F465549
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 576 | 315 | 552 | 442 |
Family's Representative Sequence
| Representative Sequence | 3300048921|Ga0496118_0066688|Ga0496118_0066688_404_1876 |
| Length | 490 |
| Sequence | VTGALPVPAGSTHARPERRAAHDNNAGDKLMHQPADGPRTRGADGTPHAVDASQPWYRSLDRQQWTALAASNLGWFFDGYETYALILTVGVALSQLLDPALHAQIPFYAGLVIALTLLGWGIGGLIGGVLTDYIGRKRMMIVAILAYSLTTGLSAFAWDWTSFAALRFIVGLAMGSEWATGTAMTAEMWPSRHRGKGAGLMQCGLGTGFFVASLVWLFMSGTGQHAWRYMYLVGVLPGLATLWMRAGLPESEQWQRVANERRDTRAKQRAGTVLEGRDAALARFTLVDLFAVPELRRRTMIAVVMSLTTTLGWWGISTWVPPYVGAVAARAGLPAASWASYAGMAYNVGAIAGYIGLGFLADAYGRKRVTFLFFAMAFVLTPVLFIWTHSVAPLLAVACVTGFFSLGQYTWMPTWLPELYPTHVRGTAIAFCFNVPRFLAWTGPLIAGTLIARFGGYGHAAVTVGFIYLLGLALVPFLPETRGKPLPEML |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 4 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 5 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 6 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 7 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 8 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 9 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 10 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 11 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 12 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 13 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 14 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 15 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 16 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 17 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 18 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 19 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 314 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 315 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.18 |
| Metatranscriptomes | 0 |
| Isolates | 3.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.17 |
| Nodule | 0.69 |
| Rhizoplane | 8.68 |
| Rhizosphere | 80.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010481 | 3300001979 | Bacteria | 3567 |
| 2 | JGI24739J22299_10004836 | 3300001989 | Bacteria | 5133 |
| 3 | JGI24738J21930_10005402 | 3300002075 | Bacteria | 3064 |
| 4 | rootH2_10067189 | 3300003320 | Bacteria | 5560 |
| 5 | rootH2_10082695 | 3300003320 | Bacteria | 1953 |
| 6 | rootH1_10050528 | 3300003323 | Bacteria | 3805 |
| 7 | JGI25160J50197_1000039 | 3300003354 | Bacteria | 159036 |
| 8 | JGI25160J50197_1000652 | 3300003354 | Bacteria | 19277 |
| 9 | Ga0065165_1000319 | 3300005262 | Bacteria | 78309 |
| 10 | Ga0065707_10095351 | 3300005295 | Bacteria | 3382 |
| 11 | Ga0070658_10166819 | 3300005327 | Unclassified | 1849 |
| 12 | Ga0070676_10042254 | 3300005328 | Bacteria | 2646 |
| 13 | Ga0070670_100059137 | 3300005331 | Bacteria | 3290 |
| 14 | Ga0070670_100078153 | 3300005331 | Bacteria | 2843 |
| 15 | Ga0068869_100003694 | 3300005334 | Bacteria | 9413 |
| 16 | Ga0068869_100043661 | 3300005334 | Bacteria | 3221 |
| 17 | Ga0070666_10091492 | 3300005335 | Bacteria | 2090 |
| 18 | Ga0070680_100076467 | 3300005336 | Bacteria | 2756 |
| 19 | Ga0070682_100045278 | 3300005337 | Bacteria | 2727 |
| 20 | Ga0070682_100097568 | 3300005337 | Bacteria | 1935 |
| 21 | Ga0068868_100029271 | 3300005338 | Bacteria | 4217 |
| 22 | Ga0070660_100215417 | 3300005339 | Bacteria | 1560 |
| 23 | Ga0070689_100014709 | 3300005340 | Bacteria | 5691 |
| 24 | Ga0070689_100144287 | 3300005340 | Bacteria | 1917 |
| 25 | Ga0070691_10029638 | 3300005341 | Bacteria | 2561 |
| 26 | Ga0070691_10034176 | 3300005341 | Bacteria | 2392 |
| 27 | Ga0070669_100040898 | 3300005353 | Bacteria | 3370 |
| 28 | Ga0070675_100052908 | 3300005354 | Bacteria | 3339 |
| 29 | Ga0070688_100047854 | 3300005365 | Bacteria | 2655 |
| 30 | Ga0070709_10091406 | 3300005434 | Bacteria | 2008 |
| 31 | Ga0070709_10108742 | 3300005434 | Unclassified | 1860 |
| 32 | Ga0070714_100064859 | 3300005435 | Bacteria | 3145 |
| 33 | Ga0070714_100148553 | 3300005435 | Bacteria | 2110 |
| 34 | Ga0070710_10008395 | 3300005437 | Bacteria | 5026 |
| 35 | Ga0070705_100116311 | 3300005440 | Bacteria | 1719 |
| 36 | Ga0070694_100021398 | 3300005444 | Bacteria | 4131 |
| 37 | Ga0070694_100129865 | 3300005444 | Bacteria | 1819 |
| 38 | Ga0070708_100301779 | 3300005445 | Bacteria | 1508 |
| 39 | Ga0070663_100000451 | 3300005455 | Bacteria | 21742 |
| 40 | Ga0070663_100073179 | 3300005455 | Bacteria | 2499 |
| 41 | Ga0070663_100149043 | 3300005455 | Bacteria | 1792 |
| 42 | Ga0070663_100158070 | 3300005455 | Bacteria | 1743 |
| 43 | Ga0070678_100061524 | 3300005456 | Bacteria | 2768 |
| 44 | Ga0068867_100051720 | 3300005459 | Bacteria | 3030 |
| 45 | Ga0070685_10016150 | 3300005466 | Bacteria | 3973 |
| 46 | Ga0070707_100017912 | 3300005468 | Bacteria | 6660 |
| 47 | Ga0070698_100000549 | 3300005471 | Bacteria | 40084 |
| 48 | Ga0070698_100078682 | 3300005471 | Bacteria | 3295 |
| 49 | Ga0070698_100081072 | 3300005471 | Bacteria | 3239 |
| 50 | Ga0070699_100001070 | 3300005518 | Bacteria | 25499 |
| 51 | Ga0070699_100061911 | 3300005518 | Bacteria | 3243 |
| 52 | Ga0070684_100033013 | 3300005535 | Bacteria | 4417 |
| 53 | Ga0070684_100059460 | 3300005535 | Bacteria | 3341 |
| 54 | Ga0070697_100035896 | 3300005536 | Bacteria | 4001 |
| 55 | Ga0070697_100122601 | 3300005536 | Unclassified | 2175 |
| 56 | Ga0070672_100112458 | 3300005543 | Bacteria | 2221 |
| 57 | Ga0070695_100001841 | 3300005545 | Bacteria | 11957 |
| 58 | Ga0070696_100025633 | 3300005546 | Bacteria | 4009 |
| 59 | Ga0070696_100069223 | 3300005546 | Bacteria | 2479 |
| 60 | Ga0070696_100109665 | 3300005546 | Bacteria | 1986 |
| 61 | Ga0070665_100050135 | 3300005548 | Bacteria | 4189 |
| 62 | Ga0070704_100004652 | 3300005549 | Bacteria | 7941 |
| 63 | Ga0068855_100007415 | 3300005563 | Bacteria | 13280 |
| 64 | Ga0070664_100208739 | 3300005564 | Bacteria | 1745 |
| 65 | Ga0068857_100026971 | 3300005577 | Bacteria | 5067 |
| 66 | Ga0068854_100009305 | 3300005578 | Bacteria | 6340 |
| 67 | Ga0068854_100012231 | 3300005578 | Bacteria | 5617 |
| 68 | Ga0068856_100032803 | 3300005614 | Bacteria | 5086 |
| 69 | Ga0068856_100054361 | 3300005614 | Bacteria | 3949 |
| 70 | Ga0070702_100010331 | 3300005615 | Bacteria | 4592 |
| 71 | Ga0070702_100102084 | 3300005615 | Bacteria | 1761 |
| 72 | Ga0070702_100107834 | 3300005615 | Bacteria | 1720 |
| 73 | Ga0068852_100086168 | 3300005616 | Bacteria | 2799 |
| 74 | Ga0068861_100035421 | 3300005719 | Bacteria | 3697 |
| 75 | Ga0068863_100105144 | 3300005841 | Bacteria | 2686 |
| 76 | Ga0068863_100232662 | 3300005841 | Bacteria | 1778 |
| 77 | Ga0068858_100036520 | 3300005842 | Bacteria | 4556 |
| 78 | Ga0068858_100048009 | 3300005842 | Bacteria | 3957 |
| 79 | Ga0068858_100080854 | 3300005842 | Bacteria | 3020 |
| 80 | Ga0068860_100262798 | 3300005843 | Bacteria | 1683 |
| 81 | Ga0068862_100026381 | 3300005844 | Bacteria | 4883 |
| 82 | Ga0081455_10002226 | 3300005937 | Bacteria | 23089 |
| 83 | Ga0081540_1019791 | 3300005983 | Bacteria | 4075 |
| 84 | Ga0081540_1024793 | 3300005983 | Bacteria | 3471 |
| 85 | Ga0075365_10054021 | 3300006038 | Bacteria | 2662 |
| 86 | Ga0070712_100017798 | 3300006175 | Bacteria | 4604 |
| 87 | Ga0070712_100086364 | 3300006175 | Bacteria | 2286 |
| 88 | Ga0075362_10030415 | 3300006177 | Bacteria | 2332 |
| 89 | Ga0075367_10038185 | 3300006178 | Bacteria | 2794 |
| 90 | Ga0097621_100066201 | 3300006237 | Bacteria | 2975 |
| 91 | Ga0075428_100040726 | 3300006844 | Bacteria | 5110 |
| 92 | Ga0075433_10025085 | 3300006852 | Bacteria | 5038 |
| 93 | Ga0075434_100006963 | 3300006871 | Bacteria | 10421 |
| 94 | Ga0075434_100024408 | 3300006871 | Bacteria | 5910 |
| 95 | Ga0075434_100109950 | 3300006871 | Bacteria | 2767 |
| 96 | Ga0075434_100117751 | 3300006871 | Bacteria | 2670 |
| 97 | Ga0075434_100202786 | 3300006871 | Bacteria | 2004 |
| 98 | Ga0075429_100018845 | 3300006880 | Bacteria | 5978 |
| 99 | Ga0075429_100063333 | 3300006880 | Bacteria | 3222 |
| 100 | Ga0068865_100067191 | 3300006881 | Bacteria | 2531 |
| 101 | Ga0075436_100004329 | 3300006914 | Bacteria | 9744 |
| 102 | Ga0075436_100024183 | 3300006914 | Bacteria | 4176 |
| 103 | Ga0075436_100078701 | 3300006914 | Bacteria | 2284 |
| 104 | Ga0075435_100072161 | 3300007076 | Bacteria | 2820 |
| 105 | Ga0075435_100095244 | 3300007076 | Bacteria | 2462 |
| 106 | Ga0099795_10031872 | 3300007788 | Bacteria | 1819 |
| 107 | Ga0105251_10041834 | 3300009011 | Bacteria | 2228 |
| 108 | Ga0105240_10018445 | 3300009093 | Bacteria | 9368 |
| 109 | Ga0111539_10063999 | 3300009094 | Bacteria | 4352 |
| 110 | Ga0111539_10064923 | 3300009094 | Bacteria | 4316 |
| 111 | Ga0105245_10241504 | 3300009098 | Bacteria | 1751 |
| 112 | Ga0105247_10008565 | 3300009101 | Bacteria | 6232 |
| 113 | Ga0114129_10009585 | 3300009147 | Bacteria | 13812 |
| 114 | Ga0114129_10024927 | 3300009147 | Bacteria | 8481 |
| 115 | Ga0114129_10092130 | 3300009147 | Bacteria | 4199 |
| 116 | Ga0114129_10335650 | 3300009147 | Bacteria | 2006 |
| 117 | Ga0105243_10018193 | 3300009148 | Bacteria | 5320 |
| 118 | Ga0105243_10058699 | 3300009148 | Bacteria | 3067 |
| 119 | Ga0105243_10142522 | 3300009148 | Unclassified | 2046 |
| 120 | Ga0105237_10059075 | 3300009545 | Bacteria | 3837 |
| 121 | Ga0105238_10029091 | 3300009551 | Bacteria | 5629 |
| 122 | Ga0105238_10093250 | 3300009551 | Bacteria | 2999 |
| 123 | Ga0105249_10040762 | 3300009553 | Bacteria | 4219 |
| 124 | Ga0099796_10013301 | 3300010159 | Bacteria | 2347 |
| 125 | Ga0105239_10086249 | 3300010375 | Bacteria | 3460 |
| 126 | Ga0105239_10093664 | 3300010375 | Bacteria | 3317 |
| 127 | Ga0105239_10135402 | 3300010375 | Bacteria | 2742 |
| 128 | Ga0157371_10129791 | 3300013102 | Bacteria | 1793 |
| 129 | Ga0157369_10128014 | 3300013105 | Bacteria | 2691 |
| 130 | Ga0157374_10124162 | 3300013296 | Bacteria | 2494 |
| 131 | Ga0163162_10000537 | 3300013306 | Bacteria | 35111 |
| 132 | Ga0163162_10002420 | 3300013306 | Bacteria | 17574 |
| 133 | Ga0163162_10048878 | 3300013306 | Bacteria | 4238 |
| 134 | Ga0163162_10132775 | 3300013306 | Bacteria | 2599 |
| 135 | Ga0157372_10051957 | 3300013307 | Bacteria | 4562 |
| 136 | Ga0157375_10033616 | 3300013308 | Bacteria | 4875 |
| 137 | Ga0157375_10063040 | 3300013308 | Bacteria | 3686 |
| 138 | Ga0157375_10372125 | 3300013308 | Bacteria | 1595 |
| 139 | Ga0163163_10036874 | 3300014325 | Bacteria | 4752 |
| 140 | Ga0163163_10260043 | 3300014325 | Bacteria | 1787 |
| 141 | Ga0163163_10354568 | 3300014325 | Bacteria | 1523 |
| 142 | Ga0157377_10001914 | 3300014745 | Bacteria | 9110 |
| 143 | Ga0157379_10021040 | 3300014968 | Bacteria | 5774 |
| 144 | Ga0157376_10037747 | 3300014969 | Unclassified | 3925 |
| 145 | Ga0213872_10049487 | 3300021361 | Bacteria | 1909 |
| 146 | Ga0213875_10000114 | 3300021388 | Bacteria | 91363 |
| 147 | Ga0213875_10001351 | 3300021388 | Bacteria | 16150 |
| 148 | Ga0209130_1002965 | 3300025284 | Bacteria | 7721 |
| 149 | Ga0209130_1003787 | 3300025284 | Bacteria | 6154 |
| 150 | Ga0209758_1003980 | 3300025297 | Bacteria | 12791 |
| 151 | Ga0207426_1000018 | 3300025302 | Bacteria | 566740 |
| 152 | Ga0207426_1002260 | 3300025302 | Bacteria | 12746 |
| 153 | Ga0207713_1039517 | 3300025735 | Bacteria | 1989 |
| 154 | Ga0207710_10009027 | 3300025900 | Unclassified | 4196 |
| 155 | Ga0207688_10000936 | 3300025901 | Bacteria | 14756 |
| 156 | Ga0207680_10122590 | 3300025903 | Bacteria | 1702 |
| 157 | Ga0207645_10032111 | 3300025907 | Bacteria | 3376 |
| 158 | Ga0207643_10000233 | 3300025908 | Bacteria | 38972 |
| 159 | Ga0207693_10000828 | 3300025915 | Bacteria | 27475 |
| 160 | Ga0207693_10120391 | 3300025915 | Bacteria | 2061 |
| 161 | Ga0207662_10012424 | 3300025918 | Bacteria | 4742 |
| 162 | Ga0207662_10097395 | 3300025918 | Bacteria | 1818 |
| 163 | Ga0207662_10115738 | 3300025918 | Bacteria | 1676 |
| 164 | Ga0207657_10034859 | 3300025919 | Bacteria | 4519 |
| 165 | Ga0207657_10053510 | 3300025919 | Bacteria | 3497 |
| 166 | Ga0207649_10200914 | 3300025920 | Bacteria | 1408 |
| 167 | Ga0207694_10006459 | 3300025924 | Bacteria | 8932 |
| 168 | Ga0207694_10144756 | 3300025924 | Bacteria | 1912 |
| 169 | Ga0207650_10094737 | 3300025925 | Bacteria | 2288 |
| 170 | Ga0207687_10045165 | 3300025927 | Bacteria | 3044 |
| 171 | Ga0207687_10054012 | 3300025927 | Bacteria | 2809 |
| 172 | Ga0207664_10047651 | 3300025929 | Bacteria | 3368 |
| 173 | Ga0207664_10140353 | 3300025929 | Bacteria | 2043 |
| 174 | Ga0207706_10003937 | 3300025933 | Bacteria | 14075 |
| 175 | Ga0207706_10133085 | 3300025933 | Bacteria | 2187 |
| 176 | Ga0207670_10208548 | 3300025936 | Bacteria | 1489 |
| 177 | Ga0207665_10056531 | 3300025939 | Bacteria | 2649 |
| 178 | Ga0207691_10032224 | 3300025940 | Bacteria | 4888 |
| 179 | Ga0207711_10006706 | 3300025941 | Bacteria | 9689 |
| 180 | Ga0207689_10016457 | 3300025942 | Bacteria | 6259 |
| 181 | Ga0207689_10141300 | 3300025942 | Bacteria | 1983 |
| 182 | Ga0207679_10159563 | 3300025945 | Bacteria | 1845 |
| 183 | Ga0207667_10000991 | 3300025949 | Bacteria | 36317 |
| 184 | Ga0207651_10051446 | 3300025960 | Bacteria | 2803 |
| 185 | Ga0207712_10018184 | 3300025961 | Bacteria | 4575 |
| 186 | Ga0207712_10267611 | 3300025961 | Bacteria | 1389 |
| 187 | Ga0207640_10180408 | 3300025981 | Bacteria | 1582 |
| 188 | Ga0207703_10018478 | 3300026035 | Bacteria | 5444 |
| 189 | Ga0207678_10008614 | 3300026067 | Bacteria | 8987 |
| 190 | Ga0207678_10015183 | 3300026067 | Bacteria | 6775 |
| 191 | Ga0207678_10018843 | 3300026067 | Bacteria | 6061 |
| 192 | Ga0207678_10023945 | 3300026067 | Bacteria | 5338 |
| 193 | Ga0207678_10048847 | 3300026067 | Bacteria | 3657 |
| 194 | Ga0207708_10000911 | 3300026075 | Bacteria | 22215 |
| 195 | Ga0207702_10055930 | 3300026078 | Unclassified | 3348 |
| 196 | Ga0207676_10040441 | 3300026095 | Bacteria | 3574 |
| 197 | Ga0207676_10042430 | 3300026095 | Bacteria | 3499 |
| 198 | Ga0207674_10122403 | 3300026116 | Bacteria | 2568 |
| 199 | Ga0207675_100005973 | 3300026118 | Bacteria | 11600 |
| 200 | Ga0207675_100026489 | 3300026118 | Bacteria | 5397 |
| 201 | Ga0207683_10031497 | 3300026121 | Bacteria | 4603 |
| 202 | Ga0207698_10056130 | 3300026142 | Bacteria | 3039 |
| 203 | Ga0209179_1003277 | 3300027512 | Bacteria | 2311 |
| 204 | Ga0207428_10085020 | 3300027907 | Bacteria | 2464 |
| 205 | Ga0268266_10001427 | 3300028379 | Bacteria | 28495 |
| 206 | Ga0268266_10023773 | 3300028379 | Bacteria | 5215 |
| 207 | Ga0268266_10058883 | 3300028379 | Bacteria | 3308 |
| 208 | Ga0268265_10028392 | 3300028380 | Bacteria | 4005 |
| 209 | Ga0268264_10174951 | 3300028381 | Bacteria | 1945 |
| 210 | Ga0265338_10007619 | 3300028800 | Bacteria | 13364 |
| 211 | Ga0265338_10102309 | 3300028800 | Bacteria | 2330 |
| 212 | Ga0265330_10012904 | 3300031235 | Bacteria | 3900 |
| 213 | Ga0265325_10010113 | 3300031241 | Bacteria | 5478 |
| 214 | Ga0265325_10032102 | 3300031241 | Bacteria | 2805 |
| 215 | Ga0265340_10026558 | 3300031247 | Bacteria | 2925 |
| 216 | Ga0265316_10004646 | 3300031344 | Bacteria | 13615 |
| 217 | Ga0265313_10021023 | 3300031595 | Bacteria | 3580 |
| 218 | Ga0265313_10053409 | 3300031595 | Unclassified | 1923 |
| 219 | Ga0265342_10023388 | 3300031712 | Bacteria | 3913 |
| 220 | Ga0307405_10133807 | 3300031731 | Bacteria | 1718 |
| 221 | Ga0307412_10000053 | 3300031911 | Bacteria | 148594 |
| 222 | Ga0307412_10012520 | 3300031911 | Bacteria | 4949 |
| 223 | Ga0307416_100068362 | 3300032002 | Bacteria | 2935 |
| 224 | Ga0373934_0002175 | 3300035086 | Bacteria | 7210 |
| 225 | Ga0373944_0000852 | 3300035089 | Bacteria | 7480 |
| 226 | Ga0373944_0005991 | 3300035089 | Bacteria | 3219 |
| 227 | Ga0373944_0012483 | 3300035089 | Bacteria | 2342 |
| 228 | Ga0373944_0022543 | 3300035089 | Bacteria | 1830 |
| 229 | Ga0373949_0015790 | 3300035090 | Bacteria | 1689 |
| 230 | Ga0373936_0022227 | 3300035113 | Bacteria | 2470 |
| 231 | Ga0373941_0003278 | 3300035115 | Bacteria | 3653 |
| 232 | Ga0373945_0001338 | 3300035116 | Bacteria | 7487 |
| 233 | Ga0373954_0063553 | 3300035118 | Bacteria | 1745 |
| 234 | Ga0373956_0004024 | 3300035119 | Bacteria | 5905 |
| 235 | Ga0373957_0007369 | 3300035120 | Bacteria | 3519 |
| 236 | Ga0373943_0000492 | 3300035170 | Bacteria | 16847 |
| 237 | Ga0373943_0009828 | 3300035170 | Bacteria | 4283 |
| 238 | Ga0373943_0054223 | 3300035170 | Bacteria | 1982 |
| 239 | Ga0373946_0001057 | 3300035171 | Bacteria | 9482 |
| 240 | Ga0373946_0050017 | 3300035171 | Bacteria | 1744 |
| 241 | Ga0373962_0021558 | 3300035242 | Bacteria | 1701 |
| 242 | Ga0373924_0022335 | 3300035410 | Bacteria | 2474 |
| 243 | Ga0373931_0003585 | 3300035691 | Bacteria | 7001 |
| 244 | Ga0373931_0083862 | 3300035691 | Bacteria | 1764 |
| 245 | Ga0373935_0034718 | 3300035692 | Bacteria | 3145 |
| 246 | Ga0373935_0085591 | 3300035692 | Bacteria | 2055 |
| 247 | Ga0373935_0158758 | 3300035692 | Bacteria | 1540 |
| 248 | Ga0373927_0001141 | 3300035695 | Bacteria | 20109 |
| 249 | Ga0373927_0021771 | 3300035695 | Bacteria | 4201 |
| 250 | Ga0373933_0001112 | 3300035724 | Bacteria | 16015 |
| 251 | Ga0373933_0003979 | 3300035724 | Bacteria | 8153 |
| 252 | Ga0373947_0003127 | 3300035725 | Bacteria | 9852 |
| 253 | Ga0373947_0006841 | 3300035725 | Bacteria | 6611 |
| 254 | Ga0373947_0013016 | 3300035725 | Unclassified | 4770 |
| 255 | Ga0373947_0023835 | 3300035725 | Bacteria | 3562 |
| 256 | Ga0373947_0065598 | 3300035725 | Bacteria | 2215 |
| 257 | Ga0373947_0161211 | 3300035725 | Bacteria | 1450 |
| 258 | Ga0373937_0003821 | 3300036401 | Bacteria | 12726 |
| 259 | Ga0373937_0022352 | 3300036401 | Bacteria | 5686 |
| 260 | Ga0373937_0034794 | 3300036401 | Bacteria | 4582 |
| 261 | Ga0373925_0002878 | 3300037068 | Bacteria | 13591 |
| 262 | Ga0373925_0012851 | 3300037068 | Bacteria | 6065 |
| 263 | Ga0373925_0028570 | 3300037068 | Bacteria | 4086 |
| 264 | Ga0373925_0053857 | 3300037068 | Unclassified | 3008 |
| 265 | Ga0373925_0069469 | 3300037068 | Bacteria | 2661 |
| 266 | Ga0373925_0074285 | 3300037068 | Bacteria | 2575 |
| 267 | Ga0373925_0275324 | 3300037068 | Bacteria | 1355 |
| 268 | Ga0395905_0001030 | 3300037471 | Bacteria | 35512 |
| 269 | Ga0395905_0001135 | 3300037471 | Bacteria | 33303 |
| 270 | Ga0436364_1075760 | 3300037853 | Bacteria | 10178 |
| 271 | Ga0436364_1352562 | 3300037853 | Bacteria | 66743 |
| 272 | Ga0436365_0664371 | 3300039437 | Bacteria | 2990 |
| 273 | Ga0436365_1652334 | 3300039437 | Bacteria | 1685 |
| 274 | Ga0436361_0694873 | 3300039447 | Bacteria | 1962 |
| 275 | Ga0466965_0044777 | 3300044683 | Bacteria | 2188 |
| 276 | Ga0466964_0012260 | 3300044706 | Bacteria | 3244 |
| 277 | Ga0453684_0313622 | 3300044712 | Bacteria | 1779 |
| 278 | Ga0466968_0049403 | 3300044735 | Bacteria | 1792 |
| 279 | Ga0466960_0012351 | 3300044901 | Bacteria | 3602 |
| 280 | Ga0451576_0254326 | 3300045051 | Bacteria | 1836 |
| 281 | Ga0466967_0008390 | 3300045976 | Bacteria | 7562 |
| 282 | Ga0466967_0095023 | 3300045976 | Bacteria | 2716 |
| 283 | Ga0495627_033879 | 3300046453 | Bacteria | 1599 |
| 284 | Ga0495592_0019252 | 3300046454 | Bacteria | 5194 |
| 285 | Ga0495592_0026796 | 3300046454 | Bacteria | 4370 |
| 286 | Ga0495592_0127416 | 3300046454 | Unclassified | 1784 |
| 287 | Ga0495603_0015424 | 3300046455 | Bacteria | 4622 |
| 288 | Ga0495603_0035565 | 3300046455 | Bacteria | 2991 |
| 289 | Ga0495590_0001787 | 3300046457 | Bacteria | 9120 |
| 290 | Ga0495629_0000042 | 3300046459 | Bacteria | 112605 |
| 291 | Ga0495629_0000138 | 3300046459 | Bacteria | 63867 |
| 292 | Ga0495629_0009468 | 3300046459 | Bacteria | 7125 |
| 293 | Ga0495629_0022819 | 3300046459 | Bacteria | 4459 |
| 294 | Ga0495629_0035061 | 3300046459 | Bacteria | 3547 |
| 295 | Ga0495638_0004088 | 3300046460 | Bacteria | 11175 |
| 296 | Ga0495638_0027312 | 3300046460 | Bacteria | 3695 |
| 297 | Ga0495641_0008929 | 3300046461 | Bacteria | 6027 |
| 298 | Ga0495641_0037115 | 3300046461 | Bacteria | 2286 |
| 299 | Ga0495641_0085122 | 3300046461 | Bacteria | 1415 |
| 300 | Ga0495651_0008321 | 3300046462 | Bacteria | 7950 |
| 301 | Ga0495653_0000321 | 3300046463 | Bacteria | 39085 |
| 302 | Ga0495653_0000446 | 3300046463 | Bacteria | 32368 |
| 303 | Ga0495653_0013384 | 3300046463 | Bacteria | 6686 |
| 304 | Ga0495650_0022526 | 3300046471 | Bacteria | 3019 |
| 305 | Ga0495580_0002848 | 3300046472 | Bacteria | 14881 |
| 306 | Ga0495580_0003831 | 3300046472 | Bacteria | 12716 |
| 307 | Ga0495580_0007637 | 3300046472 | Bacteria | 8674 |
| 308 | Ga0495580_0008581 | 3300046472 | Bacteria | 8109 |
| 309 | Ga0495580_0023475 | 3300046472 | Unclassified | 4528 |
| 310 | Ga0495580_0036026 | 3300046472 | Bacteria | 3555 |
| 311 | Ga0495580_0089303 | 3300046472 | Bacteria | 2145 |
| 312 | Ga0495580_0232880 | 3300046472 | Bacteria | 1264 |
| 313 | Ga0495582_0002241 | 3300046473 | Bacteria | 10829 |
| 314 | Ga0495582_0003196 | 3300046473 | Bacteria | 9206 |
| 315 | Ga0495582_0015023 | 3300046473 | Bacteria | 4258 |
| 316 | Ga0495582_0035701 | 3300046473 | Unclassified | 2734 |
| 317 | Ga0495582_0050932 | 3300046473 | Bacteria | 2283 |
| 318 | Ga0495605_0002503 | 3300046474 | Bacteria | 11364 |
| 319 | Ga0495605_0009908 | 3300046474 | Bacteria | 5343 |
| 320 | Ga0495605_0025718 | 3300046474 | Bacteria | 3065 |
| 321 | Ga0495662_0022327 | 3300046476 | Unclassified | 3056 |
| 322 | Ga0495662_0033953 | 3300046476 | Bacteria | 2464 |
| 323 | Ga0495664_0066590 | 3300046477 | Unclassified | 2148 |
| 324 | Ga0495664_0129153 | 3300046477 | Unclassified | 1530 |
| 325 | Ga0495584_0023923 | 3300046491 | Bacteria | 3097 |
| 326 | Ga0495584_0026185 | 3300046491 | Bacteria | 2955 |
| 327 | Ga0495585_0013503 | 3300046492 | Bacteria | 4776 |
| 328 | Ga0495585_0024997 | 3300046492 | Bacteria | 3423 |
| 329 | Ga0495607_0002323 | 3300046501 | Bacteria | 15587 |
| 330 | Ga0495583_0000789 | 3300046506 | Bacteria | 39441 |
| 331 | Ga0495583_0003588 | 3300046506 | Bacteria | 11655 |
| 332 | Ga0495583_0005487 | 3300046506 | Bacteria | 8592 |
| 333 | Ga0495583_0050943 | 3300046506 | Bacteria | 1890 |
| 334 | Ga0495606_0007081 | 3300046507 | Bacteria | 10143 |
| 335 | Ga0495608_0077927 | 3300046511 | Unclassified | 2157 |
| 336 | Ga0495610_0001257 | 3300046512 | Bacteria | 22761 |
| 337 | Ga0495616_0037014 | 3300046513 | Bacteria | 2514 |
| 338 | Ga0495620_0020291 | 3300046515 | Bacteria | 3248 |
| 339 | Ga0495628_0001775 | 3300046516 | Bacteria | 19628 |
| 340 | Ga0495628_0004238 | 3300046516 | Bacteria | 12750 |
| 341 | Ga0495630_0001163 | 3300046517 | Bacteria | 18174 |
| 342 | Ga0495630_0003840 | 3300046517 | Bacteria | 10483 |
| 343 | Ga0495630_0006265 | 3300046517 | Bacteria | 8447 |
| 344 | Ga0495630_0030567 | 3300046517 | Bacteria | 4007 |
| 345 | Ga0495644_0000597 | 3300046523 | Bacteria | 15124 |
| 346 | Ga0495648_0003381 | 3300046524 | Bacteria | 14040 |
| 347 | Ga0495648_0011886 | 3300046524 | Bacteria | 6530 |
| 348 | Ga0495648_0024280 | 3300046524 | Bacteria | 4132 |
| 349 | Ga0495648_0052277 | 3300046524 | Bacteria | 2482 |
| 350 | Ga0495648_0078045 | 3300046524 | Bacteria | 1895 |
| 351 | Ga0495666_0001806 | 3300046526 | Bacteria | 10574 |
| 352 | Ga0495642_0001523 | 3300046528 | Bacteria | 10290 |
| 353 | Ga0495652_0014832 | 3300046529 | Bacteria | 6986 |
| 354 | Ga0495665_0003795 | 3300046531 | Bacteria | 8179 |
| 355 | Ga0495665_0018966 | 3300046531 | Bacteria | 3697 |
| 356 | Ga0495665_0028332 | 3300046531 | Bacteria | 3003 |
| 357 | Ga0495640_0012679 | 3300046533 | Bacteria | 6435 |
| 358 | Ga0495640_0043740 | 3300046533 | Bacteria | 3117 |
| 359 | Ga0495586_0006751 | 3300046535 | Bacteria | 6128 |
| 360 | Ga0495587_0032199 | 3300046536 | Unclassified | 3170 |
| 361 | Ga0495587_0046890 | 3300046536 | Bacteria | 2564 |
| 362 | Ga0495609_0017184 | 3300046538 | Unclassified | 3362 |
| 363 | Ga0495609_0052329 | 3300046538 | Bacteria | 1817 |
| 364 | Ga0495621_0038518 | 3300046539 | Bacteria | 1668 |
| 365 | Ga0495597_0022666 | 3300046542 | Bacteria | 2911 |
| 366 | Ga0495597_0032947 | 3300046542 | Bacteria | 2349 |
| 367 | Ga0495645_0006001 | 3300046543 | Bacteria | 8400 |
| 368 | Ga0495645_0090168 | 3300046543 | Bacteria | 2191 |
| 369 | Ga0495645_0101050 | 3300046543 | Bacteria | 2051 |
| 370 | Ga0495622_0003932 | 3300046557 | Bacteria | 6937 |
| 371 | Ga0495622_0018169 | 3300046557 | Unclassified | 3275 |
| 372 | Ga0495633_0002701 | 3300046558 | Bacteria | 12309 |
| 373 | Ga0495656_0004064 | 3300046615 | Unclassified | 4980 |
| 374 | Ga0495656_0013548 | 3300046615 | Bacteria | 3036 |
| 375 | Ga0495634_0012451 | 3300046642 | Bacteria | 6155 |
| 376 | Ga0495611_0057110 | 3300046648 | Bacteria | 1768 |
| 377 | Ga0495625_0037942 | 3300046660 | Bacteria | 3530 |
| 378 | Ga0495635_0002054 | 3300046663 | Bacteria | 13644 |
| 379 | Ga0495635_0010307 | 3300046663 | Bacteria | 6536 |
| 380 | Ga0495635_0013165 | 3300046663 | Bacteria | 5791 |
| 381 | Ga0495661_0054835 | 3300046665 | Bacteria | 2392 |
| 382 | Ga0495588_0001664 | 3300046674 | Bacteria | 9476 |
| 383 | Ga0495599_0027877 | 3300046678 | Unclassified | 3538 |
| 384 | Ga0495623_0023322 | 3300046679 | Bacteria | 3994 |
| 385 | Ga0495646_0000273 | 3300046680 | Bacteria | 26278 |
| 386 | Ga0495646_0025995 | 3300046680 | Unclassified | 3677 |
| 387 | Ga0495647_0010347 | 3300046681 | Bacteria | 3173 |
| 388 | Ga0495658_0012862 | 3300046683 | Unclassified | 4251 |
| 389 | Ga0495658_0016656 | 3300046683 | Unclassified | 3783 |
| 390 | Ga0495669_0040223 | 3300046684 | Bacteria | 2073 |
| 391 | Ga0495613_0004866 | 3300046689 | Bacteria | 10082 |
| 392 | Ga0495613_0014024 | 3300046689 | Bacteria | 5949 |
| 393 | Ga0495613_0045610 | 3300046689 | Bacteria | 3241 |
| 394 | Ga0495613_0104326 | 3300046689 | Bacteria | 2047 |
| 395 | Ga0495613_0192422 | 3300046689 | Bacteria | 1441 |
| 396 | Ga0495624_0000216 | 3300046690 | Bacteria | 44450 |
| 397 | Ga0495624_0008826 | 3300046690 | Bacteria | 7008 |
| 398 | Ga0495624_0009706 | 3300046690 | Bacteria | 6662 |
| 399 | Ga0495624_0079688 | 3300046690 | Bacteria | 2030 |
| 400 | Ga0495670_0002872 | 3300046691 | Bacteria | 8505 |
| 401 | Ga0495671_0005979 | 3300046692 | Bacteria | 7075 |
| 402 | Ga0495671_0091193 | 3300046692 | Bacteria | 1491 |
| 403 | Ga0495649_0000242 | 3300046694 | Bacteria | 48020 |
| 404 | Ga0495649_0001737 | 3300046694 | Bacteria | 16085 |
| 405 | Ga0495649_0021882 | 3300046694 | Bacteria | 3581 |
| 406 | Ga0495589_0001320 | 3300046794 | Bacteria | 14562 |
| 407 | Ga0495589_0019368 | 3300046794 | Bacteria | 3490 |
| 408 | Ga0495589_0060281 | 3300046794 | Bacteria | 1864 |
| 409 | Ga0495660_0088169 | 3300046810 | Bacteria | 1617 |
| 410 | Ga0495581_0003464 | 3300047315 | Bacteria | 9055 |
| 411 | Ga0495581_0004873 | 3300047315 | Bacteria | 7766 |
| 412 | Ga0495604_0051127 | 3300047317 | Unclassified | 3205 |
| 413 | Ga0495604_0061181 | 3300047317 | Unclassified | 2881 |
| 414 | Ga0495636_0003571 | 3300047318 | Bacteria | 6030 |
| 415 | Ga0495636_0004315 | 3300047318 | Bacteria | 5580 |
| 416 | Ga0495674_0008140 | 3300047319 | Bacteria | 10003 |
| 417 | Ga0495674_0011538 | 3300047319 | Bacteria | 8336 |
| 418 | Ga0495674_0012860 | 3300047319 | Bacteria | 7882 |
| 419 | Ga0495674_0013683 | 3300047319 | Bacteria | 7623 |
| 420 | Ga0495674_0030914 | 3300047319 | Bacteria | 4866 |
| 421 | Ga0495674_0116670 | 3300047319 | Bacteria | 2258 |
| 422 | Ga0495674_0134161 | 3300047319 | Bacteria | 2084 |
| 423 | Ga0495672_0009676 | 3300047320 | Bacteria | 6954 |
| 424 | Ga0495672_0012479 | 3300047320 | Bacteria | 5926 |
| 425 | Ga0495676_0012375 | 3300047321 | Bacteria | 7687 |
| 426 | Ga0495676_0029297 | 3300047321 | Bacteria | 4689 |
| 427 | Ga0495676_0034143 | 3300047321 | Bacteria | 4271 |
| 428 | Ga0495676_0065974 | 3300047321 | Bacteria | 2807 |
| 429 | Ga0495680_0007070 | 3300047322 | Bacteria | 10340 |
| 430 | Ga0495680_0155888 | 3300047322 | Bacteria | 1661 |
| 431 | Ga0495683_0000360 | 3300047323 | Bacteria | 37542 |
| 432 | Ga0495683_0001184 | 3300047323 | Bacteria | 17808 |
| 433 | Ga0495683_0045001 | 3300047323 | Bacteria | 2218 |
| 434 | Ga0495683_0050657 | 3300047323 | Bacteria | 2077 |
| 435 | Ga0495687_011638 | 3300047443 | Bacteria | 4714 |
| 436 | Ga0495687_016804 | 3300047443 | Bacteria | 3670 |
| 437 | Ga0495675_0014782 | 3300047444 | Bacteria | 4935 |
| 438 | Ga0495679_000036 | 3300047446 | Bacteria | 161473 |
| 439 | Ga0495679_000345 | 3300047446 | Bacteria | 36393 |
| 440 | Ga0495673_0000424 | 3300047469 | Bacteria | 48017 |
| 441 | Ga0495673_0015972 | 3300047469 | Bacteria | 3851 |
| 442 | Ga0495681_0047132 | 3300047470 | Bacteria | 2052 |
| 443 | Ga0495684_0005507 | 3300047471 | Bacteria | 9858 |
| 444 | Ga0495684_0010002 | 3300047471 | Bacteria | 7332 |
| 445 | Ga0495686_0025429 | 3300047472 | Bacteria | 3881 |
| 446 | Ga0495593_0000149 | 3300047673 | Bacteria | 34606 |
| 447 | Ga0495593_0004070 | 3300047673 | Bacteria | 8703 |
| 448 | Ga0495593_0023237 | 3300047673 | Unclassified | 3448 |
| 449 | Ga0495602_0023268 | 3300048088 | Bacteria | 6041 |
| 450 | Ga0495602_0183895 | 3300048088 | Bacteria | 1609 |
| 451 | Ga0495614_0001261 | 3300048089 | Bacteria | 10874 |
| 452 | Ga0495614_0036449 | 3300048089 | Bacteria | 2112 |
| 453 | Ga0496100_0008741 | 3300048903 | Bacteria | 5659 |
| 454 | Ga0496100_0014315 | 3300048903 | Bacteria | 4602 |
| 455 | Ga0496101_0001966 | 3300048904 | Bacteria | 12453 |
| 456 | Ga0496101_0002634 | 3300048904 | Bacteria | 11019 |
| 457 | Ga0496102_0008102 | 3300048905 | Bacteria | 8989 |
| 458 | Ga0496102_0009383 | 3300048905 | Bacteria | 8404 |
| 459 | Ga0496102_0061808 | 3300048905 | Bacteria | 3429 |
| 460 | Ga0496102_0137287 | 3300048905 | Bacteria | 2291 |
| 461 | Ga0496103_0002359 | 3300048906 | Bacteria | 11914 |
| 462 | Ga0496103_0063963 | 3300048906 | Bacteria | 2292 |
| 463 | Ga0496103_0076835 | 3300048906 | Bacteria | 2096 |
| 464 | Ga0496104_0002958 | 3300048907 | Bacteria | 14632 |
| 465 | Ga0496104_0052295 | 3300048907 | Bacteria | 3858 |
| 466 | Ga0496104_0081769 | 3300048907 | Bacteria | 3080 |
| 467 | Ga0496106_0000003 | 3300048909 | Bacteria | 305293 |
| 468 | Ga0496106_0000032 | 3300048909 | Bacteria | 134707 |
| 469 | Ga0496106_0013742 | 3300048909 | Bacteria | 5979 |
| 470 | Ga0496106_0061578 | 3300048909 | Bacteria | 2847 |
| 471 | Ga0496106_0064880 | 3300048909 | Bacteria | 2779 |
| 472 | Ga0496107_0011824 | 3300048910 | Bacteria | 6095 |
| 473 | Ga0496107_0217981 | 3300048910 | Bacteria | 1419 |
| 474 | Ga0496107_0227243 | 3300048910 | Bacteria | 1388 |
| 475 | Ga0496108_0005821 | 3300048911 | Bacteria | 9991 |
| 476 | Ga0496108_0010386 | 3300048911 | Bacteria | 7561 |
| 477 | Ga0496108_0036535 | 3300048911 | Bacteria | 4087 |
| 478 | Ga0496108_0062283 | 3300048911 | Bacteria | 3141 |
| 479 | Ga0496109_0004418 | 3300048912 | Bacteria | 11746 |
| 480 | Ga0496109_0024349 | 3300048912 | Bacteria | 5381 |
| 481 | Ga0496109_0039169 | 3300048912 | Bacteria | 4288 |
| 482 | Ga0496110_0093710 | 3300048913 | Bacteria | 2688 |
| 483 | Ga0496110_0135296 | 3300048913 | Bacteria | 2227 |
| 484 | Ga0496110_0157611 | 3300048913 | Bacteria | 2057 |
| 485 | Ga0496111_0038873 | 3300048914 | Bacteria | 3409 |
| 486 | Ga0496111_0040605 | 3300048914 | Bacteria | 3338 |
| 487 | Ga0496112_0003353 | 3300048915 | Bacteria | 13215 |
| 488 | Ga0496112_0004542 | 3300048915 | Bacteria | 11791 |
| 489 | Ga0496112_0008562 | 3300048915 | Bacteria | 9168 |
| 490 | Ga0496112_0017034 | 3300048915 | Bacteria | 6822 |
| 491 | Ga0496113_0002552 | 3300048916 | Bacteria | 10629 |
| 492 | Ga0496113_0002993 | 3300048916 | Bacteria | 10004 |
| 493 | Ga0496113_0013645 | 3300048916 | Bacteria | 5514 |
| 494 | Ga0496113_0110345 | 3300048916 | Bacteria | 2140 |
| 495 | Ga0496113_0148976 | 3300048916 | Bacteria | 1845 |
| 496 | Ga0496114_0060491 | 3300048917 | Bacteria | 3166 |
| 497 | Ga0496114_0072436 | 3300048917 | Bacteria | 2898 |
| 498 | Ga0496114_0073911 | 3300048917 | Bacteria | 2869 |
| 499 | Ga0496115_0014251 | 3300048918 | Bacteria | 6018 |
| 500 | Ga0496115_0031112 | 3300048918 | Bacteria | 4203 |
| 501 | Ga0496115_0089862 | 3300048918 | Bacteria | 2508 |
| 502 | Ga0496117_0000903 | 3300048920 | Bacteria | 45688 |
| 503 | Ga0496117_0129168 | 3300048920 | Bacteria | 1535 |
| 504 | Ga0496118_0001642 | 3300048921 | Bacteria | 32972 |
| 505 | Ga0496118_0013136 | 3300048921 | Bacteria | 7861 |
| 506 | Ga0496118_0044806 | 3300048921 | Bacteria | 3460 |
| 507 | Ga0496118_0066688 | 3300048921 | Bacteria | 2626 |
| 508 | Ga0496121_0000540 | 3300048924 | Bacteria | 72033 |
| 509 | Ga0496121_0002263 | 3300048924 | Bacteria | 29956 |
| 510 | Ga0496121_0003588 | 3300048924 | Bacteria | 21901 |
| 511 | Ga0496121_0005258 | 3300048924 | Bacteria | 16726 |
| 512 | Ga0496121_0011954 | 3300048924 | Bacteria | 9551 |
| 513 | Ga0496121_0021136 | 3300048924 | Bacteria | 6391 |
| 514 | Ga0496124_0103653 | 3300048927 | Bacteria | 2301 |
| 515 | Ga0496126_0000118 | 3300048929 | Bacteria | 184719 |
| 516 | Ga0496126_0004459 | 3300048929 | Bacteria | 16727 |
| 517 | Ga0496126_0007159 | 3300048929 | Bacteria | 12279 |
| 518 | Ga0496126_0015198 | 3300048929 | Bacteria | 7750 |
| 519 | Ga0495682_0001396 | 3300049460 | Bacteria | 13163 |
| 520 | Ga0495682_0047455 | 3300049460 | Bacteria | 1566 |
| 521 | nmdc:mga00v17_107801_c1 | 3300050491 | Bacteria | 1764 |
| 522 | nmdc:mga0yw44_12570_c1 | 3300050492 | Bacteria | 4420 |
| 523 | nmdc:mga05p37_17000_c1 | 3300050507 | Bacteria | 8772 |
| 524 | nmdc:mga05p37_25194_c1 | 3300050507 | Bacteria | 7234 |
| 525 | nmdc:mga09592_10752_c1 | 3300050508 | Bacteria | 7440 |
| 526 | nmdc:mga08y16_139534_c1 | 3300050511 | Bacteria | 2520 |
| 527 | nmdc:mga08y16_305920_c1 | 3300050511 | Bacteria | 1638 |
| 528 | nmdc:mga08y16_75561_c1 | 3300050511 | Bacteria | 3512 |
| 529 | nmdc:mga0rr50_103643_c1 | 3300050513 | Bacteria | 2240 |
| 530 | nmdc:mga0rr50_116449_c1 | 3300050513 | Bacteria | 2122 |
| 531 | nmdc:mga0rr50_3348_c1 | 3300050513 | Bacteria | 9209 |
| 532 | nmdc:mga0rr50_59997_c1 | 3300050513 | Bacteria | 2859 |
| 533 | nmdc:mga08x19_102593_c1 | 3300050514 | Bacteria | 1900 |
| 534 | nmdc:mga08x19_20710_c1 | 3300050514 | Bacteria | 4052 |
| 535 | nmdc:mga08x19_4462_c1 | 3300050514 | Bacteria | 8292 |
| 536 | nmdc:mga08x19_48316_c1 | 3300050514 | Bacteria | 2726 |
| 537 | nmdc:mga08x19_5972_c1 | 3300050514 | Bacteria | 7200 |
| 538 | nmdc:mga0a205_53064_c1 | 3300050515 | Bacteria | 3912 |
| 539 | Ga0495601_0003272 | 3300053077 | Bacteria | 9263 |
| 540 | Ga0495595_0002751 | 3300053084 | Bacteria | 6906 |
| 541 | Ga0495619_0000266 | 3300053085 | Bacteria | 38066 |
| 542 | Ga0495619_0001146 | 3300053085 | Bacteria | 17400 |
| 543 | Ga0495619_0004895 | 3300053085 | Bacteria | 8506 |
| 544 | Ga0500643_000617 | 3300053087 | Bacteria | 24066 |
| 545 | Ga0500595_000022 | 3300053119 | Bacteria | 149029 |
| 546 | Ga0500595_000343 | 3300053119 | Bacteria | 30330 |
| 547 | Ga0500595_010944 | 3300053119 | Bacteria | 3576 |
| 548 | Ga0500595_018738 | 3300053119 | Bacteria | 2525 |
| 549 | Ga0500618_004181 | 3300053125 | Bacteria | 4702 |
| 550 | Ga0500642_0050863 | 3300053130 | Bacteria | 1828 |
| 551 | Ga0500652_000016 | 3300053131 | Bacteria | 126768 |
| 552 | Ga0500568_0033964 | 3300053139 | Bacteria | 2089 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046461 | Ga0495641_0085122 | Ga0495641_0085122_178_1398 | 370 |
| 2 | 3300046689 | Ga0495613_0192422 | Ga0495613_0192422_10_1200 | 396 |
| 3 | 3300047319 | Ga0495674_0116670 | Ga0495674_0116670_43_1284 | 400 |
| 4 | 3300035724 | Ga0373933_0003979 | Ga0373933_0003979_3158_4381 | 404 |
| 5 | 3300037068 | Ga0373925_0275324 | Ga0373925_0275324_111_1334 | 404 |
| 6 | 3300005334 | Ga0068869_100003694 | Ga0068869_1000036946 | 407 |
| 7 | 3300005338 | Ga0068868_100029271 | Ga0068868_1000292712 | 407 |
| 8 | 3300009553 | Ga0105249_10040762 | Ga0105249_100407622 | 407 |
| 9 | 3300025907 | Ga0207645_10032111 | Ga0207645_100321112 | 407 |
| 10 | 3300025942 | Ga0207689_10016457 | Ga0207689_100164575 | 407 |
| 11 | 3300025961 | Ga0207712_10267611 | Ga0207712_102676111 | 407 |
| 12 | 3300026118 | Ga0207675_100026489 | Ga0207675_1000264894 | 407 |
| 13 | 3300048913 | Ga0496110_0135296 | Ga0496110_0135296_240_1535 | 407 |
| 14 | 3300005327 | Ga0070658_10166819 | Ga0070658_101668191 | 408 |
| 15 | 3300005328 | Ga0070676_10042254 | Ga0070676_100422542 | 408 |
| 16 | 3300005331 | Ga0070670_100059137 | Ga0070670_1000591372 | 408 |
| 17 | 3300005337 | Ga0070682_100097568 | Ga0070682_1000975683 | 408 |
| 18 | 3300005339 | Ga0070660_100215417 | Ga0070660_1002154171 | 408 |
| 19 | 3300005365 | Ga0070688_100047854 | Ga0070688_1000478541 | 408 |
| 20 | 3300005455 | Ga0070663_100073179 | Ga0070663_1000731792 | 408 |
| 21 | 3300005456 | Ga0070678_100061524 | Ga0070678_1000615243 | 408 |
| 22 | 3300005466 | Ga0070685_10016150 | Ga0070685_100161502 | 408 |
| 23 | 3300005535 | Ga0070684_100059460 | Ga0070684_1000594601 | 408 |
| 24 | 3300005548 | Ga0070665_100050135 | Ga0070665_1000501352 | 408 |
| 25 | 3300005577 | Ga0068857_100026971 | Ga0068857_1000269712 | 408 |
| 26 | 3300005578 | Ga0068854_100012231 | Ga0068854_1000122314 | 408 |
| 27 | 3300005614 | Ga0068856_100032803 | Ga0068856_1000328032 | 408 |
| 28 | 3300005841 | Ga0068863_100232662 | Ga0068863_1002326621 | 408 |
| 29 | 3300005844 | Ga0068862_100026381 | Ga0068862_1000263813 | 408 |
| 30 | 3300009098 | Ga0105245_10241504 | Ga0105245_102415041 | 408 |
| 31 | 3300009148 | Ga0105243_10142522 | Ga0105243_101425222 | 408 |
| 32 | 3300010375 | Ga0105239_10093664 | Ga0105239_100936642 | 408 |
| 33 | 3300013102 | Ga0157371_10129791 | Ga0157371_101297912 | 408 |
| 34 | 3300013306 | Ga0163162_10048878 | Ga0163162_100488782 | 408 |
| 35 | 3300013307 | Ga0157372_10051957 | Ga0157372_100519573 | 408 |
| 36 | 3300013308 | Ga0157375_10063040 | Ga0157375_100630402 | 408 |
| 37 | 3300014325 | Ga0163163_10354568 | Ga0163163_103545681 | 408 |
| 38 | 3300025901 | Ga0207688_10000936 | Ga0207688_100009363 | 408 |
| 39 | 3300025919 | Ga0207657_10053510 | Ga0207657_100535102 | 408 |
| 40 | 3300025920 | Ga0207649_10200914 | Ga0207649_102009141 | 408 |
| 41 | 3300025981 | Ga0207640_10180408 | Ga0207640_101804081 | 408 |
| 42 | 3300026067 | Ga0207678_10023945 | Ga0207678_100239453 | 408 |
| 43 | 3300026095 | Ga0207676_10040441 | Ga0207676_100404412 | 408 |
| 44 | 3300028379 | Ga0268266_10023773 | Ga0268266_100237733 | 408 |
| 45 | 3300028380 | Ga0268265_10028392 | Ga0268265_100283921 | 408 |
| 46 | 3300048916 | Ga0496113_0148976 | Ga0496113_0148976_263_1558 | 408 |
| 47 | 3300009147 | Ga0114129_10335650 | Ga0114129_103356501 | 410 |
| 48 | 3300050507 | nmdc:mga05p37_17000_c1 | nmdc:mga05p37_17000_c1_481_1713 | 410 |
| 49 | 3300046472 | Ga0495580_0232880 | Ga0495580_0232880_10_1251 | 413 |
| 50 | 3300013296 | Ga0157374_10124162 | Ga0157374_101241622 | 414 |
| 51 | 3300005337 | Ga0070682_100045278 | Ga0070682_1000452782 | 415 |
| 52 | 3300005564 | Ga0070664_100208739 | Ga0070664_1002087391 | 415 |
| 53 | 3300005614 | Ga0068856_100054361 | Ga0068856_1000543613 | 415 |
| 54 | 3300013306 | Ga0163162_10000537 | Ga0163162_100005375 | 415 |
| 55 | 3300014325 | Ga0163163_10036874 | Ga0163163_100368744 | 415 |
| 56 | 3300025945 | Ga0207679_10159563 | Ga0207679_101595632 | 415 |
| 57 | 3300026078 | Ga0207702_10055930 | Ga0207702_100559302 | 415 |
| 58 | iso_pu_bacteria | 8054472261 | 8054472992 | 418 |
| 59 | 3300053119 | Ga0500595_010944 | Ga0500595_010944_1513_2847 | 419 |
| 60 | 3300046517 | Ga0495630_0030567 | Ga0495630_0030567_11_1291 | 420 |
| 61 | 3300046477 | Ga0495664_0129153 | Ga0495664_0129153_170_1435 | 421 |
| 62 | 3300046689 | Ga0495613_0104326 | Ga0495613_0104326_701_1966 | 421 |
| 63 | 3300045976 | Ga0466967_0095023 | Ga0466967_0095023_1146_2438 | 422 |
| 64 | 3300005983 | Ga0081540_1019791 | Ga0081540_10197913 | 423 |
| 65 | 3300044735 | Ga0466968_0049403 | Ga0466968_0049403_361_1656 | 423 |
| 66 | 3300046454 | Ga0495592_0026796 | Ga0495592_0026796_2042_3334 | 424 |
| 67 | 3300046476 | Ga0495662_0033953 | Ga0495662_0033953_370_1662 | 424 |
| 68 | 3300046543 | Ga0495645_0090168 | Ga0495645_0090168_158_1450 | 424 |
| 69 | 3300046692 | Ga0495671_0091193 | Ga0495671_0091193_41_1333 | 424 |
| 70 | 3300048920 | Ga0496117_0129168 | Ga0496117_0129168_28_1320 | 424 |
| 71 | 3300005563 | Ga0068855_100007415 | Ga0068855_1000074159 | 425 |
| 72 | 3300025949 | Ga0207667_10000991 | Ga0207667_1000099110 | 425 |
| 73 | 3300047319 | Ga0495674_0013683 | Ga0495674_0013683_5524_6852 | 425 |
| 74 | 3300048929 | Ga0496126_0004459 | Ga0496126_0004459_1103_2434 | 425 |
| 75 | 3300003320 | rootH2_10082695 | rootH2_100826951 | 426 |
| 76 | 3300005471 | Ga0070698_100081072 | Ga0070698_1000810722 | 427 |
| 77 | 3300031911 | Ga0307412_10012520 | Ga0307412_100125203 | 427 |
| 78 | 3300032002 | Ga0307416_100068362 | Ga0307416_1000683622 | 427 |
| 79 | 3300006880 | Ga0075429_100018845 | Ga0075429_1000188451 | 428 |
| 80 | 3300031731 | Ga0307405_10133807 | Ga0307405_101338071 | 428 |
| 81 | 3300045051 | Ga0451576_0254326 | Ga0451576_0254326_105_1394 | 428 |
| 82 | 3300048920 | Ga0496117_0000903 | Ga0496117_0000903_27536_28897 | 428 |
| 83 | 3300048921 | Ga0496118_0001642 | Ga0496118_0001642_23436_24797 | 428 |
| 84 | 3300048929 | Ga0496126_0000118 | Ga0496126_0000118_128670_130031 | 428 |
| 85 | 3300005615 | Ga0070702_100107834 | Ga0070702_1001078342 | 430 |
| 86 | 3300005842 | Ga0068858_100036520 | Ga0068858_1000365201 | 430 |
| 87 | 3300006871 | Ga0075434_100024408 | Ga0075434_1000244083 | 430 |
| 88 | 3300006914 | Ga0075436_100024183 | Ga0075436_1000241833 | 430 |
| 89 | 3300009148 | Ga0105243_10058699 | Ga0105243_100586993 | 430 |
| 90 | 3300010375 | Ga0105239_10086249 | Ga0105239_100862493 | 430 |
| 91 | 3300013306 | Ga0163162_10132775 | Ga0163162_101327751 | 430 |
| 92 | 3300013308 | Ga0157375_10372125 | Ga0157375_103721251 | 430 |
| 93 | 3300014968 | Ga0157379_10021040 | Ga0157379_100210406 | 430 |
| 94 | 3300014969 | Ga0157376_10037747 | Ga0157376_100377471 | 430 |
| 95 | 3300025900 | Ga0207710_10009027 | Ga0207710_100090273 | 430 |
| 96 | 3300025918 | Ga0207662_10097395 | Ga0207662_100973952 | 430 |
| 97 | 3300025927 | Ga0207687_10054012 | Ga0207687_100540122 | 430 |
| 98 | 3300025933 | Ga0207706_10133085 | Ga0207706_101330851 | 430 |
| 99 | 3300025941 | Ga0207711_10006706 | Ga0207711_100067063 | 430 |
| 100 | 3300026067 | Ga0207678_10048847 | Ga0207678_100488473 | 430 |
| 101 | 3300026121 | Ga0207683_10031497 | Ga0207683_100314974 | 430 |
| 102 | 3300028379 | Ga0268266_10001427 | Ga0268266_1000142710 | 430 |
| 103 | 3300035086 | Ga0373934_0002175 | Ga0373934_0002175_5273_6568 | 430 |
| 104 | 3300035089 | Ga0373944_0000852 | Ga0373944_0000852_3033_4367 | 430 |
| 105 | 3300035115 | Ga0373941_0003278 | Ga0373941_0003278_385_1719 | 430 |
| 106 | 3300035118 | Ga0373954_0063553 | Ga0373954_0063553_246_1541 | 430 |
| 107 | 3300035119 | Ga0373956_0004024 | Ga0373956_0004024_2401_3696 | 430 |
| 108 | 3300035120 | Ga0373957_0007369 | Ga0373957_0007369_1101_2396 | 430 |
| 109 | 3300035242 | Ga0373962_0021558 | Ga0373962_0021558_91_1425 | 430 |
| 110 | 3300035410 | Ga0373924_0022335 | Ga0373924_0022335_275_1609 | 430 |
| 111 | 3300035691 | Ga0373931_0003585 | Ga0373931_0003585_2695_4029 | 430 |
| 112 | 3300035724 | Ga0373933_0001112 | Ga0373933_0001112_14640_15935 | 430 |
| 113 | 3300035725 | Ga0373947_0013016 | Ga0373947_0013016_1970_3304 | 430 |
| 114 | 3300035725 | Ga0373947_0161211 | Ga0373947_0161211_86_1420 | 430 |
| 115 | 3300036401 | Ga0373937_0003821 | Ga0373937_0003821_8686_9981 | 430 |
| 116 | 3300037068 | Ga0373925_0028570 | Ga0373925_0028570_688_2022 | 430 |
| 117 | 3300037068 | Ga0373925_0053857 | Ga0373925_0053857_1343_2677 | 430 |
| 118 | 3300044712 | Ga0453684_0313622 | Ga0453684_0313622_250_1584 | 430 |
| 119 | 3300046453 | Ga0495627_033879 | Ga0495627_033879_97_1431 | 430 |
| 120 | 3300046461 | Ga0495641_0008929 | Ga0495641_0008929_453_1787 | 430 |
| 121 | 3300046462 | Ga0495651_0008321 | Ga0495651_0008321_1725_3059 | 430 |
| 122 | 3300046472 | Ga0495580_0023475 | Ga0495580_0023475_2080_3414 | 430 |
| 123 | 3300046473 | Ga0495582_0003196 | Ga0495582_0003196_5014_6348 | 430 |
| 124 | 3300046473 | Ga0495582_0035701 | Ga0495582_0035701_621_1955 | 430 |
| 125 | 3300046476 | Ga0495662_0022327 | Ga0495662_0022327_1527_2861 | 430 |
| 126 | 3300046477 | Ga0495664_0066590 | Ga0495664_0066590_798_2132 | 430 |
| 127 | 3300046501 | Ga0495607_0002323 | Ga0495607_0002323_4192_5526 | 430 |
| 128 | 3300046511 | Ga0495608_0077927 | Ga0495608_0077927_606_1940 | 430 |
| 129 | 3300046523 | Ga0495644_0000597 | Ga0495644_0000597_2890_4224 | 430 |
| 130 | 3300046536 | Ga0495587_0032199 | Ga0495587_0032199_169_1503 | 430 |
| 131 | 3300046538 | Ga0495609_0052329 | Ga0495609_0052329_355_1689 | 430 |
| 132 | 3300046557 | Ga0495622_0018169 | Ga0495622_0018169_1878_3212 | 430 |
| 133 | 3300046558 | Ga0495633_0002701 | Ga0495633_0002701_10884_12218 | 430 |
| 134 | 3300046615 | Ga0495656_0004064 | Ga0495656_0004064_2149_3483 | 430 |
| 135 | 3300046663 | Ga0495635_0013165 | Ga0495635_0013165_2072_3406 | 430 |
| 136 | 3300046674 | Ga0495588_0001664 | Ga0495588_0001664_4793_6127 | 430 |
| 137 | 3300046678 | Ga0495599_0027877 | Ga0495599_0027877_325_1659 | 430 |
| 138 | 3300046680 | Ga0495646_0025995 | Ga0495646_0025995_2197_3531 | 430 |
| 139 | 3300046681 | Ga0495647_0010347 | Ga0495647_0010347_1646_2980 | 430 |
| 140 | 3300046683 | Ga0495658_0012862 | Ga0495658_0012862_867_2201 | 430 |
| 141 | 3300046683 | Ga0495658_0016656 | Ga0495658_0016656_250_1584 | 430 |
| 142 | 3300046691 | Ga0495670_0002872 | Ga0495670_0002872_315_1649 | 430 |
| 143 | 3300046794 | Ga0495589_0060281 | Ga0495589_0060281_132_1466 | 430 |
| 144 | 3300047317 | Ga0495604_0051127 | Ga0495604_0051127_366_1700 | 430 |
| 145 | 3300047322 | Ga0495680_0155888 | Ga0495680_0155888_27_1361 | 430 |
| 146 | 3300047673 | Ga0495593_0023237 | Ga0495593_0023237_621_1955 | 430 |
| 147 | 3300048903 | Ga0496100_0008741 | Ga0496100_0008741_3099_4433 | 430 |
| 148 | 3300048904 | Ga0496101_0001966 | Ga0496101_0001966_4751_6085 | 430 |
| 149 | 3300048904 | Ga0496101_0002634 | Ga0496101_0002634_5346_6680 | 430 |
| 150 | 3300048905 | Ga0496102_0008102 | Ga0496102_0008102_6858_8192 | 430 |
| 151 | 3300048906 | Ga0496103_0002359 | Ga0496103_0002359_9055_10389 | 430 |
| 152 | 3300048907 | Ga0496104_0002958 | Ga0496104_0002958_9150_10484 | 430 |
| 153 | 3300048909 | Ga0496106_0013742 | Ga0496106_0013742_2983_4317 | 430 |
| 154 | 3300048910 | Ga0496107_0011824 | Ga0496107_0011824_4730_6064 | 430 |
| 155 | 3300048910 | Ga0496107_0227243 | Ga0496107_0227243_13_1347 | 430 |
| 156 | 3300048911 | Ga0496108_0062283 | Ga0496108_0062283_1754_3088 | 430 |
| 157 | 3300048915 | Ga0496112_0017034 | Ga0496112_0017034_1133_2467 | 430 |
| 158 | 3300048916 | Ga0496113_0110345 | Ga0496113_0110345_781_2115 | 430 |
| 159 | 3300048917 | Ga0496114_0060491 | Ga0496114_0060491_1181_2515 | 430 |
| 160 | 3300048918 | Ga0496115_0014251 | Ga0496115_0014251_4289_5623 | 430 |
| 161 | 3300048918 | Ga0496115_0089862 | Ga0496115_0089862_162_1496 | 430 |
| 162 | 3300050513 | nmdc:mga0rr50_103643_c1 | nmdc:mga0rr50_103643_c1_113_1447 | 430 |
| 163 | 3300050514 | nmdc:mga08x19_48316_c1 | nmdc:mga08x19_48316_c1_470_1804 | 430 |
| 164 | 3300053084 | Ga0495595_0002751 | Ga0495595_0002751_27_1361 | 430 |
| 165 | 3300053085 | Ga0495619_0000266 | Ga0495619_0000266_489_1823 | 430 |
| 166 | 3300053085 | Ga0495619_0004895 | Ga0495619_0004895_1881_3215 | 430 |
| 167 | 3300005437 | Ga0070710_10008395 | Ga0070710_100083953 | 431 |
| 168 | 3300021388 | Ga0213875_10000114 | Ga0213875_100001143 | 431 |
| 169 | 3300037853 | Ga0436364_1352562 | Ga0436364_1352562_8741_10051 | 431 |
| 170 | 3300005340 | Ga0070689_100144287 | Ga0070689_1001442871 | 432 |
| 171 | 3300005841 | Ga0068863_100105144 | Ga0068863_1001051442 | 432 |
| 172 | 3300005842 | Ga0068858_100080854 | Ga0068858_1000808543 | 432 |
| 173 | 3300005843 | Ga0068860_100262798 | Ga0068860_1002627982 | 432 |
| 174 | 3300006852 | Ga0075433_10025085 | Ga0075433_100250852 | 432 |
| 175 | 3300006871 | Ga0075434_100006963 | Ga0075434_10000696311 | 432 |
| 176 | 3300006914 | Ga0075436_100078701 | Ga0075436_1000787012 | 432 |
| 177 | 3300025936 | Ga0207670_10208548 | Ga0207670_102085481 | 432 |
| 178 | 3300026035 | Ga0207703_10018478 | Ga0207703_100184789 | 432 |
| 179 | 3300026095 | Ga0207676_10042430 | Ga0207676_100424302 | 432 |
| 180 | 3300028381 | Ga0268264_10174951 | Ga0268264_101749512 | 432 |
| 181 | 3300050511 | nmdc:mga08y16_139534_c1 | nmdc:mga08y16_139534_c1_692_1993 | 432 |
| 182 | 3300050513 | nmdc:mga0rr50_3348_c1 | nmdc:mga0rr50_3348_c1_6899_8200 | 432 |
| 183 | 3300050514 | nmdc:mga08x19_4462_c1 | nmdc:mga08x19_4462_c1_520_1821 | 432 |
| 184 | 3300005546 | Ga0070696_100025633 | Ga0070696_1000256337 | 433 |
| 185 | 3300035089 | Ga0373944_0022543 | Ga0373944_0022543_395_1699 | 433 |
| 186 | 3300035170 | Ga0373943_0054223 | Ga0373943_0054223_485_1789 | 433 |
| 187 | 3300035725 | Ga0373947_0023835 | Ga0373947_0023835_390_1694 | 433 |
| 188 | 3300037068 | Ga0373925_0012851 | Ga0373925_0012851_589_1893 | 433 |
| 189 | iso_pu_bacteria | 2596583598 | 2597028413 | 433 |
| 190 | iso_pu_bacteria | 2885266251 | 2885268619 | 433 |
| 191 | 3300035691 | Ga0373931_0083862 | Ga0373931_0083862_416_1729 | 434 |
| 192 | 3300046506 | Ga0495583_0000789 | Ga0495583_0000789_15421_16761 | 434 |
| 193 | 3300046515 | Ga0495620_0020291 | Ga0495620_0020291_888_2228 | 434 |
| 194 | 3300046524 | Ga0495648_0011886 | Ga0495648_0011886_3034_4374 | 434 |
| 195 | 3300046665 | Ga0495661_0054835 | Ga0495661_0054835_478_1818 | 434 |
| 196 | 3300046692 | Ga0495671_0005979 | Ga0495671_0005979_5607_6947 | 434 |
| 197 | 3300046694 | Ga0495649_0000242 | Ga0495649_0000242_35118_36458 | 434 |
| 198 | 3300047320 | Ga0495672_0009676 | Ga0495672_0009676_5571_6911 | 434 |
| 199 | 3300047323 | Ga0495683_0001184 | Ga0495683_0001184_10574_11914 | 434 |
| 200 | 3300047469 | Ga0495673_0000424 | Ga0495673_0000424_35092_36432 | 434 |
| 201 | 3300049460 | Ga0495682_0001396 | Ga0495682_0001396_5107_6447 | 434 |
| 202 | 3300005440 | Ga0070705_100116311 | Ga0070705_1001163111 | 435 |
| 203 | 3300005445 | Ga0070708_100301779 | Ga0070708_1003017792 | 435 |
| 204 | 3300005518 | Ga0070699_100061911 | Ga0070699_1000619113 | 435 |
| 205 | 3300005536 | Ga0070697_100035896 | Ga0070697_1000358962 | 435 |
| 206 | 3300005546 | Ga0070696_100109665 | Ga0070696_1001096652 | 435 |
| 207 | 3300007076 | Ga0075435_100072161 | Ga0075435_1000721613 | 435 |
| 208 | 3300025939 | Ga0207665_10056531 | Ga0207665_100565312 | 435 |
| 209 | 3300044706 | Ga0466964_0012260 | Ga0466964_0012260_976_2286 | 435 |
| 210 | 3300045976 | Ga0466967_0008390 | Ga0466967_0008390_3430_4740 | 435 |
| 211 | 3300050514 | nmdc:mga08x19_102593_c1 | nmdc:mga08x19_102593_c1_25_1335 | 435 |
| 212 | 3300050514 | nmdc:mga08x19_20710_c1 | nmdc:mga08x19_20710_c1_749_2059 | 435 |
| 213 | iso_pu_bacteria | 2721755763 | 2723878315 | 435 |
| 214 | 3300048909 | Ga0496106_0000003 | Ga0496106_0000003_150514_151914 | 436 |
| 215 | 3300048924 | Ga0496121_0021136 | Ga0496121_0021136_3055_4455 | 436 |
| 216 | 3300048905 | Ga0496102_0061808 | Ga0496102_0061808_1019_2380 | 437 |
| 217 | 3300048924 | Ga0496121_0000540 | Ga0496121_0000540_56417_57811 | 437 |
| 218 | iso_pu_bacteria | 2744054900 | 2746090160 | 437 |
| 219 | iso_pu_bacteria | 2744054901 | 2746095600 | 437 |
| 220 | 3300005335 | Ga0070666_10091492 | Ga0070666_100914923 | 438 |
| 221 | 3300006871 | Ga0075434_100202786 | Ga0075434_1002027861 | 438 |
| 222 | 3300009011 | Ga0105251_10041834 | Ga0105251_100418343 | 438 |
| 223 | 3300013306 | Ga0163162_10002420 | Ga0163162_1000242010 | 438 |
| 224 | 3300013308 | Ga0157375_10033616 | Ga0157375_100336162 | 438 |
| 225 | 3300025735 | Ga0207713_1039517 | Ga0207713_10395173 | 438 |
| 226 | 3300025903 | Ga0207680_10122590 | Ga0207680_101225901 | 438 |
| 227 | 3300025942 | Ga0207689_10141300 | Ga0207689_101413002 | 438 |
| 228 | 3300046460 | Ga0495638_0027312 | Ga0495638_0027312_1586_2968 | 438 |
| 229 | 3300046471 | Ga0495650_0022526 | Ga0495650_0022526_1515_2897 | 438 |
| 230 | 3300046491 | Ga0495584_0026185 | Ga0495584_0026185_91_1473 | 438 |
| 231 | 3300046492 | Ga0495585_0024997 | Ga0495585_0024997_732_2114 | 438 |
| 232 | 3300046506 | Ga0495583_0050943 | Ga0495583_0050943_193_1575 | 438 |
| 233 | 3300046542 | Ga0495597_0022666 | Ga0495597_0022666_97_1479 | 438 |
| 234 | 3300046794 | Ga0495589_0001320 | Ga0495589_0001320_1481_2863 | 438 |
| 235 | 3300048905 | Ga0496102_0009383 | Ga0496102_0009383_5119_6501 | 438 |
| 236 | 3300048906 | Ga0496103_0076835 | Ga0496103_0076835_452_1834 | 438 |
| 237 | 3300048907 | Ga0496104_0081769 | Ga0496104_0081769_203_1537 | 438 |
| 238 | 3300048909 | Ga0496106_0064880 | Ga0496106_0064880_862_2244 | 438 |
| 239 | 3300048911 | Ga0496108_0005821 | Ga0496108_0005821_2107_3441 | 438 |
| 240 | 3300048912 | Ga0496109_0004418 | Ga0496109_0004418_8296_9630 | 438 |
| 241 | 3300048914 | Ga0496111_0040605 | Ga0496111_0040605_746_2080 | 438 |
| 242 | 3300048915 | Ga0496112_0008562 | Ga0496112_0008562_4590_5924 | 438 |
| 243 | 3300048916 | Ga0496113_0002552 | Ga0496113_0002552_7344_8678 | 438 |
| 244 | 3300050515 | nmdc:mga0a205_53064_c1 | nmdc:mga0a205_53064_c1_467_1783 | 438 |
| 245 | iso_pu_bacteria | 2791355137 | 2792833562 | 438 |
| 246 | iso_pu_bacteria | 2904615490 | 2904618663 | 438 |
| 247 | 3300005471 | Ga0070698_100000549 | Ga0070698_10000054910 | 439 |
| 248 | 3300046491 | Ga0495584_0023923 | Ga0495584_0023923_1361_2680 | 439 |
| 249 | 3300046528 | Ga0495642_0001523 | Ga0495642_0001523_4948_6267 | 439 |
| 250 | 3300046615 | Ga0495656_0013548 | Ga0495656_0013548_652_1971 | 439 |
| 251 | 3300047318 | Ga0495636_0004315 | Ga0495636_0004315_3844_5163 | 439 |
| 252 | 3300047319 | Ga0495674_0030914 | Ga0495674_0030914_2836_4188 | 439 |
| 253 | 3300005937 | Ga0081455_10002226 | Ga0081455_1000222623 | 441 |
| 254 | 3300006871 | Ga0075434_100117751 | Ga0075434_1001177513 | 441 |
| 255 | 3300009094 | Ga0111539_10064923 | Ga0111539_100649232 | 441 |
| 256 | 3300021361 | Ga0213872_10049487 | Ga0213872_100494871 | 441 |
| 257 | 3300025302 | Ga0207426_1002260 | Ga0207426_100226012 | 441 |
| 258 | 3300037068 | Ga0373925_0069469 | Ga0373925_0069469_1048_2376 | 441 |
| 259 | 3300039447 | Ga0436361_0694873 | Ga0436361_0694873_230_1588 | 441 |
| 260 | 3300046454 | Ga0495592_0019252 | Ga0495592_0019252_3594_4946 | 441 |
| 261 | 3300046459 | Ga0495629_0000138 | Ga0495629_0000138_25205_26557 | 441 |
| 262 | 3300046459 | Ga0495629_0009468 | Ga0495629_0009468_5654_7006 | 441 |
| 263 | 3300046460 | Ga0495638_0004088 | Ga0495638_0004088_4674_6026 | 441 |
| 264 | 3300046463 | Ga0495653_0000446 | Ga0495653_0000446_5251_6603 | 441 |
| 265 | 3300046463 | Ga0495653_0013384 | Ga0495653_0013384_2766_4118 | 441 |
| 266 | 3300046472 | Ga0495580_0002848 | Ga0495580_0002848_8495_9847 | 441 |
| 267 | 3300046472 | Ga0495580_0007637 | Ga0495580_0007637_3758_5110 | 441 |
| 268 | 3300046473 | Ga0495582_0002241 | Ga0495582_0002241_8171_9523 | 441 |
| 269 | 3300046473 | Ga0495582_0050932 | Ga0495582_0050932_945_2273 | 441 |
| 270 | 3300046474 | Ga0495605_0009908 | Ga0495605_0009908_3183_4535 | 441 |
| 271 | 3300046506 | Ga0495583_0003588 | Ga0495583_0003588_4630_5982 | 441 |
| 272 | 3300046516 | Ga0495628_0004238 | Ga0495628_0004238_6153_7505 | 441 |
| 273 | 3300046517 | Ga0495630_0003840 | Ga0495630_0003840_5114_6466 | 441 |
| 274 | 3300046524 | Ga0495648_0024280 | Ga0495648_0024280_710_2062 | 441 |
| 275 | 3300046524 | Ga0495648_0078045 | Ga0495648_0078045_397_1749 | 441 |
| 276 | 3300046526 | Ga0495666_0001806 | Ga0495666_0001806_5519_6871 | 441 |
| 277 | 3300046529 | Ga0495652_0014832 | Ga0495652_0014832_4455_5807 | 441 |
| 278 | 3300046531 | Ga0495665_0018966 | Ga0495665_0018966_517_1869 | 441 |
| 279 | 3300046533 | Ga0495640_0012679 | Ga0495640_0012679_2222_3574 | 441 |
| 280 | 3300046535 | Ga0495586_0006751 | Ga0495586_0006751_4164_5516 | 441 |
| 281 | 3300046543 | Ga0495645_0006001 | Ga0495645_0006001_3087_4439 | 441 |
| 282 | 3300046642 | Ga0495634_0012451 | Ga0495634_0012451_4569_5921 | 441 |
| 283 | 3300046648 | Ga0495611_0057110 | Ga0495611_0057110_206_1558 | 441 |
| 284 | 3300046660 | Ga0495625_0037942 | Ga0495625_0037942_997_2349 | 441 |
| 285 | 3300046663 | Ga0495635_0002054 | Ga0495635_0002054_7674_9026 | 441 |
| 286 | 3300046679 | Ga0495623_0023322 | Ga0495623_0023322_2301_3653 | 441 |
| 287 | 3300046684 | Ga0495669_0040223 | Ga0495669_0040223_688_2040 | 441 |
| 288 | 3300046689 | Ga0495613_0004866 | Ga0495613_0004866_3962_5314 | 441 |
| 289 | 3300046690 | Ga0495624_0008826 | Ga0495624_0008826_615_1967 | 441 |
| 290 | 3300046690 | Ga0495624_0009706 | Ga0495624_0009706_4752_6104 | 441 |
| 291 | 3300047315 | Ga0495581_0003464 | Ga0495581_0003464_5209_6561 | 441 |
| 292 | 3300047319 | Ga0495674_0012860 | Ga0495674_0012860_3962_5314 | 441 |
| 293 | 3300047319 | Ga0495674_0134161 | Ga0495674_0134161_615_1967 | 441 |
| 294 | 3300047320 | Ga0495672_0012479 | Ga0495672_0012479_181_1533 | 441 |
| 295 | 3300047321 | Ga0495676_0012375 | Ga0495676_0012375_5464_6816 | 441 |
| 296 | 3300047321 | Ga0495676_0029297 | Ga0495676_0029297_1362_2714 | 441 |
| 297 | 3300047322 | Ga0495680_0007070 | Ga0495680_0007070_4896_6248 | 441 |
| 298 | 3300047443 | Ga0495687_016804 | Ga0495687_016804_757_2109 | 441 |
| 299 | 3300047444 | Ga0495675_0014782 | Ga0495675_0014782_2127_3479 | 441 |
| 300 | 3300047446 | Ga0495679_000036 | Ga0495679_000036_144904_146256 | 441 |
| 301 | 3300047446 | Ga0495679_000345 | Ga0495679_000345_10709_12061 | 441 |
| 302 | 3300047471 | Ga0495684_0005507 | Ga0495684_0005507_4557_5909 | 441 |
| 303 | 3300047472 | Ga0495686_0025429 | Ga0495686_0025429_1703_3055 | 441 |
| 304 | 3300047673 | Ga0495593_0004070 | Ga0495593_0004070_4990_6342 | 441 |
| 305 | 3300048088 | Ga0495602_0023268 | Ga0495602_0023268_235_1587 | 441 |
| 306 | 3300048088 | Ga0495602_0183895 | Ga0495602_0183895_139_1491 | 441 |
| 307 | 3300048089 | Ga0495614_0001261 | Ga0495614_0001261_6109_7461 | 441 |
| 308 | 3300048089 | Ga0495614_0036449 | Ga0495614_0036449_347_1699 | 441 |
| 309 | 3300048921 | Ga0496118_0013136 | Ga0496118_0013136_1215_2543 | 441 |
| 310 | 3300048921 | Ga0496118_0044806 | Ga0496118_0044806_51_1403 | 441 |
| 311 | 3300048924 | Ga0496121_0003588 | Ga0496121_0003588_902_2230 | 441 |
| 312 | 3300048924 | Ga0496121_0011954 | Ga0496121_0011954_3150_4502 | 441 |
| 313 | 3300048929 | Ga0496126_0015198 | Ga0496126_0015198_1180_2532 | 441 |
| 314 | 3300049460 | Ga0495682_0047455 | Ga0495682_0047455_34_1386 | 441 |
| 315 | 3300050511 | nmdc:mga08y16_75561_c1 | nmdc:mga08y16_75561_c1_453_1781 | 441 |
| 316 | 3300053125 | Ga0500618_004181 | Ga0500618_004181_2879_4279 | 441 |
| 317 | 3300005341 | Ga0070691_10029638 | Ga0070691_100296381 | 442 |
| 318 | 3300005435 | Ga0070714_100064859 | Ga0070714_1000648592 | 442 |
| 319 | 3300005444 | Ga0070694_100021398 | Ga0070694_1000213984 | 442 |
| 320 | 3300005455 | Ga0070663_100000451 | Ga0070663_10000045117 | 442 |
| 321 | 3300005545 | Ga0070695_100001841 | Ga0070695_1000018414 | 442 |
| 322 | 3300005983 | Ga0081540_1024793 | Ga0081540_10247933 | 442 |
| 323 | 3300006175 | Ga0070712_100017798 | Ga0070712_1000177988 | 442 |
| 324 | 3300006175 | Ga0070712_100086364 | Ga0070712_1000863642 | 442 |
| 325 | 3300006844 | Ga0075428_100040726 | Ga0075428_1000407262 | 442 |
| 326 | 3300006880 | Ga0075429_100063333 | Ga0075429_1000633332 | 442 |
| 327 | 3300009093 | Ga0105240_10018445 | Ga0105240_100184453 | 442 |
| 328 | 3300009551 | Ga0105238_10029091 | Ga0105238_100290914 | 442 |
| 329 | 3300025297 | Ga0209758_1003980 | Ga0209758_10039803 | 442 |
| 330 | 3300025915 | Ga0207693_10000828 | Ga0207693_1000082816 | 442 |
| 331 | 3300025915 | Ga0207693_10120391 | Ga0207693_101203911 | 442 |
| 332 | 3300025924 | Ga0207694_10006459 | Ga0207694_100064593 | 442 |
| 333 | 3300025929 | Ga0207664_10047651 | Ga0207664_100476515 | 442 |
| 334 | 3300026067 | Ga0207678_10008614 | Ga0207678_100086144 | 442 |
| 335 | 3300035089 | Ga0373944_0012483 | Ga0373944_0012483_164_1495 | 442 |
| 336 | 3300035170 | Ga0373943_0000492 | Ga0373943_0000492_15334_16665 | 442 |
| 337 | 3300035171 | Ga0373946_0001057 | Ga0373946_0001057_596_1927 | 442 |
| 338 | 3300035692 | Ga0373935_0085591 | Ga0373935_0085591_492_1823 | 442 |
| 339 | 3300035695 | Ga0373927_0001141 | Ga0373927_0001141_4046_5377 | 442 |
| 340 | 3300035725 | Ga0373947_0003127 | Ga0373947_0003127_1550_2881 | 442 |
| 341 | 3300037068 | Ga0373925_0074285 | Ga0373925_0074285_1158_2489 | 442 |
| 342 | 3300039437 | Ga0436365_0664371 | Ga0436365_0664371_1119_2450 | 442 |
| 343 | 3300046454 | Ga0495592_0127416 | Ga0495592_0127416_76_1407 | 442 |
| 344 | 3300046459 | Ga0495629_0035061 | Ga0495629_0035061_1141_2472 | 442 |
| 345 | 3300046472 | Ga0495580_0008581 | Ga0495580_0008581_228_1589 | 442 |
| 346 | 3300046472 | Ga0495580_0089303 | Ga0495580_0089303_345_1676 | 442 |
| 347 | 3300046517 | Ga0495630_0001163 | Ga0495630_0001163_3700_5031 | 442 |
| 348 | 3300046536 | Ga0495587_0046890 | Ga0495587_0046890_979_2310 | 442 |
| 349 | 3300046689 | Ga0495613_0014024 | Ga0495613_0014024_4420_5751 | 442 |
| 350 | 3300047315 | Ga0495581_0004873 | Ga0495581_0004873_3760_5091 | 442 |
| 351 | 3300047471 | Ga0495684_0010002 | Ga0495684_0010002_2953_4284 | 442 |
| 352 | 3300050508 | nmdc:mga09592_10752_c1 | nmdc:mga09592_10752_c1_4476_5807 | 442 |
| 353 | 3300053119 | Ga0500595_000343 | Ga0500595_000343_12228_13559 | 442 |
| 354 | 3300005331 | Ga0070670_100078153 | Ga0070670_1000781533 | 443 |
| 355 | 3300005334 | Ga0068869_100043661 | Ga0068869_1000436612 | 443 |
| 356 | 3300005340 | Ga0070689_100014709 | Ga0070689_1000147095 | 443 |
| 357 | 3300005341 | Ga0070691_10034176 | Ga0070691_100341761 | 443 |
| 358 | 3300005353 | Ga0070669_100040898 | Ga0070669_1000408983 | 443 |
| 359 | 3300005354 | Ga0070675_100052908 | Ga0070675_1000529083 | 443 |
| 360 | 3300005434 | Ga0070709_10108742 | Ga0070709_101087421 | 443 |
| 361 | 3300005435 | Ga0070714_100148553 | Ga0070714_1001485532 | 443 |
| 362 | 3300005444 | Ga0070694_100129865 | Ga0070694_1001298652 | 443 |
| 363 | 3300005455 | Ga0070663_100149043 | Ga0070663_1001490431 | 443 |
| 364 | 3300005459 | Ga0068867_100051720 | Ga0068867_1000517202 | 443 |
| 365 | 3300005535 | Ga0070684_100033013 | Ga0070684_1000330132 | 443 |
| 366 | 3300005543 | Ga0070672_100112458 | Ga0070672_1001124581 | 443 |
| 367 | 3300005578 | Ga0068854_100009305 | Ga0068854_1000093053 | 443 |
| 368 | 3300005615 | Ga0070702_100010331 | Ga0070702_1000103312 | 443 |
| 369 | 3300005616 | Ga0068852_100086168 | Ga0068852_1000861683 | 443 |
| 370 | 3300005719 | Ga0068861_100035421 | Ga0068861_1000354212 | 443 |
| 371 | 3300005842 | Ga0068858_100048009 | Ga0068858_1000480092 | 443 |
| 372 | 3300006038 | Ga0075365_10054021 | Ga0075365_100540212 | 443 |
| 373 | 3300006177 | Ga0075362_10030415 | Ga0075362_100304152 | 443 |
| 374 | 3300006178 | Ga0075367_10038185 | Ga0075367_100381852 | 443 |
| 375 | 3300006237 | Ga0097621_100066201 | Ga0097621_1000662013 | 443 |
| 376 | 3300006871 | Ga0075434_100109950 | Ga0075434_1001099503 | 443 |
| 377 | 3300006881 | Ga0068865_100067191 | Ga0068865_1000671911 | 443 |
| 378 | 3300007788 | Ga0099795_10031872 | Ga0099795_100318722 | 443 |
| 379 | 3300009094 | Ga0111539_10063999 | Ga0111539_100639992 | 443 |
| 380 | 3300009101 | Ga0105247_10008565 | Ga0105247_100085652 | 443 |
| 381 | 3300009147 | Ga0114129_10009585 | Ga0114129_1000958525 | 443 |
| 382 | 3300009147 | Ga0114129_10024927 | Ga0114129_100249273 | 443 |
| 383 | 3300009545 | Ga0105237_10059075 | Ga0105237_100590753 | 443 |
| 384 | 3300009551 | Ga0105238_10093250 | Ga0105238_100932503 | 443 |
| 385 | 3300010159 | Ga0099796_10013301 | Ga0099796_100133012 | 443 |
| 386 | 3300010375 | Ga0105239_10135402 | Ga0105239_101354021 | 443 |
| 387 | 3300014325 | Ga0163163_10260043 | Ga0163163_102600432 | 443 |
| 388 | 3300014745 | Ga0157377_10001914 | Ga0157377_100019146 | 443 |
| 389 | 3300025908 | Ga0207643_10000233 | Ga0207643_1000023314 | 443 |
| 390 | 3300025918 | Ga0207662_10012424 | Ga0207662_100124241 | 443 |
| 391 | 3300025919 | Ga0207657_10034859 | Ga0207657_100348592 | 443 |
| 392 | 3300025924 | Ga0207694_10144756 | Ga0207694_101447562 | 443 |
| 393 | 3300025925 | Ga0207650_10094737 | Ga0207650_100947372 | 443 |
| 394 | 3300025927 | Ga0207687_10045165 | Ga0207687_100451652 | 443 |
| 395 | 3300025929 | Ga0207664_10140353 | Ga0207664_101403532 | 443 |
| 396 | 3300025933 | Ga0207706_10003937 | Ga0207706_100039378 | 443 |
| 397 | 3300025940 | Ga0207691_10032224 | Ga0207691_100322242 | 443 |
| 398 | 3300025960 | Ga0207651_10051446 | Ga0207651_100514462 | 443 |
| 399 | 3300025961 | Ga0207712_10018184 | Ga0207712_100181842 | 443 |
| 400 | 3300026067 | Ga0207678_10015183 | Ga0207678_100151836 | 443 |
| 401 | 3300026075 | Ga0207708_10000911 | Ga0207708_100009112 | 443 |
| 402 | 3300026116 | Ga0207674_10122403 | Ga0207674_101224032 | 443 |
| 403 | 3300026118 | Ga0207675_100005973 | Ga0207675_1000059733 | 443 |
| 404 | 3300026142 | Ga0207698_10056130 | Ga0207698_100561303 | 443 |
| 405 | 3300027512 | Ga0209179_1003277 | Ga0209179_10032772 | 443 |
| 406 | 3300027907 | Ga0207428_10085020 | Ga0207428_100850202 | 443 |
| 407 | 3300028379 | Ga0268266_10058883 | Ga0268266_100588833 | 443 |
| 408 | 3300028800 | Ga0265338_10007619 | Ga0265338_1000761914 | 443 |
| 409 | 3300028800 | Ga0265338_10102309 | Ga0265338_101023093 | 443 |
| 410 | 3300031235 | Ga0265330_10012904 | Ga0265330_100129042 | 443 |
| 411 | 3300031241 | Ga0265325_10010113 | Ga0265325_100101132 | 443 |
| 412 | 3300031241 | Ga0265325_10032102 | Ga0265325_100321022 | 443 |
| 413 | 3300031247 | Ga0265340_10026558 | Ga0265340_100265583 | 443 |
| 414 | 3300031344 | Ga0265316_10004646 | Ga0265316_100046465 | 443 |
| 415 | 3300031595 | Ga0265313_10021023 | Ga0265313_100210233 | 443 |
| 416 | 3300031595 | Ga0265313_10053409 | Ga0265313_100534092 | 443 |
| 417 | 3300031712 | Ga0265342_10023388 | Ga0265342_100233884 | 443 |
| 418 | 3300035089 | Ga0373944_0005991 | Ga0373944_0005991_69_1403 | 443 |
| 419 | 3300035090 | Ga0373949_0015790 | Ga0373949_0015790_223_1557 | 443 |
| 420 | 3300035113 | Ga0373936_0022227 | Ga0373936_0022227_612_1946 | 443 |
| 421 | 3300035116 | Ga0373945_0001338 | Ga0373945_0001338_970_2304 | 443 |
| 422 | 3300035170 | Ga0373943_0009828 | Ga0373943_0009828_214_1548 | 443 |
| 423 | 3300035171 | Ga0373946_0050017 | Ga0373946_0050017_192_1526 | 443 |
| 424 | 3300035692 | Ga0373935_0034718 | Ga0373935_0034718_444_1778 | 443 |
| 425 | 3300035692 | Ga0373935_0158758 | Ga0373935_0158758_34_1368 | 443 |
| 426 | 3300035695 | Ga0373927_0021771 | Ga0373927_0021771_2547_3881 | 443 |
| 427 | 3300035725 | Ga0373947_0006841 | Ga0373947_0006841_3725_5059 | 443 |
| 428 | 3300035725 | Ga0373947_0065598 | Ga0373947_0065598_13_1347 | 443 |
| 429 | 3300036401 | Ga0373937_0022352 | Ga0373937_0022352_1938_3272 | 443 |
| 430 | 3300036401 | Ga0373937_0034794 | Ga0373937_0034794_133_1467 | 443 |
| 431 | 3300037068 | Ga0373925_0002878 | Ga0373925_0002878_11450_12784 | 443 |
| 432 | 3300039437 | Ga0436365_1652334 | Ga0436365_1652334_210_1544 | 443 |
| 433 | 3300046455 | Ga0495603_0015424 | Ga0495603_0015424_2455_3789 | 443 |
| 434 | 3300046459 | Ga0495629_0022819 | Ga0495629_0022819_1944_3278 | 443 |
| 435 | 3300046461 | Ga0495641_0037115 | Ga0495641_0037115_442_1776 | 443 |
| 436 | 3300046473 | Ga0495582_0015023 | Ga0495582_0015023_786_2120 | 443 |
| 437 | 3300046517 | Ga0495630_0006265 | Ga0495630_0006265_1166_2500 | 443 |
| 438 | 3300046533 | Ga0495640_0043740 | Ga0495640_0043740_51_1466 | 443 |
| 439 | 3300046539 | Ga0495621_0038518 | Ga0495621_0038518_215_1582 | 443 |
| 440 | 3300046543 | Ga0495645_0101050 | Ga0495645_0101050_477_1811 | 443 |
| 441 | 3300046663 | Ga0495635_0010307 | Ga0495635_0010307_1326_2660 | 443 |
| 442 | 3300046690 | Ga0495624_0079688 | Ga0495624_0079688_529_1863 | 443 |
| 443 | 3300047317 | Ga0495604_0061181 | Ga0495604_0061181_289_1623 | 443 |
| 444 | 3300047321 | Ga0495676_0034143 | Ga0495676_0034143_2316_3650 | 443 |
| 445 | 3300047470 | Ga0495681_0047132 | Ga0495681_0047132_298_1632 | 443 |
| 446 | 3300048905 | Ga0496102_0137287 | Ga0496102_0137287_640_1974 | 443 |
| 447 | 3300048906 | Ga0496103_0063963 | Ga0496103_0063963_779_2113 | 443 |
| 448 | 3300048907 | Ga0496104_0052295 | Ga0496104_0052295_488_1822 | 443 |
| 449 | 3300048909 | Ga0496106_0061578 | Ga0496106_0061578_475_1809 | 443 |
| 450 | 3300048910 | Ga0496107_0217981 | Ga0496107_0217981_47_1381 | 443 |
| 451 | 3300048911 | Ga0496108_0010386 | Ga0496108_0010386_3665_4999 | 443 |
| 452 | 3300048911 | Ga0496108_0036535 | Ga0496108_0036535_1596_2930 | 443 |
| 453 | 3300048912 | Ga0496109_0024349 | Ga0496109_0024349_2783_4117 | 443 |
| 454 | 3300048912 | Ga0496109_0039169 | Ga0496109_0039169_850_2184 | 443 |
| 455 | 3300048913 | Ga0496110_0093710 | Ga0496110_0093710_727_2061 | 443 |
| 456 | 3300048913 | Ga0496110_0157611 | Ga0496110_0157611_633_1967 | 443 |
| 457 | 3300048914 | Ga0496111_0038873 | Ga0496111_0038873_2001_3335 | 443 |
| 458 | 3300048915 | Ga0496112_0004542 | Ga0496112_0004542_3250_4584 | 443 |
| 459 | 3300048916 | Ga0496113_0013645 | Ga0496113_0013645_447_1781 | 443 |
| 460 | 3300048917 | Ga0496114_0072436 | Ga0496114_0072436_308_1642 | 443 |
| 461 | 3300048917 | Ga0496114_0073911 | Ga0496114_0073911_563_1897 | 443 |
| 462 | 3300050491 | nmdc:mga00v17_107801_c1 | nmdc:mga00v17_107801_c1_386_1720 | 443 |
| 463 | 3300050492 | nmdc:mga0yw44_12570_c1 | nmdc:mga0yw44_12570_c1_2116_3450 | 443 |
| 464 | 3300050507 | nmdc:mga05p37_25194_c1 | nmdc:mga05p37_25194_c1_5005_6339 | 443 |
| 465 | 3300050511 | nmdc:mga08y16_305920_c1 | nmdc:mga08y16_305920_c1_143_1477 | 443 |
| 466 | 3300053077 | Ga0495601_0003272 | Ga0495601_0003272_1116_2450 | 443 |
| 467 | 3300053085 | Ga0495619_0001146 | Ga0495619_0001146_15894_17228 | 443 |
| 468 | 3300053087 | Ga0500643_000617 | Ga0500643_000617_9666_11000 | 443 |
| 469 | 3300053119 | Ga0500595_000022 | Ga0500595_000022_73499_74833 | 443 |
| 470 | 3300053119 | Ga0500595_018738 | Ga0500595_018738_918_2279 | 443 |
| 471 | 3300053130 | Ga0500642_0050863 | Ga0500642_0050863_257_1591 | 443 |
| 472 | 3300053131 | Ga0500652_000016 | Ga0500652_000016_124028_125389 | 443 |
| 473 | 3300053139 | Ga0500568_0033964 | Ga0500568_0033964_547_1881 | 443 |
| 474 | 3300005434 | Ga0070709_10091406 | Ga0070709_100914061 | 444 |
| 475 | 3300006914 | Ga0075436_100004329 | Ga0075436_1000043292 | 444 |
| 476 | 3300007076 | Ga0075435_100095244 | Ga0075435_1000952442 | 444 |
| 477 | 3300021388 | Ga0213875_10001351 | Ga0213875_100013517 | 444 |
| 478 | 3300037853 | Ga0436364_1075760 | Ga0436364_1075760_7935_9272 | 444 |
| 479 | 3300050513 | nmdc:mga0rr50_59997_c1 | nmdc:mga0rr50_59997_c1_875_2311 | 444 |
| 480 | 3300050514 | nmdc:mga08x19_5972_c1 | nmdc:mga08x19_5972_c1_737_2173 | 444 |
| 481 | 3300005336 | Ga0070680_100076467 | Ga0070680_1000764672 | 445 |
| 482 | 3300005615 | Ga0070702_100102084 | Ga0070702_1001020841 | 445 |
| 483 | 3300025918 | Ga0207662_10115738 | Ga0207662_101157382 | 445 |
| 484 | 3300005295 | Ga0065707_10095351 | Ga0065707_100953512 | 449 |
| 485 | 3300005468 | Ga0070707_100017912 | Ga0070707_1000179121 | 449 |
| 486 | 3300005471 | Ga0070698_100078682 | Ga0070698_1000786822 | 449 |
| 487 | 3300005536 | Ga0070697_100122601 | Ga0070697_1001226012 | 449 |
| 488 | 3300005549 | Ga0070704_100004652 | Ga0070704_1000046526 | 449 |
| 489 | 3300009147 | Ga0114129_10092130 | Ga0114129_100921304 | 449 |
| 490 | 3300009148 | Ga0105243_10018193 | Ga0105243_100181934 | 449 |
| 491 | 3300044683 | Ga0466965_0044777 | Ga0466965_0044777_328_1680 | 449 |
| 492 | 3300046538 | Ga0495609_0017184 | Ga0495609_0017184_66_1418 | 449 |
| 493 | 3300047318 | Ga0495636_0003571 | Ga0495636_0003571_1396_2748 | 449 |
| 494 | 3300005518 | Ga0070699_100001070 | Ga0070699_10000107024 | 450 |
| 495 | 3300005546 | Ga0070696_100069223 | Ga0070696_1000692232 | 450 |
| 496 | 3300037471 | Ga0395905_0001030 | Ga0395905_0001030_27190_28545 | 450 |
| 497 | 3300046492 | Ga0495585_0013503 | Ga0495585_0013503_2526_3881 | 450 |
| 498 | 3300046513 | Ga0495616_0037014 | Ga0495616_0037014_54_1409 | 450 |
| 499 | 3300050513 | nmdc:mga0rr50_116449_c1 | nmdc:mga0rr50_116449_c1_455_1813 | 451 |
| 500 | iso_pu_bacteria | 2513237166 | 2514047036 | 455 |
| 501 | iso_pu_bacteria | 2562617112 | 2563064900 | 455 |
| 502 | iso_pu_bacteria | 2711768613 | 2713482111 | 455 |
| 503 | 3300003354 | JGI25160J50197_1000039 | JGI25160J50197_100003925 | 457 |
| 504 | 3300005262 | Ga0065165_1000319 | Ga0065165_100031950 | 457 |
| 505 | 3300025284 | Ga0209130_1003787 | Ga0209130_10037873 | 457 |
| 506 | 3300025302 | Ga0207426_1000018 | Ga0207426_1000018209 | 457 |
| 507 | 3300044901 | Ga0466960_0012351 | Ga0466960_0012351_308_1702 | 457 |
| 508 | 3300003320 | rootH2_10067189 | rootH2_100671893 | 458 |
| 509 | 3300003323 | rootH1_10050528 | rootH1_100505283 | 458 |
| 510 | 3300048909 | Ga0496106_0000032 | Ga0496106_0000032_115980_117365 | 458 |
| 511 | 3300048924 | Ga0496121_0005258 | Ga0496121_0005258_12680_14065 | 458 |
| 512 | 3300048927 | Ga0496124_0103653 | Ga0496124_0103653_461_1846 | 458 |
| 513 | 3300003354 | JGI25160J50197_1000652 | JGI25160J50197_100065210 | 459 |
| 514 | 3300005262 | Ga0065165_1000319 | Ga0065165_100031971 | 459 |
| 515 | 3300025284 | Ga0209130_1002965 | Ga0209130_10029657 | 459 |
| 516 | 3300025302 | Ga0207426_1000018 | Ga0207426_1000018230 | 459 |
| 517 | 3300037471 | Ga0395905_0001135 | Ga0395905_0001135_21944_23323 | 459 |
| 518 | 3300046455 | Ga0495603_0035565 | Ga0495603_0035565_1003_2382 | 459 |
| 519 | 3300046472 | Ga0495580_0036026 | Ga0495580_0036026_1815_3194 | 459 |
| 520 | 3300046474 | Ga0495605_0025718 | Ga0495605_0025718_160_1539 | 459 |
| 521 | 3300046506 | Ga0495583_0005487 | Ga0495583_0005487_1847_3226 | 459 |
| 522 | 3300046524 | Ga0495648_0052277 | Ga0495648_0052277_509_1888 | 459 |
| 523 | 3300046531 | Ga0495665_0028332 | Ga0495665_0028332_834_2213 | 459 |
| 524 | 3300046557 | Ga0495622_0003932 | Ga0495622_0003932_4083_5462 | 459 |
| 525 | 3300046694 | Ga0495649_0021882 | Ga0495649_0021882_860_2239 | 459 |
| 526 | 3300046794 | Ga0495589_0019368 | Ga0495589_0019368_792_2171 | 459 |
| 527 | 3300047319 | Ga0495674_0008140 | Ga0495674_0008140_8236_9615 | 459 |
| 528 | 3300047323 | Ga0495683_0045001 | Ga0495683_0045001_476_1855 | 459 |
| 529 | 3300047469 | Ga0495673_0015972 | Ga0495673_0015972_897_2276 | 459 |
| 530 | 3300048903 | Ga0496100_0014315 | Ga0496100_0014315_1084_2463 | 459 |
| 531 | 3300048915 | Ga0496112_0003353 | Ga0496112_0003353_6464_7843 | 459 |
| 532 | 3300048916 | Ga0496113_0002993 | Ga0496113_0002993_2188_3567 | 459 |
| 533 | 3300048918 | Ga0496115_0031112 | Ga0496115_0031112_1652_3031 | 459 |
| 534 | 3300048921 | Ga0496118_0066688 | Ga0496118_0066688_404_1876 | 459 |
| 535 | 3300048924 | Ga0496121_0002263 | Ga0496121_0002263_25114_26493 | 459 |
| 536 | iso_pu_bacteria | 2508501125 | 2509129573 | 459 |
| 537 | 3300048929 | Ga0496126_0007159 | Ga0496126_0007159_1640_3040 | 460 |
| 538 | 3300046459 | Ga0495629_0000042 | Ga0495629_0000042_26024_27418 | 461 |
| 539 | 3300046463 | Ga0495653_0000321 | Ga0495653_0000321_15599_16993 | 461 |
| 540 | 3300046472 | Ga0495580_0003831 | Ga0495580_0003831_8523_9917 | 461 |
| 541 | 3300046516 | Ga0495628_0001775 | Ga0495628_0001775_10214_11608 | 461 |
| 542 | 3300046524 | Ga0495648_0003381 | Ga0495648_0003381_10470_11864 | 461 |
| 543 | 3300046531 | Ga0495665_0003795 | Ga0495665_0003795_1804_3198 | 461 |
| 544 | 3300046680 | Ga0495646_0000273 | Ga0495646_0000273_13255_14649 | 461 |
| 545 | 3300046689 | Ga0495613_0045610 | Ga0495613_0045610_1510_2904 | 461 |
| 546 | 3300046690 | Ga0495624_0000216 | Ga0495624_0000216_26024_27418 | 461 |
| 547 | 3300047319 | Ga0495674_0011538 | Ga0495674_0011538_3691_5085 | 461 |
| 548 | 3300047321 | Ga0495676_0065974 | Ga0495676_0065974_334_1728 | 461 |
| 549 | 3300047673 | Ga0495593_0000149 | Ga0495593_0000149_22818_24212 | 461 |
| 550 | iso_pu_bacteria | 2904483920 | 2904486501 | 462 |
| 551 | iso_pu_bacteria | 8055301274 | 8055304502 | 462 |
| 552 | iso_pu_bacteria | 2738541296 | 2738822668 | 463 |
| 553 | iso_pu_bacteria | 2738541298 | 2738834875 | 463 |
| 554 | iso_pu_bacteria | 2738541306 | 2738876354 | 463 |
| 555 | iso_pu_bacteria | 2738543002 | 2739188298 | 463 |
| 556 | iso_pu_bacteria | 2738543008 | 2739222951 | 463 |
| 557 | iso_pu_bacteria | 2945934425 | 2945940031 | 463 |
| 558 | iso_pu_bacteria | 2990703756 | 2990707155 | 463 |
| 559 | iso_pu_bacteria | 641736151 | 642424110 | 463 |
| 560 | 3300046457 | Ga0495590_0001787 | Ga0495590_0001787_1482_2915 | 466 |
| 561 | 3300046507 | Ga0495606_0007081 | Ga0495606_0007081_4721_6154 | 466 |
| 562 | 3300046542 | Ga0495597_0032947 | Ga0495597_0032947_65_1498 | 466 |
| 563 | 3300046694 | Ga0495649_0001737 | Ga0495649_0001737_12960_14393 | 466 |
| 564 | 3300047323 | Ga0495683_0000360 | Ga0495683_0000360_9432_10865 | 466 |
| 565 | 3300047443 | Ga0495687_011638 | Ga0495687_011638_1524_2957 | 466 |
| 566 | 3300001979 | JGI24740J21852_10010481 | JGI24740J21852_100104813 | 467 |
| 567 | 3300001989 | JGI24739J22299_10004836 | JGI24739J22299_100048363 | 467 |
| 568 | 3300002075 | JGI24738J21930_10005402 | JGI24738J21930_100054022 | 467 |
| 569 | 3300005455 | Ga0070663_100158070 | Ga0070663_1001580702 | 467 |
| 570 | 3300013105 | Ga0157369_10128014 | Ga0157369_101280142 | 467 |
| 571 | 3300026067 | Ga0207678_10018843 | Ga0207678_100188432 | 467 |
| 572 | 3300031911 | Ga0307412_10000053 | Ga0307412_1000005328 | 467 |
| 573 | 3300046474 | Ga0495605_0002503 | Ga0495605_0002503_476_1879 | 467 |
| 574 | 3300046512 | Ga0495610_0001257 | Ga0495610_0001257_5668_7071 | 467 |
| 575 | 3300046810 | Ga0495660_0088169 | Ga0495660_0088169_139_1542 | 467 |
| 576 | 3300047323 | Ga0495683_0050657 | Ga0495683_0050657_67_1470 | 467 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.8598 | 44 | 452 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.8532 | 45 | 456 |
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.8513 | 44 | 462 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.8468 | 45 | 456 |
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.8449 | 44 | 462 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0K4_17_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.929 | 43 | 233 | 1.20.1250.20 |
| af_P77589_11_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9251 | 40 | 232 | 1.20.1250.20 |
| af_A0A0R0GUC5_71_252_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9245 | 41 | 221 | 1.20.1250.20 |
| af_A0A0R0HMJ0_13_161_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9128 | 92 | 228 | 1.20.1250.20 |
| af_P25744_212_408_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9121 | 43 | 223 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2MRZ7-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9079 | 39 | 456 |
GO:0005886
GO:0046943 |
| AF-A0A839XN35-F1-model_v4 | Putative MFS family arabinose efflux permease | 0.9072 | 44 | 228 |
GO:0005886
GO:0022857 |
| AF-F7S474-F1-model_v4 | Major facilitator transporter | 0.8934 | 19 | 342 |
GO:0005886
GO:0046943 |
| AF-C0XND7-F1-model_v4 | Drug resistance transporter, EmrB/QacA family | 0.89 | 35 | 221 |
GO:0005886
GO:0022857 |
| AF-A0A1Q8QWG6-F1-model_v4 | Sialic acid transporter (Permease) NanT | 0.8869 | 39 | 259 |
GO:0005886
GO:0046943 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar