 7 244
7ocr-assembly1.cif.gz_B nadph and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii 0.8763 8 244
7ocu-assembly1.cif.gz_B mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-n374a from acinetobacter baumannii 0.8753 7 244
ID Description Score Start End Superfamily
af_Q4CSI4_580_667_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9362 117 193 3.40.50.1000
4gibB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.936 121 243 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9299 117 219 3.40.50.1000
3nasA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.923 121 242 3.40.50.1000
4g9bA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.922 121 243 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A535KBW4-F1-model_v4 HAD family hydrolase 1.007 179 244 GO:0050308
AF-A0A2S8BJ31-F1-model_v4 Trehalose-phosphate phosphatase (EC 3.1.3.12) 1.004 166 243 GO:0004805
AF-A0A6A0CTZ3-F1-model_v4 deleted 0.9978 119 243
AF-A0A7V9AED5-F1-model_v4 HAD-IA family hydrolase 0.9978 162 243 GO:0050308
AF-A0A655AQY5-F1-model_v4 Hydrolase (EC 3.-.-.-, EC 3.1.3.-) 0.9947 137 243 GO:0016787

Map