F465582

General Info

Members Datasets Scaffolds Average Seq Length
577 258 1154 158

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10102982|Ga0070692_101029821
Length 175
Sequence MSLPGNKGCRPSDVTPWERRADAVLGIAASALLFGMMVLTFFDVVGRYLLNRPIRGAFEITELGLLVLIFAGLPLVSHADEHVTMDFIDRMLPARAVPVLIRVVHAFVAAVFFFLTWQVLIKAARISAYGDTTDVLRIAVGPFVYFMAAMIFLSGLVHLFKVFVPGARRAAQATT

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
167 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.17
Rhizosphere 99.83
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10102982 3300005345 Bacteria 1568
2 Ga0065704_10475648 3300005289 Bacteria 686
3 Ga0065715_10175301 3300005293 Bacteria 1516
4 Ga0065707_10174308 3300005295 Bacteria 1462
5 Ga0065707_10328508 3300005295 Bacteria 948
6 Ga0065707_10509960 3300005295 Bacteria 747
7 Ga0070683_100082542 3300005329 Bacteria 3010
8 Ga0070690_100011115 3300005330 Bacteria 5257
9 Ga0070690_100182567 3300005330 Bacteria 1450
10 Ga0068869_100476581 3300005334 Bacteria 1038
11 Ga0070680_100054143 3300005336 Bacteria 3275
12 Ga0070680_100074854 3300005336 Bacteria 2787
13 Ga0070680_100099424 3300005336 Bacteria 2414
14 Ga0070680_100212393 3300005336 Bacteria 1633
15 Ga0070660_101592697 3300005339 Unclassified 556
16 Ga0070689_100130917 3300005340 Bacteria 2012
17 Ga0070689_100146052 3300005340 Bacteria 1905
18 Ga0070689_100236976 3300005340 Bacteria 1502
19 Ga0070689_100341668 3300005340 Bacteria 1254
20 Ga0070689_100983637 3300005340 Bacteria 750
21 Ga0070691_10000874 3300005341 Bacteria 12209
22 Ga0070691_10534526 3300005341 Bacteria 683
23 Ga0070687_100024385 3300005343 Bacteria 2887
24 Ga0070687_100251901 3300005343 Bacteria 1097
25 Ga0070692_10009393 3300005345 Bacteria 4409
26 Ga0070692_10012268 3300005345 Bacteria 3960
27 Ga0070692_10350117 3300005345 Bacteria 917
28 Ga0070669_100036800 3300005353 Bacteria 3548
29 Ga0070675_100165637 3300005354 Bacteria 1903
30 Ga0070675_101230097 3300005354 Bacteria 690
31 Ga0070671_101249720 3300005355 Bacteria 654
32 Ga0070671_101532628 3300005355 Bacteria 590
33 Ga0070674_100170069 3300005356 Bacteria 1661
34 Ga0070674_100564047 3300005356 Archaea 957
35 Ga0070673_100428837 3300005364 Bacteria 1186
36 Ga0070673_100496357 3300005364 Bacteria 1103
37 Ga0070688_100436245 3300005365 Bacteria 976
38 Ga0070703_10025638 3300005406 Bacteria 1750
39 Ga0070703_10050043 3300005406 Bacteria 1332
40 Ga0070703_10063425 3300005406 Unclassified 1215
41 Ga0070703_10184979 3300005406 Unclassified 807
42 Ga0070710_10357863 3300005437 Bacteria 968
43 Ga0070701_10011007 3300005438 Bacteria 4024
44 Ga0070701_10016989 3300005438 Bacteria 3394
45 Ga0070701_10025679 3300005438 Bacteria 2863
46 Ga0070701_10080218 3300005438 Bacteria 1765
47 Ga0070701_10542360 3300005438 Unclassified 762
48 Ga0070701_10709367 3300005438 Bacteria 677
49 Ga0070711_100161282 3300005439 Bacteria 1700
50 Ga0070705_100001344 3300005440 Bacteria 13123
51 Ga0070705_100137070 3300005440 Bacteria 1605
52 Ga0070705_100294767 3300005440 Bacteria 1159
53 Ga0070705_100624511 3300005440 Bacteria 837
54 Ga0070700_100031063 3300005441 Bacteria 3197
55 Ga0070700_100060774 3300005441 Bacteria 2382
56 Ga0070700_100146854 3300005441 Bacteria 1608
57 Ga0070700_100321205 3300005441 Bacteria 1137
58 Ga0070700_100717415 3300005441 Bacteria 797
59 Ga0070694_100002752 3300005444 Bacteria 10430
60 Ga0070694_100032957 3300005444 Bacteria 3404
61 Ga0070694_100055162 3300005444 Bacteria 2695
62 Ga0070694_100071199 3300005444 Bacteria 2396
63 Ga0070694_100137828 3300005444 Bacteria 1769
64 Ga0070694_100156922 3300005444 Bacteria 1666
65 Ga0070694_100204490 3300005444 Bacteria 1473
66 Ga0070694_100339072 3300005444 Bacteria 1161
67 Ga0070694_100936504 3300005444 Unclassified 716
68 Ga0070694_101566689 3300005444 Unclassified 558
69 Ga0070662_100253431 3300005457 Bacteria 1416
70 Ga0070681_10000615 3300005458 Bacteria 29209
71 Ga0070681_10328569 3300005458 Bacteria 1439
72 Ga0070681_10390302 3300005458 Bacteria 1303
73 Ga0068867_100009029 3300005459 Bacteria 7033
74 Ga0068867_100013766 3300005459 Bacteria 5727
75 Ga0070706_101167939 3300005467 Bacteria 708
76 Ga0070698_101495487 3300005471 Unclassified 627
77 Ga0070699_100083426 3300005518 Bacteria 2788
78 Ga0070699_100222168 3300005518 Bacteria 1683
79 Ga0070699_100256669 3300005518 Bacteria 1563
80 Ga0070699_100526812 3300005518 Bacteria 1075
81 Ga0070679_100405178 3300005530 Bacteria 1309
82 Ga0070679_100740350 3300005530 Bacteria 926
83 Ga0070684_100273381 3300005535 Bacteria 1547
84 Ga0070697_100004383 3300005536 Bacteria 10834
85 Ga0070697_100279786 3300005536 Bacteria 1431
86 Ga0070697_100408795 3300005536 Bacteria 1178
87 Ga0070697_100628432 3300005536 Unclassified 945
88 Ga0068853_100775947 3300005539 Bacteria 917
89 Ga0070672_100508643 3300005543 Bacteria 1042
90 Ga0070672_100636317 3300005543 Bacteria 931
91 Ga0070686_100622596 3300005544 Unclassified 853
92 Ga0070695_100001112 3300005545 Bacteria 14731
93 Ga0070695_100015012 3300005545 Bacteria 4673
94 Ga0070695_100023983 3300005545 Bacteria 3755
95 Ga0070695_100062033 3300005545 Bacteria 2427
96 Ga0070695_100115641 3300005545 Bacteria 1828
97 Ga0070695_100134280 3300005545 Bacteria 1709
98 Ga0070695_100163690 3300005545 Bacteria 1564
99 Ga0070695_100187494 3300005545 Bacteria 1470
100 Ga0070695_100203763 3300005545 Bacteria 1415
101 Ga0070695_100389591 3300005545 Bacteria 1053
102 Ga0070695_100397745 3300005545 Bacteria 1044
103 Ga0070696_100001385 3300005546 Bacteria 15850
104 Ga0070696_100003449 3300005546 Bacteria 10525
105 Ga0070696_100004740 3300005546 Bacteria 9091
106 Ga0070696_100082187 3300005546 Bacteria 2283
107 Ga0070696_100125960 3300005546 Bacteria 1858
108 Ga0070696_100203318 3300005546 Bacteria 1480
109 Ga0070696_100302253 3300005546 Bacteria 1226
110 Ga0070696_101357915 3300005546 Unclassified 605
111 Ga0070693_100000174 3300005547 Bacteria 29811
112 Ga0070693_100057357 3300005547 Bacteria 2251
113 Ga0070704_100001537 3300005549 Bacteria 12455
114 Ga0070704_100029506 3300005549 Bacteria 3664
115 Ga0070704_100046485 3300005549 Bacteria 3027
116 Ga0070704_100085984 3300005549 Bacteria 2329
117 Ga0070704_100147950 3300005549 Bacteria 1843
118 Ga0070704_100239944 3300005549 Bacteria 1483
119 Ga0070704_100279439 3300005549 Bacteria 1382
120 Ga0070704_100284713 3300005549 Bacteria 1371
121 Ga0070704_100328678 3300005549 Bacteria 1283
122 Ga0070704_100342429 3300005549 Bacteria 1259
123 Ga0070704_100358203 3300005549 Bacteria 1233
124 Ga0070704_101103457 3300005549 Bacteria 721
125 Ga0068855_100024277 3300005563 Bacteria 7258
126 Ga0068857_100018306 3300005577 Bacteria 6145
127 Ga0068857_100052669 3300005577 Bacteria 3610
128 Ga0068857_100428082 3300005577 Bacteria 1235
129 Ga0068854_100462344 3300005578 Bacteria 1062
130 Ga0068854_100863261 3300005578 Bacteria 793
131 Ga0068856_100632405 3300005614 Bacteria 1091
132 Ga0068856_101098004 3300005614 Bacteria 813
133 Ga0070702_100000064 3300005615 Bacteria 30037
134 Ga0068859_100017941 3300005617 Bacteria 7113
135 Ga0068859_100046350 3300005617 Bacteria 4366
136 Ga0068859_100113164 3300005617 Bacteria 2777
137 Ga0068859_100582415 3300005617 Bacteria 1213
138 Ga0068859_100652367 3300005617 Bacteria 1144
139 Ga0068864_100070723 3300005618 Bacteria 3036
140 Ga0068864_100186205 3300005618 Bacteria 1900
141 Ga0068866_10000766 3300005718 Bacteria 14492
142 Ga0068866_10058530 3300005718 Bacteria 1990
143 Ga0068861_100011356 3300005719 Bacteria 6187
144 Ga0068861_100042554 3300005719 Bacteria 3405
145 Ga0068861_101640101 3300005719 Bacteria 634
146 Ga0068870_10080305 3300005840 Bacteria 1802
147 Ga0068870_10670293 3300005840 Bacteria 712
148 Ga0068858_100167667 3300005842 Bacteria 2070
149 Ga0068860_100015309 3300005843 Bacteria 7491
150 Ga0068860_100122487 3300005843 Bacteria 2491
151 Ga0068860_100130115 3300005843 Bacteria 2414
152 Ga0068860_100958230 3300005843 Bacteria 873
153 Ga0068862_100051748 3300005844 Bacteria 3513
154 Ga0068862_100060092 3300005844 Bacteria 3264
155 Ga0068862_100241726 3300005844 Bacteria 1642
156 Ga0068862_100637630 3300005844 Bacteria 1026
157 Ga0081539_10000178 3300005985 Bacteria 149201
158 Ga0070716_100547678 3300006173 Bacteria 862
159 Ga0097621_100037682 3300006237 Bacteria 3877
160 Ga0068871_100007842 3300006358 Bacteria 7649
161 Ga0075428_100004106 3300006844 Bacteria 16026
162 Ga0075428_100053337 3300006844 Bacteria 4430
163 Ga0075428_100068989 3300006844 Bacteria 3867
164 Ga0075430_100311101 3300006846 Bacteria 1303
165 Ga0075430_100557181 3300006846 Bacteria 945
166 Ga0075430_101016564 3300006846 Bacteria 683
167 Ga0075431_100034715 3300006847 Bacteria 5196
168 Ga0075431_100255530 3300006847 Bacteria 1779
169 Ga0075431_100542078 3300006847 Bacteria 1151
170 Ga0075431_101281448 3300006847 Bacteria 694
171 Ga0075433_10011094 3300006852 Bacteria 7247
172 Ga0075433_10192185 3300006852 Bacteria 1816
173 Ga0075433_10743426 3300006852 Bacteria 858
174 Ga0075433_10984870 3300006852 Bacteria 735
175 Ga0075434_100069562 3300006871 Bacteria 3509
176 Ga0075434_100092158 3300006871 Bacteria 3032
177 Ga0075434_100488292 3300006871 Bacteria 1252
178 Ga0075434_100811582 3300006871 Bacteria 952
179 Ga0075429_100000470 3300006880 Bacteria 30046
180 Ga0075429_100014944 3300006880 Bacteria 6734
181 Ga0075429_100035249 3300006880 Bacteria 4351
182 Ga0075429_100615620 3300006880 Bacteria 951
183 Ga0068865_100002536 3300006881 Bacteria 10821
184 Ga0068865_100226343 3300006881 Bacteria 1465
185 Ga0068865_100390826 3300006881 Bacteria 1137
186 Ga0068865_100583691 3300006881 Bacteria 942
187 Ga0068865_100809686 3300006881 Unclassified 809
188 Ga0075436_100000353 3300006914 Bacteria 29366
189 Ga0075436_100001446 3300006914 Bacteria 16130
190 Ga0075436_100049788 3300006914 Bacteria 2891
191 Ga0075436_100067817 3300006914 Bacteria 2465
192 Ga0075436_100079542 3300006914 Bacteria 2271
193 Ga0075436_100213060 3300006914 Bacteria 1370
194 Ga0097620_100017939 3300006931 Bacteria 7113
195 Ga0097620_100046350 3300006931 Bacteria 4366
196 Ga0097620_100113165 3300006931 Bacteria 2777
197 Ga0097620_100582365 3300006931 Bacteria 1213
198 Ga0097620_100652382 3300006931 Bacteria 1144
199 Ga0075435_100000148 3300007076 Bacteria 39782
200 Ga0075435_100026928 3300007076 Bacteria 4492
201 Ga0075435_100029785 3300007076 Bacteria 4286
202 Ga0075435_100043532 3300007076 Bacteria 3594
203 Ga0075435_100302122 3300007076 Bacteria 1369
204 Ga0099794_10003816 3300007265 Bacteria 5820
205 Ga0099794_10088183 3300007265 Bacteria 1537
206 Ga0099794_10245160 3300007265 Bacteria 923
207 Ga0111539_10086342 3300009094 Bacteria 3687
208 Ga0111539_10143281 3300009094 Bacteria 2797
209 Ga0111539_10191206 3300009094 Bacteria 2388
210 Ga0111539_10231550 3300009094 Bacteria 2151
211 Ga0111539_10392941 3300009094 Bacteria 1615
212 Ga0111539_10549570 3300009094 Bacteria 1345
213 Ga0111539_10662420 3300009094 Bacteria 1215
214 Ga0114129_10000467 3300009147 Bacteria 48450
215 Ga0114129_10016956 3300009147 Bacteria 10369
216 Ga0114129_10020824 3300009147 Bacteria 9315
217 Ga0114129_10340745 3300009147 Bacteria 1988
218 Ga0114129_10555858 3300009147 Bacteria 1492
219 Ga0114129_11614831 3300009147 Bacteria 793
220 Ga0114129_11682689 3300009147 Unclassified 775
221 Ga0105243_10063549 3300009148 Bacteria 2958
222 Ga0105243_10065514 3300009148 Bacteria 2919
223 Ga0105243_10287127 3300009148 Bacteria 1485
224 Ga0105241_10144498 3300009174 Bacteria 1940
225 Ga0105242_10000524 3300009176 Bacteria 30157
226 Ga0105242_10011347 3300009176 Bacteria 6849
227 Ga0105242_10069341 3300009176 Bacteria 2920
228 Ga0105248_10345300 3300009177 Bacteria 1676
229 Ga0105248_10554675 3300009177 Bacteria 1296
230 Ga0105248_11859690 3300009177 Bacteria 683
231 Ga0105238_11579881 3300009551 Bacteria 686
232 Ga0105249_10018598 3300009553 Bacteria 6187
233 Ga0105249_10037736 3300009553 Bacteria 4384
234 Ga0105249_10040954 3300009553 Bacteria 4209
235 Ga0105249_10626666 3300009553 Bacteria 1132
236 Ga0105239_11350084 3300010375 Bacteria 823
237 Ga0105246_10794911 3300011119 Archaea 839
238 Ga0157369_11983051 3300013105 Bacteria 591
239 Ga0157378_11642246 3300013297 Bacteria 689
240 Ga0157378_11761860 3300013297 Unclassified 667
241 Ga0157378_11880252 3300013297 Bacteria 647
242 Ga0157375_10085879 3300013308 Bacteria 3197
243 Ga0157380_10084696 3300014326 Bacteria 2600
244 Ga0157380_10230413 3300014326 Bacteria 1663
245 Ga0157380_10678890 3300014326 Unclassified 1032
246 Ga0157380_11878523 3300014326 Bacteria 659
247 Ga0157377_10060595 3300014745 Bacteria 2161
248 Ga0157377_10080035 3300014745 Bacteria 1907
249 Ga0157379_10686274 3300014968 Unclassified 960
250 Ga0157379_10760938 3300014968 Bacteria 912
251 Ga0157376_10078012 3300014969 Bacteria 2835
252 Ga0157376_10502956 3300014969 Bacteria 1191
253 Ga0213871_10048910 3300021441 Unclassified 1154
254 Ga0207653_10041759 3300025885 Bacteria 1507
255 Ga0207642_10108818 3300025899 Bacteria 1407
256 Ga0207645_10225164 3300025907 Bacteria 1237
257 Ga0207643_10106622 3300025908 Bacteria 1647
258 Ga0207684_10106715 3300025910 Bacteria 2396
259 Ga0207684_10483516 3300025910 Bacteria 1062
260 Ga0207684_10661330 3300025910 Bacteria 890
261 Ga0207654_10104197 3300025911 Bacteria 1753
262 Ga0207654_10207781 3300025911 Bacteria 1292
263 Ga0207707_10001577 3300025912 Bacteria 21004
264 Ga0207707_10646732 3300025912 Bacteria 891
265 Ga0207663_10486453 3300025916 Bacteria 957
266 Ga0207660_10016601 3300025917 Bacteria 4877
267 Ga0207660_10066141 3300025917 Bacteria 2614
268 Ga0207662_10000674 3300025918 Bacteria 15520
269 Ga0207662_10103427 3300025918 Bacteria 1767
270 Ga0207662_10481226 3300025918 Unclassified 853
271 Ga0207652_10095130 3300025921 Bacteria 2624
272 Ga0207646_10253566 3300025922 Bacteria 1590
273 Ga0207646_10271531 3300025922 Bacteria 1533
274 Ga0207659_10910056 3300025926 Unclassified 756
275 Ga0207687_10092942 3300025927 Bacteria 2204
276 Ga0207687_10099124 3300025927 Bacteria 2141
277 Ga0207686_10081143 3300025934 Bacteria 2116
278 Ga0207709_10002341 3300025935 Bacteria 11961
279 Ga0207709_10141362 3300025935 Bacteria 1655
280 Ga0207670_10076942 3300025936 Bacteria 2323
281 Ga0207670_10255820 3300025936 Bacteria 1355
282 Ga0207670_10297373 3300025936 Bacteria 1263
283 Ga0207670_10661019 3300025936 Bacteria 862
284 Ga0207670_10731027 3300025936 Unclassified 821
285 Ga0207669_10075329 3300025937 Bacteria 2138
286 Ga0207704_10013852 3300025938 Bacteria 4052
287 Ga0207704_10263168 3300025938 Unclassified 1301
288 Ga0207704_10452745 3300025938 Bacteria 1025
289 Ga0207691_10657462 3300025940 Archaea 885
290 Ga0207689_10139628 3300025942 Bacteria 1996
291 Ga0207661_10439368 3300025944 Bacteria 1187
292 Ga0207661_11059257 3300025944 Bacteria 747
293 Ga0207712_10133411 3300025961 Bacteria 1896
294 Ga0207712_10382951 3300025961 Bacteria 1178
295 Ga0207712_10785921 3300025961 Bacteria 836
296 Ga0207712_10847106 3300025961 Bacteria 806
297 Ga0207640_11001789 3300025981 Bacteria 735
298 Ga0207703_10098177 3300026035 Bacteria 2476
299 Ga0207639_10335264 3300026041 Bacteria 1347
300 Ga0207708_10001613 3300026075 Bacteria 16809
301 Ga0207708_10014476 3300026075 Bacteria 5903
302 Ga0207708_10034570 3300026075 Bacteria 3844
303 Ga0207708_10246514 3300026075 Bacteria 1438
304 Ga0207708_10685329 3300026075 Bacteria 875
305 Ga0207702_10530021 3300026078 Bacteria 1150
306 Ga0207702_11328955 3300026078 Bacteria 713
307 Ga0207641_10292170 3300026088 Bacteria 1537
308 Ga0207648_10601857 3300026089 Bacteria 1013
309 Ga0207648_10910556 3300026089 Bacteria 822
310 Ga0207676_10136564 3300026095 Bacteria 2093
311 Ga0207676_11110473 3300026095 Unclassified 782
312 Ga0207674_10013493 3300026116 Bacteria 9062
313 Ga0207674_10064473 3300026116 Bacteria 3695
314 Ga0207674_10153528 3300026116 Bacteria 2259
315 Ga0207675_100000353 3300026118 Bacteria 43874
316 Ga0207675_100042109 3300026118 Bacteria 4263
317 Ga0209967_1002992 3300027364 Bacteria 2215
318 Ga0209967_1026400 3300027364 Bacteria 862
319 Ga0209981_1008733 3300027378 Bacteria 1376
320 Ga0210000_1024023 3300027462 Bacteria 939
321 Ga0209995_1027082 3300027471 Bacteria 956
322 Ga0209968_1013423 3300027526 Bacteria 1285
323 Ga0209999_1014760 3300027543 Bacteria 1419
324 Ga0209970_1002777 3300027614 Bacteria 2959
325 Ga0209588_1133737 3300027671 Unclassified 790
326 Ga0209971_1008333 3300027682 Bacteria 2456
327 Ga0209971_1112498 3300027682 Bacteria 668
328 Ga0209974_10005808 3300027876 Bacteria 4328
329 Ga0207428_10003226 3300027907 Bacteria 15924
330 Ga0207428_10029538 3300027907 Bacteria 4542
331 Ga0207428_10400432 3300027907 Bacteria 1005
332 Ga0268265_10010733 3300028380 Bacteria 6184
333 Ga0268265_10448761 3300028380 Bacteria 1204
334 Ga0268265_10943604 3300028380 Bacteria 849
335 Ga0268264_10045090 3300028381 Bacteria 3660
336 Ga0268264_10143762 3300028381 Bacteria 2130
337 Ga0268264_10611794 3300028381 Bacteria 1075
338 Ga0307408_100050167 3300031548 Bacteria 3000
339 Ga0307408_100454521 3300031548 Bacteria 1112
340 Ga0265314_10252117 3300031711 Bacteria 1013
341 Ga0307405_10379912 3300031731 Bacteria 1099
342 Ga0307405_11321943 3300031731 Unclassified 628
343 Ga0307407_10399987 3300031903 Bacteria 985
344 Ga0307412_10095961 3300031911 Bacteria 2086
345 Ga0307416_100036747 3300032002 Bacteria 3760
346 Ga0307416_100041401 3300032002 Bacteria 3588
347 Ga0307416_100101763 3300032002 Bacteria 2503
348 Ga0307416_100200614 3300032002 Bacteria 1892
349 Ga0307416_100739809 3300032002 Bacteria 1075
350 Ga0307416_102335362 3300032002 Unclassified 635
351 Ga0307411_10076730 3300032005 Bacteria 2285
352 Ga0307411_10216641 3300032005 Bacteria 1482
353 Ga0373948_0014817 3300034817 Bacteria 1425
354 Ga0373948_0053899 3300034817 Bacteria 870
355 Ga0373948_0057949 3300034817 Bacteria 845
356 Ga0373938_0026895 3300034957 Bacteria 1207
357 Ga0373940_0036273 3300035088 Bacteria 1338
358 Ga0373940_0133674 3300035088 Bacteria 779
359 Ga0373944_0016896 3300035089 Bacteria 2064
360 Ga0373949_0043538 3300035090 Bacteria 1111
361 Ga0373951_0019625 3300035091 Bacteria 1542
362 Ga0373952_0077124 3300035092 Bacteria 844
363 Ga0373923_0093436 3300035111 Unclassified 1319
364 Ga0373923_0107796 3300035111 Unclassified 1234
365 Ga0373932_0016739 3300035112 Bacteria 1874
366 Ga0373932_0082398 3300035112 Bacteria 1019
367 Ga0373936_0026113 3300035113 Bacteria 2286
368 Ga0373939_0012107 3300035114 Bacteria 2192
369 Ga0373941_0022693 3300035115 Bacteria 1783
370 Ga0373945_0027214 3300035116 Bacteria 1996
371 Ga0373946_0058648 3300035171 Bacteria 1631
372 Ga0373942_0145489 3300035207 Unclassified 758
373 Ga0373961_0019394 3300035241 Bacteria 1786
374 Ga0373962_0085951 3300035242 Bacteria 962
375 Ga0373924_0065533 3300035410 Bacteria 1525
376 Ga0373931_0035451 3300035691 Bacteria 2594
377 Ga0373931_0077046 3300035691 Bacteria 1832
378 Ga0373931_0140706 3300035691 Bacteria 1397
379 Ga0373935_0042625 3300035692 Bacteria 2854
380 Ga0373927_0034645 3300035695 Bacteria 3283
381 Ga0373937_0002644 3300036401 Bacteria 14929
382 Ga0373937_0506367 3300036401 Bacteria 1147
383 Ga0373937_0680121 3300036401 Bacteria 975
384 Ga0373925_0018981 3300037068 Bacteria 4997
385 Ga0436360_0054213 3300039438 Bacteria 1744
386 Ga0451807_2176720 3300041486 Bacteria 2979
387 Ga0439441_046354 3300042001 Bacteria 885
388 Ga0439443_012219 3300042003 Bacteria 1268
389 Ga0439443_017622 3300042003 Bacteria 1100
390 Ga0439446_0039668 3300042156 Bacteria 1384
391 Ga0439434_0056459 3300042435 Bacteria 1223
392 Ga0439435_0002967 3300042436 Bacteria 3455
393 Ga0439464_0069726 3300042439 Bacteria 1039
394 Ga0451577_0041797 3300042876 Bacteria 4114
395 Ga0451577_0840946 3300042876 Bacteria 828
396 Ga0451576_0000490 3300045051 Bacteria 87626
397 Ga0451576_0019294 3300045051 Bacteria 7444
398 Ga0451576_0037008 3300045051 Bacteria 5170
399 Ga0451576_0055608 3300045051 Bacteria 4140
400 Ga0451576_0056664 3300045051 Bacteria 4098
401 Ga0451576_0158449 3300045051 Bacteria 2362
402 Ga0451576_0161908 3300045051 Bacteria 2335
403 Ga0451576_0595787 3300045051 Bacteria 1162
404 Ga0451576_0869490 3300045051 Bacteria 946
405 Ga0451576_1316316 3300045051 Unclassified 753
406 Ga0451576_1721027 3300045051 Unclassified 649
407 Ga0495592_0000656 3300046454 Bacteria 24042
408 Ga0495603_0028367 3300046455 Bacteria 3376
409 Ga0495629_0270512 3300046459 Bacteria 1167
410 Ga0495653_0153348 3300046463 Bacteria 1607
411 Ga0495580_0003364 3300046472 Bacteria 13666
412 Ga0495582_0008530 3300046473 Bacteria 5653
413 Ga0495639_0007525 3300046475 Bacteria 4677
414 Ga0495662_0136159 3300046476 Bacteria 1208
415 Ga0495584_0023164 3300046491 Bacteria 3149
416 Ga0495594_0047925 3300046499 Bacteria 2347
417 Ga0495608_0013093 3300046511 Bacteria 5756
418 Ga0495628_0009521 3300046516 Bacteria 8292
419 Ga0495630_0021082 3300046517 Bacteria 4811
420 Ga0495630_0122863 3300046517 Bacteria 1970
421 Ga0495644_0211240 3300046523 Bacteria 749
422 Ga0495666_0011968 3300046526 Bacteria 4331
423 Ga0495666_0014171 3300046526 Bacteria 3973
424 Ga0495652_0076031 3300046529 Bacteria 2787
425 Ga0495665_0011502 3300046531 Bacteria 4792
426 Ga0495640_0044672 3300046533 Bacteria 3079
427 Ga0495640_0055031 3300046533 Bacteria 2723
428 Ga0495586_0000700 3300046535 Bacteria 19011
429 Ga0495586_0231552 3300046535 Bacteria 1051
430 Ga0495609_0042999 3300046538 Bacteria 2029
431 Ga0495621_0103691 3300046539 Bacteria 1085
432 Ga0495621_0104538 3300046539 Bacteria 1081
433 Ga0495621_0154175 3300046539 Bacteria 905
434 Ga0495621_0287943 3300046539 Bacteria 678
435 Ga0495645_0072876 3300046543 Bacteria 2474
436 Ga0495622_0336316 3300046557 Bacteria 655
437 Ga0495622_0369768 3300046557 Unclassified 619
438 Ga0495667_0001556 3300046559 Bacteria 15231
439 Ga0495656_0003398 3300046615 Bacteria 5385
440 Ga0495635_0142147 3300046663 Bacteria 1634
441 Ga0495635_0218862 3300046663 Bacteria 1288
442 Ga0495659_0017157 3300046664 Bacteria 2395
443 Ga0495659_0192617 3300046664 Unclassified 834
444 Ga0495588_0177574 3300046674 Bacteria 1125
445 Ga0495647_0000666 3300046681 Bacteria 10212
446 Ga0495647_0217952 3300046681 Bacteria 841
447 Ga0495658_0012070 3300046683 Bacteria 4363
448 Ga0495613_0024689 3300046689 Bacteria 4478
449 Ga0495670_0222035 3300046691 Bacteria 1004
450 Ga0495600_0004354 3300046809 Bacteria 8472
451 Ga0495581_0125740 3300047315 Bacteria 1493
452 Ga0495604_0101800 3300047317 Bacteria 2109
453 Ga0495636_0015749 3300047318 Bacteria 3014
454 Ga0495672_0322044 3300047320 Unclassified 726
455 Ga0495676_0007965 3300047321 Bacteria 9712
456 Ga0495680_0018286 3300047322 Bacteria 5955
457 Ga0495675_0141538 3300047444 Bacteria 1491
458 Ga0501031_0076996 3300049568 Bacteria 2172
459 Ga0501032_0464323 3300049569 Bacteria 810
460 Ga0501033_0003205 3300049570 Bacteria 13541
461 Ga0501036_0000101 3300049572 Bacteria 53813
462 Ga0501036_1111127 3300049572 Bacteria 646
463 Ga0501039_0004411 3300049575 Bacteria 10617
464 Ga0501039_0106041 3300049575 Bacteria 2195
465 Ga0501039_0142724 3300049575 Bacteria 1881
466 Ga0501040_0001365 3300049576 Bacteria 15415
467 Ga0501041_0000991 3300049577 Bacteria 15517
468 Ga0501041_0036250 3300049577 Bacteria 2989
469 Ga0501041_0308189 3300049577 Bacteria 998
470 Ga0501041_0747654 3300049577 Bacteria 626
471 Ga0501041_0833395 3300049577 Unclassified 592
472 Ga0501042_0001081 3300049578 Bacteria 15620
473 Ga0501042_0167712 3300049578 Bacteria 1584
474 Ga0501042_0349307 3300049578 Bacteria 1070
475 Ga0501042_0549255 3300049578 Unclassified 840
476 Ga0501043_0014498 3300049579 Bacteria 6170
477 Ga0501046_0000705 3300049580 Bacteria 32282
478 Ga0501046_0145199 3300049580 Bacteria 1792
479 Ga0501048_0000707 3300049582 Bacteria 24361
480 Ga0501068_0004998 3300049584 Bacteria 7220
481 Ga0501069_0090649 3300049585 Bacteria 1729
482 Ga0501070_0262041 3300049586 Bacteria 1413
483 Ga0501071_0032846 3300049587 Bacteria 3687
484 Ga0501071_0252180 3300049587 Bacteria 1332
485 Ga0501072_0002292 3300049588 Bacteria 14325
486 Ga0501072_0178190 3300049588 Bacteria 1695
487 Ga0501072_0750153 3300049588 Bacteria 766
488 Ga0501073_0119804 3300049589 Bacteria 1824
489 Ga0501073_0247815 3300049589 Bacteria 1230
490 Ga0501073_0301566 3300049589 Bacteria 1105
491 Ga0501074_0928466 3300049590 Bacteria 612
492 Ga0501075_0000036 3300049591 Bacteria 55260
493 Ga0501075_1192743 3300049591 Bacteria 577
494 Ga0501076_0000220 3300049592 Bacteria 34479
495 Ga0501076_0092724 3300049592 Bacteria 2430
496 Ga0501076_0312839 3300049592 Bacteria 1288
497 Ga0501077_0002144 3300049593 Bacteria 11914
498 Ga0501077_0032220 3300049593 Bacteria 3337
499 Ga0501077_0304610 3300049593 Bacteria 1015
500 Ga0501077_0525006 3300049593 Bacteria 759
501 Ga0501079_0001209 3300049741 Bacteria 18083
502 Ga0501079_0025959 3300049741 Bacteria 4493
503 Ga0501079_0233221 3300049741 Bacteria 1438
504 Ga0501080_0051138 3300049742 Bacteria 3845
505 Ga0501080_0474531 3300049742 Bacteria 1120
506 Ga0501080_1174346 3300049742 Bacteria 661
507 Ga0501081_0001138 3300049743 Bacteria 16054
508 Ga0501081_0067228 3300049743 Bacteria 2494
509 Ga0501081_0099692 3300049743 Bacteria 2052
510 Ga0501083_0103822 3300049744 Bacteria 1873
511 Ga0501035_0300862 3300049822 Bacteria 1351
512 Ga0501044_0079617 3300049823 Bacteria 3320
513 Ga0501045_0001533 3300049824 Bacteria 15394
514 Ga0501045_0065910 3300049824 Bacteria 2659
515 nmdc:mga05p37_1343159_c1 3300050507 Unclassified 725
516 nmdc:mga05p37_5335_c1 3300050507 Bacteria 15100
517 nmdc:mga05p37_90929_c1 3300050507 Bacteria 3761
518 nmdc:mga05p37_93093_c1 3300050507 Bacteria 3714
519 nmdc:mga09592_162111_c1 3300050508 Bacteria 1932
520 nmdc:mga09592_2360_c1 3300050508 Bacteria 15225
521 nmdc:mga09592_39354_c1 3300050508 Bacteria 3972
522 nmdc:mga09592_70130_c1 3300050508 Bacteria 2974
523 nmdc:mga09592_79785_c1 3300050508 Bacteria 2787
524 nmdc:mga0qj67_12737_c1 3300050509 Bacteria 6340
525 nmdc:mga0qj67_251844_c1 3300050509 Bacteria 1433
526 nmdc:mga0qj67_646125_c1 3300050509 Bacteria 844
527 nmdc:mga06r32_159511_c1 3300050510 Bacteria 2238
528 nmdc:mga06r32_194966_c1 3300050510 Bacteria 2013
529 nmdc:mga06r32_221516_c1 3300050510 Bacteria 1880
530 nmdc:mga06r32_41137_c1 3300050510 Bacteria 4390
531 nmdc:mga06r32_628073_c1 3300050510 Bacteria 1044
532 nmdc:mga08y16_1136331_c1 3300050511 Bacteria 755
533 nmdc:mga08y16_155621_c1 3300050511 Bacteria 2375
534 nmdc:mga08y16_158381_c1 3300050511 Bacteria 2353
535 nmdc:mga08y16_20278_c1 3300050511 Bacteria 7017
536 nmdc:mga08y16_329888_c1 3300050511 Bacteria 1570
537 nmdc:mga08y16_34921_c1 3300050511 Bacteria 5283
538 nmdc:mga08y16_619396_c1 3300050511 Bacteria 1089
539 nmdc:mga08y16_79198_c1 3300050511 Bacteria 3425
540 nmdc:mga0n895_1379379_c1 3300050512 Bacteria 674
541 nmdc:mga0n895_32906_c1 3300050512 Bacteria 4979
542 nmdc:mga0n895_34992_c1 3300050512 Bacteria 4839
543 nmdc:mga0n895_353_c1 3300050512 Bacteria 30930
544 nmdc:mga0n895_747227_c1 3300050512 Bacteria 971
545 nmdc:mga0n895_9490_c1 3300050512 Bacteria 8516
546 nmdc:mga0rr50_17164_c1 3300050513 Bacteria 4826
547 nmdc:mga0rr50_297033_c1 3300050513 Bacteria 1351
548 nmdc:mga0rr50_333019_c1 3300050513 Bacteria 1274
549 nmdc:mga0rr50_35437_c1 3300050513 Bacteria 3584
550 nmdc:mga0rr50_44754_c1 3300050513 Bacteria 3249
551 nmdc:mga0rr50_609690_c1 3300050513 Bacteria 931
552 nmdc:mga08x19_1057_c1 3300050514 Bacteria 17209
553 nmdc:mga08x19_144_c1 3300050514 Bacteria 61986
554 nmdc:mga08x19_170948_c1 3300050514 Bacteria 1480
555 nmdc:mga08x19_188351_c1 3300050514 Bacteria 1411
556 nmdc:mga08x19_23537_c1 3300050514 Bacteria 3821
557 nmdc:mga08x19_34439_c1 3300050514 Bacteria 3201
558 nmdc:mga08x19_413759_c1 3300050514 Bacteria 947
559 nmdc:mga08x19_644110_c1 3300050514 Bacteria 752
560 nmdc:mga0a205_132553_c1 3300050515 Bacteria 2392
561 nmdc:mga0a205_17082_c1 3300050515 Bacteria 6794
562 nmdc:mga0a205_3228_c1 3300050515 Bacteria 14499
563 nmdc:mga0a205_445576_c1 3300050515 Bacteria 744
564 nmdc:mga0a205_653076_c1 3300050515 Bacteria 903
565 Ga0495601_0006179 3300053077 Bacteria 6991
566 Ga0495601_0043664 3300053077 Bacteria 2815
567 Ga0495595_0186319 3300053084 Bacteria 1030
568 Ga0501084_0002769 3300054114 Bacteria 14160
569 Ga0501084_0279918 3300054114 Bacteria 1408
570 Ga0501084_0301609 3300054114 Bacteria 1353
571 Ga0501084_0956635 3300054114 Unclassified 720
572 Ga0590071_005711 3300059421 Bacteria 2986
573 Ga0590074_008276 3300059423 Bacteria 1733
574 Ga0590077_046936 3300059426 Bacteria 966
575 Ga0501082_0007385 3300060353 Bacteria 9485
576 Ga0530510_0034346 3300061734 Bacteria 3652
577 Ga0530510_0815479 3300061734 Bacteria 712
578 Ga0070692_10102982
579 Ga0065704_10475648
580 Ga0065715_10175301
581 Ga0065707_10174308
582 Ga0065707_10328508
583 Ga0065707_10509960
584 Ga0070683_100082542
585 Ga0070690_100011115
586 Ga0070690_100182567
587 Ga0068869_100476581
588 Ga0070680_100054143
589 Ga0070680_100074854
590 Ga0070680_100099424
591 Ga0070680_100212393
592 Ga0070660_101592697
593 Ga0070689_100130917
594 Ga0070689_100146052
595 Ga0070689_100236976
596 Ga0070689_100341668
597 Ga0070689_100983637
598 Ga0070691_10000874
599 Ga0070691_10534526
600 Ga0070687_100024385
601 Ga0070687_100251901
602 Ga0070692_10009393
603 Ga0070692_10012268
604 Ga0070692_10350117
605 Ga0070669_100036800
606 Ga0070675_100165637
607 Ga0070675_101230097
608 Ga0070671_101249720
609 Ga0070671_101532628
610 Ga0070674_100170069
611 Ga0070674_100564047
612 Ga0070673_100428837
613 Ga0070673_100496357
614 Ga0070688_100436245
615 Ga0070703_10025638
616 Ga0070703_10050043
617 Ga0070703_10063425
618 Ga0070703_10184979
619 Ga0070710_10357863
620 Ga0070701_10011007
621 Ga0070701_10016989
622 Ga0070701_10025679
623 Ga0070701_10080218
624 Ga0070701_10542360
625 Ga0070701_10709367
626 Ga0070711_100161282
627 Ga0070705_100001344
628 Ga0070705_100137070
629 Ga0070705_100294767
630 Ga0070705_100624511
631 Ga0070700_100031063
632 Ga0070700_100060774
633 Ga0070700_100146854
634 Ga0070700_100321205
635 Ga0070700_100717415
636 Ga0070694_100002752
637 Ga0070694_100032957
638 Ga0070694_100055162
639 Ga0070694_100071199
640 Ga0070694_100137828
641 Ga0070694_100156922
642 Ga0070694_100204490
643 Ga0070694_100339072
644 Ga0070694_100936504
645 Ga0070694_101566689
646 Ga0070662_100253431
647 Ga0070681_10000615
648 Ga0070681_10328569
649 Ga0070681_10390302
650 Ga0068867_100009029
651 Ga0068867_100013766
652 Ga0070706_101167939
653 Ga0070698_101495487
654 Ga0070699_100083426
655 Ga0070699_100222168
656 Ga0070699_100256669
657 Ga0070699_100526812
658 Ga0070679_100405178
659 Ga0070679_100740350
660 Ga0070684_100273381
661 Ga0070697_100004383
662 Ga0070697_100279786
663 Ga0070697_100408795
664 Ga0070697_100628432
665 Ga0068853_100775947
666 Ga0070672_100508643
667 Ga0070672_100636317
668 Ga0070686_100622596
669 Ga0070695_100001112
670 Ga0070695_100015012
671 Ga0070695_100023983
672 Ga0070695_100062033
673 Ga0070695_100115641
674 Ga0070695_100134280
675 Ga0070695_100163690
676 Ga0070695_100187494
677 Ga0070695_100203763
678 Ga0070695_100389591
679 Ga0070695_100397745
680 Ga0070696_100001385
681 Ga0070696_100003449
682 Ga0070696_100004740
683 Ga0070696_100082187
684 Ga0070696_100125960
685 Ga0070696_100203318
686 Ga0070696_100302253
687 Ga0070696_101357915
688 Ga0070693_100000174
689 Ga0070693_100057357
690 Ga0070704_100001537
691 Ga0070704_100029506
692 Ga0070704_100046485
693 Ga0070704_100085984
694 Ga0070704_100147950
695 Ga0070704_100239944
696 Ga0070704_100279439
697 Ga0070704_100284713
698 Ga0070704_100328678
699 Ga0070704_100342429
700 Ga0070704_100358203
701 Ga0070704_101103457
702 Ga0068855_100024277
703 Ga0068857_100018306
704 Ga0068857_100052669
705 Ga0068857_100428082
706 Ga0068854_100462344
707 Ga0068854_100863261
708 Ga0068856_100632405
709 Ga0068856_101098004
710 Ga0070702_100000064
711 Ga0068859_100017941
712 Ga0068859_100046350
713 Ga0068859_100113164
714 Ga0068859_100582415
715 Ga0068859_100652367
716 Ga0068864_100070723
717 Ga0068864_100186205
718 Ga0068866_10000766
719 Ga0068866_10058530
720 Ga0068861_100011356
721 Ga0068861_100042554
722 Ga0068861_101640101
723 Ga0068870_10080305
724 Ga0068870_10670293
725 Ga0068858_100167667
726 Ga0068860_100015309
727 Ga0068860_100122487
728 Ga0068860_100130115
729 Ga0068860_100958230
730 Ga0068862_100051748
731 Ga0068862_100060092
732 Ga0068862_100241726
733 Ga0068862_100637630
734 Ga0081539_10000178
735 Ga0070716_100547678
736 Ga0097621_100037682
737 Ga0068871_100007842
738 Ga0075428_100004106
739 Ga0075428_100053337
740 Ga0075428_100068989
741 Ga0075430_100311101
742 Ga0075430_100557181
743 Ga0075430_101016564
744 Ga0075431_100034715
745 Ga0075431_100255530
746 Ga0075431_100542078
747 Ga0075431_101281448
748 Ga0075433_10011094
749 Ga0075433_10192185
750 Ga0075433_10743426
751 Ga0075433_10984870
752 Ga0075434_100069562
753 Ga0075434_100092158
754 Ga0075434_100488292
755 Ga0075434_100811582
756 Ga0075429_100000470
757 Ga0075429_100014944
758 Ga0075429_100035249
759 Ga0075429_100615620
760 Ga0068865_100002536
761 Ga0068865_100226343
762 Ga0068865_100390826
763 Ga0068865_100583691
764 Ga0068865_100809686
765 Ga0075436_100000353
766 Ga0075436_100001446
767 Ga0075436_100049788
768 Ga0075436_100067817
769 Ga0075436_100079542
770 Ga0075436_100213060
771 Ga0097620_100017939
772 Ga0097620_100046350
773 Ga0097620_100113165
774 Ga0097620_100582365
775 Ga0097620_100652382
776 Ga0075435_100000148
777 Ga0075435_100026928
778 Ga0075435_100029785
779 Ga0075435_100043532
780 Ga0075435_100302122
781 Ga0099794_10003816
782 Ga0099794_10088183
783 Ga0099794_10245160
784 Ga0111539_10086342
785 Ga0111539_10143281
786 Ga0111539_10191206
787 Ga0111539_10231550
788 Ga0111539_10392941
789 Ga0111539_10549570
790 Ga0111539_10662420
791 Ga0114129_10000467
792 Ga0114129_10016956
793 Ga0114129_10020824
794 Ga0114129_10340745
795 Ga0114129_10555858
796 Ga0114129_11614831
797 Ga0114129_11682689
798 Ga0105243_10063549
799 Ga0105243_10065514
800 Ga0105243_10287127
801 Ga0105241_10144498
802 Ga0105242_10000524
803 Ga0105242_10011347
804 Ga0105242_10069341
805 Ga0105248_10345300
806 Ga0105248_10554675
807 Ga0105248_11859690
808 Ga0105238_11579881
809 Ga0105249_10018598
810 Ga0105249_10037736
811 Ga0105249_10040954
812 Ga0105249_10626666
813 Ga0105239_11350084
814 Ga0105246_10794911
815 Ga0157369_11983051
816 Ga0157378_11642246
817 Ga0157378_11761860
818 Ga0157378_11880252
819 Ga0157375_10085879
820 Ga0157380_10084696
821 Ga0157380_10230413
822 Ga0157380_10678890
823 Ga0157380_11878523
824 Ga0157377_10060595
825 Ga0157377_10080035
826 Ga0157379_10686274
827 Ga0157379_10760938
828 Ga0157376_10078012
829 Ga0157376_10502956
830 Ga0213871_10048910
831 Ga0207653_10041759
832 Ga0207642_10108818
833 Ga0207645_10225164
834 Ga0207643_10106622
835 Ga0207684_10106715
836 Ga0207684_10483516
837 Ga0207684_10661330
838 Ga0207654_10104197
839 Ga0207654_10207781
840 Ga0207707_10001577
841 Ga0207707_10646732
842 Ga0207663_10486453
843 Ga0207660_10016601
844 Ga0207660_10066141
845 Ga0207662_10000674
846 Ga0207662_10103427
847 Ga0207662_10481226
848 Ga0207652_10095130
849 Ga0207646_10253566
850 Ga0207646_10271531
851 Ga0207659_10910056
852 Ga0207687_10092942
853 Ga0207687_10099124
854 Ga0207686_10081143
855 Ga0207709_10002341
856 Ga0207709_10141362
857 Ga0207670_10076942
858 Ga0207670_10255820
859 Ga0207670_10297373
860 Ga0207670_10661019
861 Ga0207670_10731027
862 Ga0207669_10075329
863 Ga0207704_10013852
864 Ga0207704_10263168
865 Ga0207704_10452745
866 Ga0207691_10657462
867 Ga0207689_10139628
868 Ga0207661_10439368
869 Ga0207661_11059257
870 Ga0207712_10133411
871 Ga0207712_10382951
872 Ga0207712_10785921
873 Ga0207712_10847106
874 Ga0207640_11001789
875 Ga0207703_10098177
876 Ga0207639_10335264
877 Ga0207708_10001613
878 Ga0207708_10014476
879 Ga0207708_10034570
880 Ga0207708_10246514
881 Ga0207708_10685329
882 Ga0207702_10530021
883 Ga0207702_11328955
884 Ga0207641_10292170
885 Ga0207648_10601857
886 Ga0207648_10910556
887 Ga0207676_10136564
888 Ga0207676_11110473
889 Ga0207674_10013493
890 Ga0207674_10064473
891 Ga0207674_10153528
892 Ga0207675_100000353
893 Ga0207675_100042109
894 Ga0209967_1002992
895 Ga0209967_1026400
896 Ga0209981_1008733
897 Ga0210000_1024023
898 Ga0209995_1027082
899 Ga0209968_1013423
900 Ga0209999_1014760
901 Ga0209970_1002777
902 Ga0209588_1133737
903 Ga0209971_1008333
904 Ga0209971_1112498
905 Ga0209974_10005808
906 Ga0207428_10003226
907 Ga0207428_10029538
908 Ga0207428_10400432
909 Ga0268265_10010733
910 Ga0268265_10448761
911 Ga0268265_10943604
912 Ga0268264_10045090
913 Ga0268264_10143762
914 Ga0268264_10611794
915 Ga0307408_100050167
916 Ga0307408_100454521
917 Ga0265314_10252117
918 Ga0307405_10379912
919 Ga0307405_11321943
920 Ga0307407_10399987
921 Ga0307412_10095961
922 Ga0307416_100036747
923 Ga0307416_100041401
924 Ga0307416_100101763
925 Ga0307416_100200614
926 Ga0307416_100739809
927 Ga0307416_102335362
928 Ga0307411_10076730
929 Ga0307411_10216641
930 Ga0373948_0014817
931 Ga0373948_0053899
932 Ga0373948_0057949
933 Ga0373938_0026895
934 Ga0373940_0036273
935 Ga0373940_0133674
936 Ga0373944_0016896
937 Ga0373949_0043538
938 Ga0373951_0019625
939 Ga0373952_0077124
940 Ga0373923_0093436
941 Ga0373923_0107796
942 Ga0373932_0016739
943 Ga0373932_0082398
944 Ga0373936_0026113
945 Ga0373939_0012107
946 Ga0373941_0022693
947 Ga0373945_0027214
948 Ga0373946_0058648
949 Ga0373942_0145489
950 Ga0373961_0019394
951 Ga0373962_0085951
952 Ga0373924_0065533
953 Ga0373931_0035451
954 Ga0373931_0077046
955 Ga0373931_0140706
956 Ga0373935_0042625
957 Ga0373927_0034645
958 Ga0373937_0002644
959 Ga0373937_0506367
960 Ga0373937_0680121
961 Ga0373925_0018981
962 Ga0436360_0054213
963 Ga0451807_2176720
964 Ga0439441_046354
965 Ga0439443_012219
966 Ga0439443_017622
967 Ga0439446_0039668
968 Ga0439434_0056459
969 Ga0439435_0002967
970 Ga0439464_0069726
971 Ga0451577_0041797
972 Ga0451577_0840946
973 Ga0451576_0000490
974 Ga0451576_0019294
975 Ga0451576_0037008
976 Ga0451576_0055608
977 Ga0451576_0056664
978 Ga0451576_0158449
979 Ga0451576_0161908
980 Ga0451576_0595787
981 Ga0451576_0869490
982 Ga0451576_1316316
983 Ga0451576_1721027
984 Ga0495592_0000656
985 Ga0495603_0028367
986 Ga0495629_0270512
987 Ga0495653_0153348
988 Ga0495580_0003364
989 Ga0495582_0008530
990 Ga0495639_0007525
991 Ga0495662_0136159
992 Ga0495584_0023164
993 Ga0495594_0047925
994 Ga0495608_0013093
995 Ga0495628_0009521
996 Ga0495630_0021082
997 Ga0495630_0122863
998 Ga0495644_0211240
999 Ga0495666_0011968
1000 Ga0495666_0014171
1001 Ga0495652_0076031
1002 Ga0495665_0011502
1003 Ga0495640_0044672
1004 Ga0495640_0055031
1005 Ga0495586_0000700
1006 Ga0495586_0231552
1007 Ga0495609_0042999
1008 Ga0495621_0103691
1009 Ga0495621_0104538
1010 Ga0495621_0154175
1011 Ga0495621_0287943
1012 Ga0495645_0072876
1013 Ga0495622_0336316
1014 Ga0495622_0369768
1015 Ga0495667_0001556
1016 Ga0495656_0003398
1017 Ga0495635_0142147
1018 Ga0495635_0218862
1019 Ga0495659_0017157
1020 Ga0495659_0192617
1021 Ga0495588_0177574
1022 Ga0495647_0000666
1023 Ga0495647_0217952
1024 Ga0495658_0012070
1025 Ga0495613_0024689
1026 Ga0495670_0222035
1027 Ga0495600_0004354
1028 Ga0495581_0125740
1029 Ga0495604_0101800
1030 Ga0495636_0015749
1031 Ga0495672_0322044
1032 Ga0495676_0007965
1033 Ga0495680_0018286
1034 Ga0495675_0141538
1035 Ga0501031_0076996
1036 Ga0501032_0464323
1037 Ga0501033_0003205
1038 Ga0501036_0000101
1039 Ga0501036_1111127
1040 Ga0501039_0004411
1041 Ga0501039_0106041
1042 Ga0501039_0142724
1043 Ga0501040_0001365
1044 Ga0501041_0000991
1045 Ga0501041_0036250
1046 Ga0501041_0308189
1047 Ga0501041_0747654
1048 Ga0501041_0833395
1049 Ga0501042_0001081
1050 Ga0501042_0167712
1051 Ga0501042_0349307
1052 Ga0501042_0549255
1053 Ga0501043_0014498
1054 Ga0501046_0000705
1055 Ga0501046_0145199
1056 Ga0501048_0000707
1057 Ga0501068_0004998
1058 Ga0501069_0090649
1059 Ga0501070_0262041
1060 Ga0501071_0032846
1061 Ga0501071_0252180
1062 Ga0501072_0002292
1063 Ga0501072_0178190
1064 Ga0501072_0750153
1065 Ga0501073_0119804
1066 Ga0501073_0247815
1067 Ga0501073_0301566
1068 Ga0501074_0928466
1069 Ga0501075_0000036
1070 Ga0501075_1192743
1071 Ga0501076_0000220
1072 Ga0501076_0092724
1073 Ga0501076_0312839
1074 Ga0501077_0002144
1075 Ga0501077_0032220
1076 Ga0501077_0304610
1077 Ga0501077_0525006
1078 Ga0501079_0001209
1079 Ga0501079_0025959
1080 Ga0501079_0233221
1081 Ga0501080_0051138
1082 Ga0501080_0474531
1083 Ga0501080_1174346
1084 Ga0501081_0001138
1085 Ga0501081_0067228
1086 Ga0501081_0099692
1087 Ga0501083_0103822
1088 Ga0501035_0300862
1089 Ga0501044_0079617
1090 Ga0501045_0001533
1091 Ga0501045_0065910
1092 nmdc:mga05p37_1343159_c1
1093 nmdc:mga05p37_5335_c1
1094 nmdc:mga05p37_90929_c1
1095 nmdc:mga05p37_93093_c1
1096 nmdc:mga09592_162111_c1
1097 nmdc:mga09592_2360_c1
1098 nmdc:mga09592_39354_c1
1099 nmdc:mga09592_70130_c1
1100 nmdc:mga09592_79785_c1
1101 nmdc:mga0qj67_12737_c1
1102 nmdc:mga0qj67_251844_c1
1103 nmdc:mga0qj67_646125_c1
1104 nmdc:mga06r32_159511_c1
1105 nmdc:mga06r32_194966_c1
1106 nmdc:mga06r32_221516_c1
1107 nmdc:mga06r32_41137_c1
1108 nmdc:mga06r32_628073_c1
1109 nmdc:mga08y16_1136331_c1
1110 nmdc:mga08y16_155621_c1
1111 nmdc:mga08y16_158381_c1
1112 nmdc:mga08y16_20278_c1
1113 nmdc:mga08y16_329888_c1
1114 nmdc:mga08y16_34921_c1
1115 nmdc:mga08y16_619396_c1
1116 nmdc:mga08y16_79198_c1
1117 nmdc:mga0n895_1379379_c1
1118 nmdc:mga0n895_32906_c1
1119 nmdc:mga0n895_34992_c1
1120 nmdc:mga0n895_353_c1
1121 nmdc:mga0n895_747227_c1
1122 nmdc:mga0n895_9490_c1
1123 nmdc:mga0rr50_17164_c1
1124 nmdc:mga0rr50_297033_c1
1125 nmdc:mga0rr50_333019_c1
1126 nmdc:mga0rr50_35437_c1
1127 nmdc:mga0rr50_44754_c1
1128 nmdc:mga0rr50_609690_c1
1129 nmdc:mga08x19_1057_c1
1130 nmdc:mga08x19_144_c1
1131 nmdc:mga08x19_170948_c1
1132 nmdc:mga08x19_188351_c1
1133 nmdc:mga08x19_23537_c1
1134 nmdc:mga08x19_34439_c1
1135 nmdc:mga08x19_413759_c1
1136 nmdc:mga08x19_644110_c1
1137 nmdc:mga0a205_132553_c1
1138 nmdc:mga0a205_17082_c1
1139 nmdc:mga0a205_3228_c1
1140 nmdc:mga0a205_445576_c1
1141 nmdc:mga0a205_653076_c1
1142 Ga0495601_0006179
1143 Ga0495601_0043664
1144 Ga0495595_0186319
1145 Ga0501084_0002769
1146 Ga0501084_0279918
1147 Ga0501084_0301609
1148 Ga0501084_0956635
1149 Ga0590071_005711
1150 Ga0590074_008276
1151 Ga0590077_046936
1152 Ga0501082_0007385
1153 Ga0530510_0034346
1154 Ga0530510_0815479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

36

167

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ew3-assembly1.cif.gz_R cryo-em structure of s1p-bound sphingosine 1-phosphate receptor 3 in complex with gi protein 0.7347 68 132
7xvq-assembly1.cif.gz_A crystal structure of acriic4 0.7097 55 126
8esv-assembly1.cif.gz_B structure of human adam10-tspan15 complex bound to 11g2 vfab 0.6785 60 132
7uzf-assembly1.cif.gz_f rat kidney v-atpase with sidk, state 1 0.6757 66 130
5tsj-assembly1.cif.gz_P thermus thermophilus v/a-atpase bound to vh dabs 0.672 61 127
ID Description Score Start End Superfamily
af_M9MSL9_1_154_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8089 63 130 1.20.140.150
af_P24485_1_104_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7952 58 132 1.10.287.70
af_F0JAT1_1_141_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7636 63 131 1.20.120.350
5d56C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7628 62 130 1.10.287.3610
4uyoB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7427 57 130 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A6M5XWL2-F1-model_v4 deleted 0.8237 43 140
AF-A0A3B7LC06-F1-model_v4 TRAP transporter small permease 0.7791 23 140 GO:0016020
AF-A0A0P0MFI1-F1-model_v4 TRAP transporter small permease protein 0.7188 32 140 GO:0005886
GO:0022857
AF-A0A0P0MFI1-F1-model_v4 TRAP transporter small permease protein 0.6955 32 140 GO:0005886
GO:0022857
AF-A0A090RRP4-F1-model_v4 Uncharacterized protein 0.6944 38 140 GO:0016020

Map