F465549

General Info

Members Datasets Scaffolds Average Seq Length
576 315 552 442

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0066688|Ga0496118_0066688_404_1876
Length 490
Sequence VTGALPVPAGSTHARPERRAAHDNNAGDKLMHQPADGPRTRGADGTPHAVDASQPWYRSLDRQQWTALAASNLGWFFDGYETYALILTVGVALSQLLDPALHAQIPFYAGLVIALTLLGWGIGGLIGGVLTDYIGRKRMMIVAILAYSLTTGLSAFAWDWTSFAALRFIVGLAMGSEWATGTAMTAEMWPSRHRGKGAGLMQCGLGTGFFVASLVWLFMSGTGQHAWRYMYLVGVLPGLATLWMRAGLPESEQWQRVANERRDTRAKQRAGTVLEGRDAALARFTLVDLFAVPELRRRTMIAVVMSLTTTLGWWGISTWVPPYVGAVAARAGLPAASWASYAGMAYNVGAIAGYIGLGFLADAYGRKRVTFLFFAMAFVLTPVLFIWTHSVAPLLAVACVTGFFSLGQYTWMPTWLPELYPTHVRGTAIAFCFNVPRFLAWTGPLIAGTLIARFGGYGHAAVTVGFIYLLGLALVPFLPETRGKPLPEML

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
6 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
7 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
8 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
9 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
10 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
11 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
12 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
13 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
14 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
15 2885266251 Ralstonia sp. SET104 Isolate Nodule
16 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
17 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
18 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
19 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
314 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
315 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.18
Metatranscriptomes 0
Isolates 3.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0.69
Rhizoplane 8.68
Rhizosphere 80.03
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010481 3300001979 Bacteria 3567
2 JGI24739J22299_10004836 3300001989 Bacteria 5133
3 JGI24738J21930_10005402 3300002075 Bacteria 3064
4 rootH2_10067189 3300003320 Bacteria 5560
5 rootH2_10082695 3300003320 Bacteria 1953
6 rootH1_10050528 3300003323 Bacteria 3805
7 JGI25160J50197_1000039 3300003354 Bacteria 159036
8 JGI25160J50197_1000652 3300003354 Bacteria 19277
9 Ga0065165_1000319 3300005262 Bacteria 78309
10 Ga0065707_10095351 3300005295 Bacteria 3382
11 Ga0070658_10166819 3300005327 Unclassified 1849
12 Ga0070676_10042254 3300005328 Bacteria 2646
13 Ga0070670_100059137 3300005331 Bacteria 3290
14 Ga0070670_100078153 3300005331 Bacteria 2843
15 Ga0068869_100003694 3300005334 Bacteria 9413
16 Ga0068869_100043661 3300005334 Bacteria 3221
17 Ga0070666_10091492 3300005335 Bacteria 2090
18 Ga0070680_100076467 3300005336 Bacteria 2756
19 Ga0070682_100045278 3300005337 Bacteria 2727
20 Ga0070682_100097568 3300005337 Bacteria 1935
21 Ga0068868_100029271 3300005338 Bacteria 4217
22 Ga0070660_100215417 3300005339 Bacteria 1560
23 Ga0070689_100014709 3300005340 Bacteria 5691
24 Ga0070689_100144287 3300005340 Bacteria 1917
25 Ga0070691_10029638 3300005341 Bacteria 2561
26 Ga0070691_10034176 3300005341 Bacteria 2392
27 Ga0070669_100040898 3300005353 Bacteria 3370
28 Ga0070675_100052908 3300005354 Bacteria 3339
29 Ga0070688_100047854 3300005365 Bacteria 2655
30 Ga0070709_10091406 3300005434 Bacteria 2008
31 Ga0070709_10108742 3300005434 Unclassified 1860
32 Ga0070714_100064859 3300005435 Bacteria 3145
33 Ga0070714_100148553 3300005435 Bacteria 2110
34 Ga0070710_10008395 3300005437 Bacteria 5026
35 Ga0070705_100116311 3300005440 Bacteria 1719
36 Ga0070694_100021398 3300005444 Bacteria 4131
37 Ga0070694_100129865 3300005444 Bacteria 1819
38 Ga0070708_100301779 3300005445 Bacteria 1508
39 Ga0070663_100000451 3300005455 Bacteria 21742
40 Ga0070663_100073179 3300005455 Bacteria 2499
41 Ga0070663_100149043 3300005455 Bacteria 1792
42 Ga0070663_100158070 3300005455 Bacteria 1743
43 Ga0070678_100061524 3300005456 Bacteria 2768
44 Ga0068867_100051720 3300005459 Bacteria 3030
45 Ga0070685_10016150 3300005466 Bacteria 3973
46 Ga0070707_100017912 3300005468 Bacteria 6660
47 Ga0070698_100000549 3300005471 Bacteria 40084
48 Ga0070698_100078682 3300005471 Bacteria 3295
49 Ga0070698_100081072 3300005471 Bacteria 3239
50 Ga0070699_100001070 3300005518 Bacteria 25499
51 Ga0070699_100061911 3300005518 Bacteria 3243
52 Ga0070684_100033013 3300005535 Bacteria 4417
53 Ga0070684_100059460 3300005535 Bacteria 3341
54 Ga0070697_100035896 3300005536 Bacteria 4001
55 Ga0070697_100122601 3300005536 Unclassified 2175
56 Ga0070672_100112458 3300005543 Bacteria 2221
57 Ga0070695_100001841 3300005545 Bacteria 11957
58 Ga0070696_100025633 3300005546 Bacteria 4009
59 Ga0070696_100069223 3300005546 Bacteria 2479
60 Ga0070696_100109665 3300005546 Bacteria 1986
61 Ga0070665_100050135 3300005548 Bacteria 4189
62 Ga0070704_100004652 3300005549 Bacteria 7941
63 Ga0068855_100007415 3300005563 Bacteria 13280
64 Ga0070664_100208739 3300005564 Bacteria 1745
65 Ga0068857_100026971 3300005577 Bacteria 5067
66 Ga0068854_100009305 3300005578 Bacteria 6340
67 Ga0068854_100012231 3300005578 Bacteria 5617
68 Ga0068856_100032803 3300005614 Bacteria 5086
69 Ga0068856_100054361 3300005614 Bacteria 3949
70 Ga0070702_100010331 3300005615 Bacteria 4592
71 Ga0070702_100102084 3300005615 Bacteria 1761
72 Ga0070702_100107834 3300005615 Bacteria 1720
73 Ga0068852_100086168 3300005616 Bacteria 2799
74 Ga0068861_100035421 3300005719 Bacteria 3697
75 Ga0068863_100105144 3300005841 Bacteria 2686
76 Ga0068863_100232662 3300005841 Bacteria 1778
77 Ga0068858_100036520 3300005842 Bacteria 4556
78 Ga0068858_100048009 3300005842 Bacteria 3957
79 Ga0068858_100080854 3300005842 Bacteria 3020
80 Ga0068860_100262798 3300005843 Bacteria 1683
81 Ga0068862_100026381 3300005844 Bacteria 4883
82 Ga0081455_10002226 3300005937 Bacteria 23089
83 Ga0081540_1019791 3300005983 Bacteria 4075
84 Ga0081540_1024793 3300005983 Bacteria 3471
85 Ga0075365_10054021 3300006038 Bacteria 2662
86 Ga0070712_100017798 3300006175 Bacteria 4604
87 Ga0070712_100086364 3300006175 Bacteria 2286
88 Ga0075362_10030415 3300006177 Bacteria 2332
89 Ga0075367_10038185 3300006178 Bacteria 2794
90 Ga0097621_100066201 3300006237 Bacteria 2975
91 Ga0075428_100040726 3300006844 Bacteria 5110
92 Ga0075433_10025085 3300006852 Bacteria 5038
93 Ga0075434_100006963 3300006871 Bacteria 10421
94 Ga0075434_100024408 3300006871 Bacteria 5910
95 Ga0075434_100109950 3300006871 Bacteria 2767
96 Ga0075434_100117751 3300006871 Bacteria 2670
97 Ga0075434_100202786 3300006871 Bacteria 2004
98 Ga0075429_100018845 3300006880 Bacteria 5978
99 Ga0075429_100063333 3300006880 Bacteria 3222
100 Ga0068865_100067191 3300006881 Bacteria 2531
101 Ga0075436_100004329 3300006914 Bacteria 9744
102 Ga0075436_100024183 3300006914 Bacteria 4176
103 Ga0075436_100078701 3300006914 Bacteria 2284
104 Ga0075435_100072161 3300007076 Bacteria 2820
105 Ga0075435_100095244 3300007076 Bacteria 2462
106 Ga0099795_10031872 3300007788 Bacteria 1819
107 Ga0105251_10041834 3300009011 Bacteria 2228
108 Ga0105240_10018445 3300009093 Bacteria 9368
109 Ga0111539_10063999 3300009094 Bacteria 4352
110 Ga0111539_10064923 3300009094 Bacteria 4316
111 Ga0105245_10241504 3300009098 Bacteria 1751
112 Ga0105247_10008565 3300009101 Bacteria 6232
113 Ga0114129_10009585 3300009147 Bacteria 13812
114 Ga0114129_10024927 3300009147 Bacteria 8481
115 Ga0114129_10092130 3300009147 Bacteria 4199
116 Ga0114129_10335650 3300009147 Bacteria 2006
117 Ga0105243_10018193 3300009148 Bacteria 5320
118 Ga0105243_10058699 3300009148 Bacteria 3067
119 Ga0105243_10142522 3300009148 Unclassified 2046
120 Ga0105237_10059075 3300009545 Bacteria 3837
121 Ga0105238_10029091 3300009551 Bacteria 5629
122 Ga0105238_10093250 3300009551 Bacteria 2999
123 Ga0105249_10040762 3300009553 Bacteria 4219
124 Ga0099796_10013301 3300010159 Bacteria 2347
125 Ga0105239_10086249 3300010375 Bacteria 3460
126 Ga0105239_10093664 3300010375 Bacteria 3317
127 Ga0105239_10135402 3300010375 Bacteria 2742
128 Ga0157371_10129791 3300013102 Bacteria 1793
129 Ga0157369_10128014 3300013105 Bacteria 2691
130 Ga0157374_10124162 3300013296 Bacteria 2494
131 Ga0163162_10000537 3300013306 Bacteria 35111
132 Ga0163162_10002420 3300013306 Bacteria 17574
133 Ga0163162_10048878 3300013306 Bacteria 4238
134 Ga0163162_10132775 3300013306 Bacteria 2599
135 Ga0157372_10051957 3300013307 Bacteria 4562
136 Ga0157375_10033616 3300013308 Bacteria 4875
137 Ga0157375_10063040 3300013308 Bacteria 3686
138 Ga0157375_10372125 3300013308 Bacteria 1595
139 Ga0163163_10036874 3300014325 Bacteria 4752
140 Ga0163163_10260043 3300014325 Bacteria 1787
141 Ga0163163_10354568 3300014325 Bacteria 1523
142 Ga0157377_10001914 3300014745 Bacteria 9110
143 Ga0157379_10021040 3300014968 Bacteria 5774
144 Ga0157376_10037747 3300014969 Unclassified 3925
145 Ga0213872_10049487 3300021361 Bacteria 1909
146 Ga0213875_10000114 3300021388 Bacteria 91363
147 Ga0213875_10001351 3300021388 Bacteria 16150
148 Ga0209130_1002965 3300025284 Bacteria 7721
149 Ga0209130_1003787 3300025284 Bacteria 6154
150 Ga0209758_1003980 3300025297 Bacteria 12791
151 Ga0207426_1000018 3300025302 Bacteria 566740
152 Ga0207426_1002260 3300025302 Bacteria 12746
153 Ga0207713_1039517 3300025735 Bacteria 1989
154 Ga0207710_10009027 3300025900 Unclassified 4196
155 Ga0207688_10000936 3300025901 Bacteria 14756
156 Ga0207680_10122590 3300025903 Bacteria 1702
157 Ga0207645_10032111 3300025907 Bacteria 3376
158 Ga0207643_10000233 3300025908 Bacteria 38972
159 Ga0207693_10000828 3300025915 Bacteria 27475
160 Ga0207693_10120391 3300025915 Bacteria 2061
161 Ga0207662_10012424 3300025918 Bacteria 4742
162 Ga0207662_10097395 3300025918 Bacteria 1818
163 Ga0207662_10115738 3300025918 Bacteria 1676
164 Ga0207657_10034859 3300025919 Bacteria 4519
165 Ga0207657_10053510 3300025919 Bacteria 3497
166 Ga0207649_10200914 3300025920 Bacteria 1408
167 Ga0207694_10006459 3300025924 Bacteria 8932
168 Ga0207694_10144756 3300025924 Bacteria 1912
169 Ga0207650_10094737 3300025925 Bacteria 2288
170 Ga0207687_10045165 3300025927 Bacteria 3044
171 Ga0207687_10054012 3300025927 Bacteria 2809
172 Ga0207664_10047651 3300025929 Bacteria 3368
173 Ga0207664_10140353 3300025929 Bacteria 2043
174 Ga0207706_10003937 3300025933 Bacteria 14075
175 Ga0207706_10133085 3300025933 Bacteria 2187
176 Ga0207670_10208548 3300025936 Bacteria 1489
177 Ga0207665_10056531 3300025939 Bacteria 2649
178 Ga0207691_10032224 3300025940 Bacteria 4888
179 Ga0207711_10006706 3300025941 Bacteria 9689
180 Ga0207689_10016457 3300025942 Bacteria 6259
181 Ga0207689_10141300 3300025942 Bacteria 1983
182 Ga0207679_10159563 3300025945 Bacteria 1845
183 Ga0207667_10000991 3300025949 Bacteria 36317
184 Ga0207651_10051446 3300025960 Bacteria 2803
185 Ga0207712_10018184 3300025961 Bacteria 4575
186 Ga0207712_10267611 3300025961 Bacteria 1389
187 Ga0207640_10180408 3300025981 Bacteria 1582
188 Ga0207703_10018478 3300026035 Bacteria 5444
189 Ga0207678_10008614 3300026067 Bacteria 8987
190 Ga0207678_10015183 3300026067 Bacteria 6775
191 Ga0207678_10018843 3300026067 Bacteria 6061
192 Ga0207678_10023945 3300026067 Bacteria 5338
193 Ga0207678_10048847 3300026067 Bacteria 3657
194 Ga0207708_10000911 3300026075 Bacteria 22215
195 Ga0207702_10055930 3300026078 Unclassified 3348
196 Ga0207676_10040441 3300026095 Bacteria 3574
197 Ga0207676_10042430 3300026095 Bacteria 3499
198 Ga0207674_10122403 3300026116 Bacteria 2568
199 Ga0207675_100005973 3300026118 Bacteria 11600
200 Ga0207675_100026489 3300026118 Bacteria 5397
201 Ga0207683_10031497 3300026121 Bacteria 4603
202 Ga0207698_10056130 3300026142 Bacteria 3039
203 Ga0209179_1003277 3300027512 Bacteria 2311
204 Ga0207428_10085020 3300027907 Bacteria 2464
205 Ga0268266_10001427 3300028379 Bacteria 28495
206 Ga0268266_10023773 3300028379 Bacteria 5215
207 Ga0268266_10058883 3300028379 Bacteria 3308
208 Ga0268265_10028392 3300028380 Bacteria 4005
209 Ga0268264_10174951 3300028381 Bacteria 1945
210 Ga0265338_10007619 3300028800 Bacteria 13364
211 Ga0265338_10102309 3300028800 Bacteria 2330
212 Ga0265330_10012904 3300031235 Bacteria 3900
213 Ga0265325_10010113 3300031241 Bacteria 5478
214 Ga0265325_10032102 3300031241 Bacteria 2805
215 Ga0265340_10026558 3300031247 Bacteria 2925
216 Ga0265316_10004646 3300031344 Bacteria 13615
217 Ga0265313_10021023 3300031595 Bacteria 3580
218 Ga0265313_10053409 3300031595 Unclassified 1923
219 Ga0265342_10023388 3300031712 Bacteria 3913
220 Ga0307405_10133807 3300031731 Bacteria 1718
221 Ga0307412_10000053 3300031911 Bacteria 148594
222 Ga0307412_10012520 3300031911 Bacteria 4949
223 Ga0307416_100068362 3300032002 Bacteria 2935
224 Ga0373934_0002175 3300035086 Bacteria 7210
225 Ga0373944_0000852 3300035089 Bacteria 7480
226 Ga0373944_0005991 3300035089 Bacteria 3219
227 Ga0373944_0012483 3300035089 Bacteria 2342
228 Ga0373944_0022543 3300035089 Bacteria 1830
229 Ga0373949_0015790 3300035090 Bacteria 1689
230 Ga0373936_0022227 3300035113 Bacteria 2470
231 Ga0373941_0003278 3300035115 Bacteria 3653
232 Ga0373945_0001338 3300035116 Bacteria 7487
233 Ga0373954_0063553 3300035118 Bacteria 1745
234 Ga0373956_0004024 3300035119 Bacteria 5905
235 Ga0373957_0007369 3300035120 Bacteria 3519
236 Ga0373943_0000492 3300035170 Bacteria 16847
237 Ga0373943_0009828 3300035170 Bacteria 4283
238 Ga0373943_0054223 3300035170 Bacteria 1982
239 Ga0373946_0001057 3300035171 Bacteria 9482
240 Ga0373946_0050017 3300035171 Bacteria 1744
241 Ga0373962_0021558 3300035242 Bacteria 1701
242 Ga0373924_0022335 3300035410 Bacteria 2474
243 Ga0373931_0003585 3300035691 Bacteria 7001
244 Ga0373931_0083862 3300035691 Bacteria 1764
245 Ga0373935_0034718 3300035692 Bacteria 3145
246 Ga0373935_0085591 3300035692 Bacteria 2055
247 Ga0373935_0158758 3300035692 Bacteria 1540
248 Ga0373927_0001141 3300035695 Bacteria 20109
249 Ga0373927_0021771 3300035695 Bacteria 4201
250 Ga0373933_0001112 3300035724 Bacteria 16015
251 Ga0373933_0003979 3300035724 Bacteria 8153
252 Ga0373947_0003127 3300035725 Bacteria 9852
253 Ga0373947_0006841 3300035725 Bacteria 6611
254 Ga0373947_0013016 3300035725 Unclassified 4770
255 Ga0373947_0023835 3300035725 Bacteria 3562
256 Ga0373947_0065598 3300035725 Bacteria 2215
257 Ga0373947_0161211 3300035725 Bacteria 1450
258 Ga0373937_0003821 3300036401 Bacteria 12726
259 Ga0373937_0022352 3300036401 Bacteria 5686
260 Ga0373937_0034794 3300036401 Bacteria 4582
261 Ga0373925_0002878 3300037068 Bacteria 13591
262 Ga0373925_0012851 3300037068 Bacteria 6065
263 Ga0373925_0028570 3300037068 Bacteria 4086
264 Ga0373925_0053857 3300037068 Unclassified 3008
265 Ga0373925_0069469 3300037068 Bacteria 2661
266 Ga0373925_0074285 3300037068 Bacteria 2575
267 Ga0373925_0275324 3300037068 Bacteria 1355
268 Ga0395905_0001030 3300037471 Bacteria 35512
269 Ga0395905_0001135 3300037471 Bacteria 33303
270 Ga0436364_1075760 3300037853 Bacteria 10178
271 Ga0436364_1352562 3300037853 Bacteria 66743
272 Ga0436365_0664371 3300039437 Bacteria 2990
273 Ga0436365_1652334 3300039437 Bacteria 1685
274 Ga0436361_0694873 3300039447 Bacteria 1962
275 Ga0466965_0044777 3300044683 Bacteria 2188
276 Ga0466964_0012260 3300044706 Bacteria 3244
277 Ga0453684_0313622 3300044712 Bacteria 1779
278 Ga0466968_0049403 3300044735 Bacteria 1792
279 Ga0466960_0012351 3300044901 Bacteria 3602
280 Ga0451576_0254326 3300045051 Bacteria 1836
281 Ga0466967_0008390 3300045976 Bacteria 7562
282 Ga0466967_0095023 3300045976 Bacteria 2716
283 Ga0495627_033879 3300046453 Bacteria 1599
284 Ga0495592_0019252 3300046454 Bacteria 5194
285 Ga0495592_0026796 3300046454 Bacteria 4370
286 Ga0495592_0127416 3300046454 Unclassified 1784
287 Ga0495603_0015424 3300046455 Bacteria 4622
288 Ga0495603_0035565 3300046455 Bacteria 2991
289 Ga0495590_0001787 3300046457 Bacteria 9120
290 Ga0495629_0000042 3300046459 Bacteria 112605
291 Ga0495629_0000138 3300046459 Bacteria 63867
292 Ga0495629_0009468 3300046459 Bacteria 7125
293 Ga0495629_0022819 3300046459 Bacteria 4459
294 Ga0495629_0035061 3300046459 Bacteria 3547
295 Ga0495638_0004088 3300046460 Bacteria 11175
296 Ga0495638_0027312 3300046460 Bacteria 3695
297 Ga0495641_0008929 3300046461 Bacteria 6027
298 Ga0495641_0037115 3300046461 Bacteria 2286
299 Ga0495641_0085122 3300046461 Bacteria 1415
300 Ga0495651_0008321 3300046462 Bacteria 7950
301 Ga0495653_0000321 3300046463 Bacteria 39085
302 Ga0495653_0000446 3300046463 Bacteria 32368
303 Ga0495653_0013384 3300046463 Bacteria 6686
304 Ga0495650_0022526 3300046471 Bacteria 3019
305 Ga0495580_0002848 3300046472 Bacteria 14881
306 Ga0495580_0003831 3300046472 Bacteria 12716
307 Ga0495580_0007637 3300046472 Bacteria 8674
308 Ga0495580_0008581 3300046472 Bacteria 8109
309 Ga0495580_0023475 3300046472 Unclassified 4528
310 Ga0495580_0036026 3300046472 Bacteria 3555
311 Ga0495580_0089303 3300046472 Bacteria 2145
312 Ga0495580_0232880 3300046472 Bacteria 1264
313 Ga0495582_0002241 3300046473 Bacteria 10829
314 Ga0495582_0003196 3300046473 Bacteria 9206
315 Ga0495582_0015023 3300046473 Bacteria 4258
316 Ga0495582_0035701 3300046473 Unclassified 2734
317 Ga0495582_0050932 3300046473 Bacteria 2283
318 Ga0495605_0002503 3300046474 Bacteria 11364
319 Ga0495605_0009908 3300046474 Bacteria 5343
320 Ga0495605_0025718 3300046474 Bacteria 3065
321 Ga0495662_0022327 3300046476 Unclassified 3056
322 Ga0495662_0033953 3300046476 Bacteria 2464
323 Ga0495664_0066590 3300046477 Unclassified 2148
324 Ga0495664_0129153 3300046477 Unclassified 1530
325 Ga0495584_0023923 3300046491 Bacteria 3097
326 Ga0495584_0026185 3300046491 Bacteria 2955
327 Ga0495585_0013503 3300046492 Bacteria 4776
328 Ga0495585_0024997 3300046492 Bacteria 3423
329 Ga0495607_0002323 3300046501 Bacteria 15587
330 Ga0495583_0000789 3300046506 Bacteria 39441
331 Ga0495583_0003588 3300046506 Bacteria 11655
332 Ga0495583_0005487 3300046506 Bacteria 8592
333 Ga0495583_0050943 3300046506 Bacteria 1890
334 Ga0495606_0007081 3300046507 Bacteria 10143
335 Ga0495608_0077927 3300046511 Unclassified 2157
336 Ga0495610_0001257 3300046512 Bacteria 22761
337 Ga0495616_0037014 3300046513 Bacteria 2514
338 Ga0495620_0020291 3300046515 Bacteria 3248
339 Ga0495628_0001775 3300046516 Bacteria 19628
340 Ga0495628_0004238 3300046516 Bacteria 12750
341 Ga0495630_0001163 3300046517 Bacteria 18174
342 Ga0495630_0003840 3300046517 Bacteria 10483
343 Ga0495630_0006265 3300046517 Bacteria 8447
344 Ga0495630_0030567 3300046517 Bacteria 4007
345 Ga0495644_0000597 3300046523 Bacteria 15124
346 Ga0495648_0003381 3300046524 Bacteria 14040
347 Ga0495648_0011886 3300046524 Bacteria 6530
348 Ga0495648_0024280 3300046524 Bacteria 4132
349 Ga0495648_0052277 3300046524 Bacteria 2482
350 Ga0495648_0078045 3300046524 Bacteria 1895
351 Ga0495666_0001806 3300046526 Bacteria 10574
352 Ga0495642_0001523 3300046528 Bacteria 10290
353 Ga0495652_0014832 3300046529 Bacteria 6986
354 Ga0495665_0003795 3300046531 Bacteria 8179
355 Ga0495665_0018966 3300046531 Bacteria 3697
356 Ga0495665_0028332 3300046531 Bacteria 3003
357 Ga0495640_0012679 3300046533 Bacteria 6435
358 Ga0495640_0043740 3300046533 Bacteria 3117
359 Ga0495586_0006751 3300046535 Bacteria 6128
360 Ga0495587_0032199 3300046536 Unclassified 3170
361 Ga0495587_0046890 3300046536 Bacteria 2564
362 Ga0495609_0017184 3300046538 Unclassified 3362
363 Ga0495609_0052329 3300046538 Bacteria 1817
364 Ga0495621_0038518 3300046539 Bacteria 1668
365 Ga0495597_0022666 3300046542 Bacteria 2911
366 Ga0495597_0032947 3300046542 Bacteria 2349
367 Ga0495645_0006001 3300046543 Bacteria 8400
368 Ga0495645_0090168 3300046543 Bacteria 2191
369 Ga0495645_0101050 3300046543 Bacteria 2051
370 Ga0495622_0003932 3300046557 Bacteria 6937
371 Ga0495622_0018169 3300046557 Unclassified 3275
372 Ga0495633_0002701 3300046558 Bacteria 12309
373 Ga0495656_0004064 3300046615 Unclassified 4980
374 Ga0495656_0013548 3300046615 Bacteria 3036
375 Ga0495634_0012451 3300046642 Bacteria 6155
376 Ga0495611_0057110 3300046648 Bacteria 1768
377 Ga0495625_0037942 3300046660 Bacteria 3530
378 Ga0495635_0002054 3300046663 Bacteria 13644
379 Ga0495635_0010307 3300046663 Bacteria 6536
380 Ga0495635_0013165 3300046663 Bacteria 5791
381 Ga0495661_0054835 3300046665 Bacteria 2392
382 Ga0495588_0001664 3300046674 Bacteria 9476
383 Ga0495599_0027877 3300046678 Unclassified 3538
384 Ga0495623_0023322 3300046679 Bacteria 3994
385 Ga0495646_0000273 3300046680 Bacteria 26278
386 Ga0495646_0025995 3300046680 Unclassified 3677
387 Ga0495647_0010347 3300046681 Bacteria 3173
388 Ga0495658_0012862 3300046683 Unclassified 4251
389 Ga0495658_0016656 3300046683 Unclassified 3783
390 Ga0495669_0040223 3300046684 Bacteria 2073
391 Ga0495613_0004866 3300046689 Bacteria 10082
392 Ga0495613_0014024 3300046689 Bacteria 5949
393 Ga0495613_0045610 3300046689 Bacteria 3241
394 Ga0495613_0104326 3300046689 Bacteria 2047
395 Ga0495613_0192422 3300046689 Bacteria 1441
396 Ga0495624_0000216 3300046690 Bacteria 44450
397 Ga0495624_0008826 3300046690 Bacteria 7008
398 Ga0495624_0009706 3300046690 Bacteria 6662
399 Ga0495624_0079688 3300046690 Bacteria 2030
400 Ga0495670_0002872 3300046691 Bacteria 8505
401 Ga0495671_0005979 3300046692 Bacteria 7075
402 Ga0495671_0091193 3300046692 Bacteria 1491
403 Ga0495649_0000242 3300046694 Bacteria 48020
404 Ga0495649_0001737 3300046694 Bacteria 16085
405 Ga0495649_0021882 3300046694 Bacteria 3581
406 Ga0495589_0001320 3300046794 Bacteria 14562
407 Ga0495589_0019368 3300046794 Bacteria 3490
408 Ga0495589_0060281 3300046794 Bacteria 1864
409 Ga0495660_0088169 3300046810 Bacteria 1617
410 Ga0495581_0003464 3300047315 Bacteria 9055
411 Ga0495581_0004873 3300047315 Bacteria 7766
412 Ga0495604_0051127 3300047317 Unclassified 3205
413 Ga0495604_0061181 3300047317 Unclassified 2881
414 Ga0495636_0003571 3300047318 Bacteria 6030
415 Ga0495636_0004315 3300047318 Bacteria 5580
416 Ga0495674_0008140 3300047319 Bacteria 10003
417 Ga0495674_0011538 3300047319 Bacteria 8336
418 Ga0495674_0012860 3300047319 Bacteria 7882
419 Ga0495674_0013683 3300047319 Bacteria 7623
420 Ga0495674_0030914 3300047319 Bacteria 4866
421 Ga0495674_0116670 3300047319 Bacteria 2258
422 Ga0495674_0134161 3300047319 Bacteria 2084
423 Ga0495672_0009676 3300047320 Bacteria 6954
424 Ga0495672_0012479 3300047320 Bacteria 5926
425 Ga0495676_0012375 3300047321 Bacteria 7687
426 Ga0495676_0029297 3300047321 Bacteria 4689
427 Ga0495676_0034143 3300047321 Bacteria 4271
428 Ga0495676_0065974 3300047321 Bacteria 2807
429 Ga0495680_0007070 3300047322 Bacteria 10340
430 Ga0495680_0155888 3300047322 Bacteria 1661
431 Ga0495683_0000360 3300047323 Bacteria 37542
432 Ga0495683_0001184 3300047323 Bacteria 17808
433 Ga0495683_0045001 3300047323 Bacteria 2218
434 Ga0495683_0050657 3300047323 Bacteria 2077
435 Ga0495687_011638 3300047443 Bacteria 4714
436 Ga0495687_016804 3300047443 Bacteria 3670
437 Ga0495675_0014782 3300047444 Bacteria 4935
438 Ga0495679_000036 3300047446 Bacteria 161473
439 Ga0495679_000345 3300047446 Bacteria 36393
440 Ga0495673_0000424 3300047469 Bacteria 48017
441 Ga0495673_0015972 3300047469 Bacteria 3851
442 Ga0495681_0047132 3300047470 Bacteria 2052
443 Ga0495684_0005507 3300047471 Bacteria 9858
444 Ga0495684_0010002 3300047471 Bacteria 7332
445 Ga0495686_0025429 3300047472 Bacteria 3881
446 Ga0495593_0000149 3300047673 Bacteria 34606
447 Ga0495593_0004070 3300047673 Bacteria 8703
448 Ga0495593_0023237 3300047673 Unclassified 3448
449 Ga0495602_0023268 3300048088 Bacteria 6041
450 Ga0495602_0183895 3300048088 Bacteria 1609
451 Ga0495614_0001261 3300048089 Bacteria 10874
452 Ga0495614_0036449 3300048089 Bacteria 2112
453 Ga0496100_0008741 3300048903 Bacteria 5659
454 Ga0496100_0014315 3300048903 Bacteria 4602
455 Ga0496101_0001966 3300048904 Bacteria 12453
456 Ga0496101_0002634 3300048904 Bacteria 11019
457 Ga0496102_0008102 3300048905 Bacteria 8989
458 Ga0496102_0009383 3300048905 Bacteria 8404
459 Ga0496102_0061808 3300048905 Bacteria 3429
460 Ga0496102_0137287 3300048905 Bacteria 2291
461 Ga0496103_0002359 3300048906 Bacteria 11914
462 Ga0496103_0063963 3300048906 Bacteria 2292
463 Ga0496103_0076835 3300048906 Bacteria 2096
464 Ga0496104_0002958 3300048907 Bacteria 14632
465 Ga0496104_0052295 3300048907 Bacteria 3858
466 Ga0496104_0081769 3300048907 Bacteria 3080
467 Ga0496106_0000003 3300048909 Bacteria 305293
468 Ga0496106_0000032 3300048909 Bacteria 134707
469 Ga0496106_0013742 3300048909 Bacteria 5979
470 Ga0496106_0061578 3300048909 Bacteria 2847
471 Ga0496106_0064880 3300048909 Bacteria 2779
472 Ga0496107_0011824 3300048910 Bacteria 6095
473 Ga0496107_0217981 3300048910 Bacteria 1419
474 Ga0496107_0227243 3300048910 Bacteria 1388
475 Ga0496108_0005821 3300048911 Bacteria 9991
476 Ga0496108_0010386 3300048911 Bacteria 7561
477 Ga0496108_0036535 3300048911 Bacteria 4087
478 Ga0496108_0062283 3300048911 Bacteria 3141
479 Ga0496109_0004418 3300048912 Bacteria 11746
480 Ga0496109_0024349 3300048912 Bacteria 5381
481 Ga0496109_0039169 3300048912 Bacteria 4288
482 Ga0496110_0093710 3300048913 Bacteria 2688
483 Ga0496110_0135296 3300048913 Bacteria 2227
484 Ga0496110_0157611 3300048913 Bacteria 2057
485 Ga0496111_0038873 3300048914 Bacteria 3409
486 Ga0496111_0040605 3300048914 Bacteria 3338
487 Ga0496112_0003353 3300048915 Bacteria 13215
488 Ga0496112_0004542 3300048915 Bacteria 11791
489 Ga0496112_0008562 3300048915 Bacteria 9168
490 Ga0496112_0017034 3300048915 Bacteria 6822
491 Ga0496113_0002552 3300048916 Bacteria 10629
492 Ga0496113_0002993 3300048916 Bacteria 10004
493 Ga0496113_0013645 3300048916 Bacteria 5514
494 Ga0496113_0110345 3300048916 Bacteria 2140
495 Ga0496113_0148976 3300048916 Bacteria 1845
496 Ga0496114_0060491 3300048917 Bacteria 3166
497 Ga0496114_0072436 3300048917 Bacteria 2898
498 Ga0496114_0073911 3300048917 Bacteria 2869
499 Ga0496115_0014251 3300048918 Bacteria 6018
500 Ga0496115_0031112 3300048918 Bacteria 4203
501 Ga0496115_0089862 3300048918 Bacteria 2508
502 Ga0496117_0000903 3300048920 Bacteria 45688
503 Ga0496117_0129168 3300048920 Bacteria 1535
504 Ga0496118_0001642 3300048921 Bacteria 32972
505 Ga0496118_0013136 3300048921 Bacteria 7861
506 Ga0496118_0044806 3300048921 Bacteria 3460
507 Ga0496118_0066688 3300048921 Bacteria 2626
508 Ga0496121_0000540 3300048924 Bacteria 72033
509 Ga0496121_0002263 3300048924 Bacteria 29956
510 Ga0496121_0003588 3300048924 Bacteria 21901
511 Ga0496121_0005258 3300048924 Bacteria 16726
512 Ga0496121_0011954 3300048924 Bacteria 9551
513 Ga0496121_0021136 3300048924 Bacteria 6391
514 Ga0496124_0103653 3300048927 Bacteria 2301
515 Ga0496126_0000118 3300048929 Bacteria 184719
516 Ga0496126_0004459 3300048929 Bacteria 16727
517 Ga0496126_0007159 3300048929 Bacteria 12279
518 Ga0496126_0015198 3300048929 Bacteria 7750
519 Ga0495682_0001396 3300049460 Bacteria 13163
520 Ga0495682_0047455 3300049460 Bacteria 1566
521 nmdc:mga00v17_107801_c1 3300050491 Bacteria 1764
522 nmdc:mga0yw44_12570_c1 3300050492 Bacteria 4420
523 nmdc:mga05p37_17000_c1 3300050507 Bacteria 8772
524 nmdc:mga05p37_25194_c1 3300050507 Bacteria 7234
525 nmdc:mga09592_10752_c1 3300050508 Bacteria 7440
526 nmdc:mga08y16_139534_c1 3300050511 Bacteria 2520
527 nmdc:mga08y16_305920_c1 3300050511 Bacteria 1638
528 nmdc:mga08y16_75561_c1 3300050511 Bacteria 3512
529 nmdc:mga0rr50_103643_c1 3300050513 Bacteria 2240
530 nmdc:mga0rr50_116449_c1 3300050513 Bacteria 2122
531 nmdc:mga0rr50_3348_c1 3300050513 Bacteria 9209
532 nmdc:mga0rr50_59997_c1 3300050513 Bacteria 2859
533 nmdc:mga08x19_102593_c1 3300050514 Bacteria 1900
534 nmdc:mga08x19_20710_c1 3300050514 Bacteria 4052
535 nmdc:mga08x19_4462_c1 3300050514 Bacteria 8292
536 nmdc:mga08x19_48316_c1 3300050514 Bacteria 2726
537 nmdc:mga08x19_5972_c1 3300050514 Bacteria 7200
538 nmdc:mga0a205_53064_c1 3300050515 Bacteria 3912
539 Ga0495601_0003272 3300053077 Bacteria 9263
540 Ga0495595_0002751 3300053084 Bacteria 6906
541 Ga0495619_0000266 3300053085 Bacteria 38066
542 Ga0495619_0001146 3300053085 Bacteria 17400
543 Ga0495619_0004895 3300053085 Bacteria 8506
544 Ga0500643_000617 3300053087 Bacteria 24066
545 Ga0500595_000022 3300053119 Bacteria 149029
546 Ga0500595_000343 3300053119 Bacteria 30330
547 Ga0500595_010944 3300053119 Bacteria 3576
548 Ga0500595_018738 3300053119 Bacteria 2525
549 Ga0500618_004181 3300053125 Bacteria 4702
550 Ga0500642_0050863 3300053130 Bacteria 1828
551 Ga0500652_000016 3300053131 Bacteria 126768
552 Ga0500568_0033964 3300053139 Bacteria 2089

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0085122 Ga0495641_0085122_178_1398 370
2 3300046689 Ga0495613_0192422 Ga0495613_0192422_10_1200 396
3 3300047319 Ga0495674_0116670 Ga0495674_0116670_43_1284 400
4 3300035724 Ga0373933_0003979 Ga0373933_0003979_3158_4381 404
5 3300037068 Ga0373925_0275324 Ga0373925_0275324_111_1334 404
6 3300005334 Ga0068869_100003694 Ga0068869_1000036946 407
7 3300005338 Ga0068868_100029271 Ga0068868_1000292712 407
8 3300009553 Ga0105249_10040762 Ga0105249_100407622 407
9 3300025907 Ga0207645_10032111 Ga0207645_100321112 407
10 3300025942 Ga0207689_10016457 Ga0207689_100164575 407
11 3300025961 Ga0207712_10267611 Ga0207712_102676111 407
12 3300026118 Ga0207675_100026489 Ga0207675_1000264894 407
13 3300048913 Ga0496110_0135296 Ga0496110_0135296_240_1535 407
14 3300005327 Ga0070658_10166819 Ga0070658_101668191 408
15 3300005328 Ga0070676_10042254 Ga0070676_100422542 408
16 3300005331 Ga0070670_100059137 Ga0070670_1000591372 408
17 3300005337 Ga0070682_100097568 Ga0070682_1000975683 408
18 3300005339 Ga0070660_100215417 Ga0070660_1002154171 408
19 3300005365 Ga0070688_100047854 Ga0070688_1000478541 408
20 3300005455 Ga0070663_100073179 Ga0070663_1000731792 408
21 3300005456 Ga0070678_100061524 Ga0070678_1000615243 408
22 3300005466 Ga0070685_10016150 Ga0070685_100161502 408
23 3300005535 Ga0070684_100059460 Ga0070684_1000594601 408
24 3300005548 Ga0070665_100050135 Ga0070665_1000501352 408
25 3300005577 Ga0068857_100026971 Ga0068857_1000269712 408
26 3300005578 Ga0068854_100012231 Ga0068854_1000122314 408
27 3300005614 Ga0068856_100032803 Ga0068856_1000328032 408
28 3300005841 Ga0068863_100232662 Ga0068863_1002326621 408
29 3300005844 Ga0068862_100026381 Ga0068862_1000263813 408
30 3300009098 Ga0105245_10241504 Ga0105245_102415041 408
31 3300009148 Ga0105243_10142522 Ga0105243_101425222 408
32 3300010375 Ga0105239_10093664 Ga0105239_100936642 408
33 3300013102 Ga0157371_10129791 Ga0157371_101297912 408
34 3300013306 Ga0163162_10048878 Ga0163162_100488782 408
35 3300013307 Ga0157372_10051957 Ga0157372_100519573 408
36 3300013308 Ga0157375_10063040 Ga0157375_100630402 408
37 3300014325 Ga0163163_10354568 Ga0163163_103545681 408
38 3300025901 Ga0207688_10000936 Ga0207688_100009363 408
39 3300025919 Ga0207657_10053510 Ga0207657_100535102 408
40 3300025920 Ga0207649_10200914 Ga0207649_102009141 408
41 3300025981 Ga0207640_10180408 Ga0207640_101804081 408
42 3300026067 Ga0207678_10023945 Ga0207678_100239453 408
43 3300026095 Ga0207676_10040441 Ga0207676_100404412 408
44 3300028379 Ga0268266_10023773 Ga0268266_100237733 408
45 3300028380 Ga0268265_10028392 Ga0268265_100283921 408
46 3300048916 Ga0496113_0148976 Ga0496113_0148976_263_1558 408
47 3300009147 Ga0114129_10335650 Ga0114129_103356501 410
48 3300050507 nmdc:mga05p37_17000_c1 nmdc:mga05p37_17000_c1_481_1713 410
49 3300046472 Ga0495580_0232880 Ga0495580_0232880_10_1251 413
50 3300013296 Ga0157374_10124162 Ga0157374_101241622 414
51 3300005337 Ga0070682_100045278 Ga0070682_1000452782 415
52 3300005564 Ga0070664_100208739 Ga0070664_1002087391 415
53 3300005614 Ga0068856_100054361 Ga0068856_1000543613 415
54 3300013306 Ga0163162_10000537 Ga0163162_100005375 415
55 3300014325 Ga0163163_10036874 Ga0163163_100368744 415
56 3300025945 Ga0207679_10159563 Ga0207679_101595632 415
57 3300026078 Ga0207702_10055930 Ga0207702_100559302 415
58 iso_pu_bacteria 8054472261 8054472992 418
59 3300053119 Ga0500595_010944 Ga0500595_010944_1513_2847 419
60 3300046517 Ga0495630_0030567 Ga0495630_0030567_11_1291 420
61 3300046477 Ga0495664_0129153 Ga0495664_0129153_170_1435 421
62 3300046689 Ga0495613_0104326 Ga0495613_0104326_701_1966 421
63 3300045976 Ga0466967_0095023 Ga0466967_0095023_1146_2438 422
64 3300005983 Ga0081540_1019791 Ga0081540_10197913 423
65 3300044735 Ga0466968_0049403 Ga0466968_0049403_361_1656 423
66 3300046454 Ga0495592_0026796 Ga0495592_0026796_2042_3334 424
67 3300046476 Ga0495662_0033953 Ga0495662_0033953_370_1662 424
68 3300046543 Ga0495645_0090168 Ga0495645_0090168_158_1450 424
69 3300046692 Ga0495671_0091193 Ga0495671_0091193_41_1333 424
70 3300048920 Ga0496117_0129168 Ga0496117_0129168_28_1320 424
71 3300005563 Ga0068855_100007415 Ga0068855_1000074159 425
72 3300025949 Ga0207667_10000991 Ga0207667_1000099110 425
73 3300047319 Ga0495674_0013683 Ga0495674_0013683_5524_6852 425
74 3300048929 Ga0496126_0004459 Ga0496126_0004459_1103_2434 425
75 3300003320 rootH2_10082695 rootH2_100826951 426
76 3300005471 Ga0070698_100081072 Ga0070698_1000810722 427
77 3300031911 Ga0307412_10012520 Ga0307412_100125203 427
78 3300032002 Ga0307416_100068362 Ga0307416_1000683622 427
79 3300006880 Ga0075429_100018845 Ga0075429_1000188451 428
80 3300031731 Ga0307405_10133807 Ga0307405_101338071 428
81 3300045051 Ga0451576_0254326 Ga0451576_0254326_105_1394 428
82 3300048920 Ga0496117_0000903 Ga0496117_0000903_27536_28897 428
83 3300048921 Ga0496118_0001642 Ga0496118_0001642_23436_24797 428
84 3300048929 Ga0496126_0000118 Ga0496126_0000118_128670_130031 428
85 3300005615 Ga0070702_100107834 Ga0070702_1001078342 430
86 3300005842 Ga0068858_100036520 Ga0068858_1000365201 430
87 3300006871 Ga0075434_100024408 Ga0075434_1000244083 430
88 3300006914 Ga0075436_100024183 Ga0075436_1000241833 430
89 3300009148 Ga0105243_10058699 Ga0105243_100586993 430
90 3300010375 Ga0105239_10086249 Ga0105239_100862493 430
91 3300013306 Ga0163162_10132775 Ga0163162_101327751 430
92 3300013308 Ga0157375_10372125 Ga0157375_103721251 430
93 3300014968 Ga0157379_10021040 Ga0157379_100210406 430
94 3300014969 Ga0157376_10037747 Ga0157376_100377471 430
95 3300025900 Ga0207710_10009027 Ga0207710_100090273 430
96 3300025918 Ga0207662_10097395 Ga0207662_100973952 430
97 3300025927 Ga0207687_10054012 Ga0207687_100540122 430
98 3300025933 Ga0207706_10133085 Ga0207706_101330851 430
99 3300025941 Ga0207711_10006706 Ga0207711_100067063 430
100 3300026067 Ga0207678_10048847 Ga0207678_100488473 430
101 3300026121 Ga0207683_10031497 Ga0207683_100314974 430
102 3300028379 Ga0268266_10001427 Ga0268266_1000142710 430
103 3300035086 Ga0373934_0002175 Ga0373934_0002175_5273_6568 430
104 3300035089 Ga0373944_0000852 Ga0373944_0000852_3033_4367 430
105 3300035115 Ga0373941_0003278 Ga0373941_0003278_385_1719 430
106 3300035118 Ga0373954_0063553 Ga0373954_0063553_246_1541 430
107 3300035119 Ga0373956_0004024 Ga0373956_0004024_2401_3696 430
108 3300035120 Ga0373957_0007369 Ga0373957_0007369_1101_2396 430
109 3300035242 Ga0373962_0021558 Ga0373962_0021558_91_1425 430
110 3300035410 Ga0373924_0022335 Ga0373924_0022335_275_1609 430
111 3300035691 Ga0373931_0003585 Ga0373931_0003585_2695_4029 430
112 3300035724 Ga0373933_0001112 Ga0373933_0001112_14640_15935 430
113 3300035725 Ga0373947_0013016 Ga0373947_0013016_1970_3304 430
114 3300035725 Ga0373947_0161211 Ga0373947_0161211_86_1420 430
115 3300036401 Ga0373937_0003821 Ga0373937_0003821_8686_9981 430
116 3300037068 Ga0373925_0028570 Ga0373925_0028570_688_2022 430
117 3300037068 Ga0373925_0053857 Ga0373925_0053857_1343_2677 430
118 3300044712 Ga0453684_0313622 Ga0453684_0313622_250_1584 430
119 3300046453 Ga0495627_033879 Ga0495627_033879_97_1431 430
120 3300046461 Ga0495641_0008929 Ga0495641_0008929_453_1787 430
121 3300046462 Ga0495651_0008321 Ga0495651_0008321_1725_3059 430
122 3300046472 Ga0495580_0023475 Ga0495580_0023475_2080_3414 430
123 3300046473 Ga0495582_0003196 Ga0495582_0003196_5014_6348 430
124 3300046473 Ga0495582_0035701 Ga0495582_0035701_621_1955 430
125 3300046476 Ga0495662_0022327 Ga0495662_0022327_1527_2861 430
126 3300046477 Ga0495664_0066590 Ga0495664_0066590_798_2132 430
127 3300046501 Ga0495607_0002323 Ga0495607_0002323_4192_5526 430
128 3300046511 Ga0495608_0077927 Ga0495608_0077927_606_1940 430
129 3300046523 Ga0495644_0000597 Ga0495644_0000597_2890_4224 430
130 3300046536 Ga0495587_0032199 Ga0495587_0032199_169_1503 430
131 3300046538 Ga0495609_0052329 Ga0495609_0052329_355_1689 430
132 3300046557 Ga0495622_0018169 Ga0495622_0018169_1878_3212 430
133 3300046558 Ga0495633_0002701 Ga0495633_0002701_10884_12218 430
134 3300046615 Ga0495656_0004064 Ga0495656_0004064_2149_3483 430
135 3300046663 Ga0495635_0013165 Ga0495635_0013165_2072_3406 430
136 3300046674 Ga0495588_0001664 Ga0495588_0001664_4793_6127 430
137 3300046678 Ga0495599_0027877 Ga0495599_0027877_325_1659 430
138 3300046680 Ga0495646_0025995 Ga0495646_0025995_2197_3531 430
139 3300046681 Ga0495647_0010347 Ga0495647_0010347_1646_2980 430
140 3300046683 Ga0495658_0012862 Ga0495658_0012862_867_2201 430
141 3300046683 Ga0495658_0016656 Ga0495658_0016656_250_1584 430
142 3300046691 Ga0495670_0002872 Ga0495670_0002872_315_1649 430
143 3300046794 Ga0495589_0060281 Ga0495589_0060281_132_1466 430
144 3300047317 Ga0495604_0051127 Ga0495604_0051127_366_1700 430
145 3300047322 Ga0495680_0155888 Ga0495680_0155888_27_1361 430
146 3300047673 Ga0495593_0023237 Ga0495593_0023237_621_1955 430
147 3300048903 Ga0496100_0008741 Ga0496100_0008741_3099_4433 430
148 3300048904 Ga0496101_0001966 Ga0496101_0001966_4751_6085 430
149 3300048904 Ga0496101_0002634 Ga0496101_0002634_5346_6680 430
150 3300048905 Ga0496102_0008102 Ga0496102_0008102_6858_8192 430
151 3300048906 Ga0496103_0002359 Ga0496103_0002359_9055_10389 430
152 3300048907 Ga0496104_0002958 Ga0496104_0002958_9150_10484 430
153 3300048909 Ga0496106_0013742 Ga0496106_0013742_2983_4317 430
154 3300048910 Ga0496107_0011824 Ga0496107_0011824_4730_6064 430
155 3300048910 Ga0496107_0227243 Ga0496107_0227243_13_1347 430
156 3300048911 Ga0496108_0062283 Ga0496108_0062283_1754_3088 430
157 3300048915 Ga0496112_0017034 Ga0496112_0017034_1133_2467 430
158 3300048916 Ga0496113_0110345 Ga0496113_0110345_781_2115 430
159 3300048917 Ga0496114_0060491 Ga0496114_0060491_1181_2515 430
160 3300048918 Ga0496115_0014251 Ga0496115_0014251_4289_5623 430
161 3300048918 Ga0496115_0089862 Ga0496115_0089862_162_1496 430
162 3300050513 nmdc:mga0rr50_103643_c1 nmdc:mga0rr50_103643_c1_113_1447 430
163 3300050514 nmdc:mga08x19_48316_c1 nmdc:mga08x19_48316_c1_470_1804 430
164 3300053084 Ga0495595_0002751 Ga0495595_0002751_27_1361 430
165 3300053085 Ga0495619_0000266 Ga0495619_0000266_489_1823 430
166 3300053085 Ga0495619_0004895 Ga0495619_0004895_1881_3215 430
167 3300005437 Ga0070710_10008395 Ga0070710_100083953 431
168 3300021388 Ga0213875_10000114 Ga0213875_100001143 431
169 3300037853 Ga0436364_1352562 Ga0436364_1352562_8741_10051 431
170 3300005340 Ga0070689_100144287 Ga0070689_1001442871 432
171 3300005841 Ga0068863_100105144 Ga0068863_1001051442 432
172 3300005842 Ga0068858_100080854 Ga0068858_1000808543 432
173 3300005843 Ga0068860_100262798 Ga0068860_1002627982 432
174 3300006852 Ga0075433_10025085 Ga0075433_100250852 432
175 3300006871 Ga0075434_100006963 Ga0075434_10000696311 432
176 3300006914 Ga0075436_100078701 Ga0075436_1000787012 432
177 3300025936 Ga0207670_10208548 Ga0207670_102085481 432
178 3300026035 Ga0207703_10018478 Ga0207703_100184789 432
179 3300026095 Ga0207676_10042430 Ga0207676_100424302 432
180 3300028381 Ga0268264_10174951 Ga0268264_101749512 432
181 3300050511 nmdc:mga08y16_139534_c1 nmdc:mga08y16_139534_c1_692_1993 432
182 3300050513 nmdc:mga0rr50_3348_c1 nmdc:mga0rr50_3348_c1_6899_8200 432
183 3300050514 nmdc:mga08x19_4462_c1 nmdc:mga08x19_4462_c1_520_1821 432
184 3300005546 Ga0070696_100025633 Ga0070696_1000256337 433
185 3300035089 Ga0373944_0022543 Ga0373944_0022543_395_1699 433
186 3300035170 Ga0373943_0054223 Ga0373943_0054223_485_1789 433
187 3300035725 Ga0373947_0023835 Ga0373947_0023835_390_1694 433
188 3300037068 Ga0373925_0012851 Ga0373925_0012851_589_1893 433
189 iso_pu_bacteria 2596583598 2597028413 433
190 iso_pu_bacteria 2885266251 2885268619 433
191 3300035691 Ga0373931_0083862 Ga0373931_0083862_416_1729 434
192 3300046506 Ga0495583_0000789 Ga0495583_0000789_15421_16761 434
193 3300046515 Ga0495620_0020291 Ga0495620_0020291_888_2228 434
194 3300046524 Ga0495648_0011886 Ga0495648_0011886_3034_4374 434
195 3300046665 Ga0495661_0054835 Ga0495661_0054835_478_1818 434
196 3300046692 Ga0495671_0005979 Ga0495671_0005979_5607_6947 434
197 3300046694 Ga0495649_0000242 Ga0495649_0000242_35118_36458 434
198 3300047320 Ga0495672_0009676 Ga0495672_0009676_5571_6911 434
199 3300047323 Ga0495683_0001184 Ga0495683_0001184_10574_11914 434
200 3300047469 Ga0495673_0000424 Ga0495673_0000424_35092_36432 434
201 3300049460 Ga0495682_0001396 Ga0495682_0001396_5107_6447 434
202 3300005440 Ga0070705_100116311 Ga0070705_1001163111 435
203 3300005445 Ga0070708_100301779 Ga0070708_1003017792 435
204 3300005518 Ga0070699_100061911 Ga0070699_1000619113 435
205 3300005536 Ga0070697_100035896 Ga0070697_1000358962 435
206 3300005546 Ga0070696_100109665 Ga0070696_1001096652 435
207 3300007076 Ga0075435_100072161 Ga0075435_1000721613 435
208 3300025939 Ga0207665_10056531 Ga0207665_100565312 435
209 3300044706 Ga0466964_0012260 Ga0466964_0012260_976_2286 435
210 3300045976 Ga0466967_0008390 Ga0466967_0008390_3430_4740 435
211 3300050514 nmdc:mga08x19_102593_c1 nmdc:mga08x19_102593_c1_25_1335 435
212 3300050514 nmdc:mga08x19_20710_c1 nmdc:mga08x19_20710_c1_749_2059 435
213 iso_pu_bacteria 2721755763 2723878315 435
214 3300048909 Ga0496106_0000003 Ga0496106_0000003_150514_151914 436
215 3300048924 Ga0496121_0021136 Ga0496121_0021136_3055_4455 436
216 3300048905 Ga0496102_0061808 Ga0496102_0061808_1019_2380 437
217 3300048924 Ga0496121_0000540 Ga0496121_0000540_56417_57811 437
218 iso_pu_bacteria 2744054900 2746090160 437
219 iso_pu_bacteria 2744054901 2746095600 437
220 3300005335 Ga0070666_10091492 Ga0070666_100914923 438
221 3300006871 Ga0075434_100202786 Ga0075434_1002027861 438
222 3300009011 Ga0105251_10041834 Ga0105251_100418343 438
223 3300013306 Ga0163162_10002420 Ga0163162_1000242010 438
224 3300013308 Ga0157375_10033616 Ga0157375_100336162 438
225 3300025735 Ga0207713_1039517 Ga0207713_10395173 438
226 3300025903 Ga0207680_10122590 Ga0207680_101225901 438
227 3300025942 Ga0207689_10141300 Ga0207689_101413002 438
228 3300046460 Ga0495638_0027312 Ga0495638_0027312_1586_2968 438
229 3300046471 Ga0495650_0022526 Ga0495650_0022526_1515_2897 438
230 3300046491 Ga0495584_0026185 Ga0495584_0026185_91_1473 438
231 3300046492 Ga0495585_0024997 Ga0495585_0024997_732_2114 438
232 3300046506 Ga0495583_0050943 Ga0495583_0050943_193_1575 438
233 3300046542 Ga0495597_0022666 Ga0495597_0022666_97_1479 438
234 3300046794 Ga0495589_0001320 Ga0495589_0001320_1481_2863 438
235 3300048905 Ga0496102_0009383 Ga0496102_0009383_5119_6501 438
236 3300048906 Ga0496103_0076835 Ga0496103_0076835_452_1834 438
237 3300048907 Ga0496104_0081769 Ga0496104_0081769_203_1537 438
238 3300048909 Ga0496106_0064880 Ga0496106_0064880_862_2244 438
239 3300048911 Ga0496108_0005821 Ga0496108_0005821_2107_3441 438
240 3300048912 Ga0496109_0004418 Ga0496109_0004418_8296_9630 438
241 3300048914 Ga0496111_0040605 Ga0496111_0040605_746_2080 438
242 3300048915 Ga0496112_0008562 Ga0496112_0008562_4590_5924 438
243 3300048916 Ga0496113_0002552 Ga0496113_0002552_7344_8678 438
244 3300050515 nmdc:mga0a205_53064_c1 nmdc:mga0a205_53064_c1_467_1783 438
245 iso_pu_bacteria 2791355137 2792833562 438
246 iso_pu_bacteria 2904615490 2904618663 438
247 3300005471 Ga0070698_100000549 Ga0070698_10000054910 439
248 3300046491 Ga0495584_0023923 Ga0495584_0023923_1361_2680 439
249 3300046528 Ga0495642_0001523 Ga0495642_0001523_4948_6267 439
250 3300046615 Ga0495656_0013548 Ga0495656_0013548_652_1971 439
251 3300047318 Ga0495636_0004315 Ga0495636_0004315_3844_5163 439
252 3300047319 Ga0495674_0030914 Ga0495674_0030914_2836_4188 439
253 3300005937 Ga0081455_10002226 Ga0081455_1000222623 441
254 3300006871 Ga0075434_100117751 Ga0075434_1001177513 441
255 3300009094 Ga0111539_10064923 Ga0111539_100649232 441
256 3300021361 Ga0213872_10049487 Ga0213872_100494871 441
257 3300025302 Ga0207426_1002260 Ga0207426_100226012 441
258 3300037068 Ga0373925_0069469 Ga0373925_0069469_1048_2376 441
259 3300039447 Ga0436361_0694873 Ga0436361_0694873_230_1588 441
260 3300046454 Ga0495592_0019252 Ga0495592_0019252_3594_4946 441
261 3300046459 Ga0495629_0000138 Ga0495629_0000138_25205_26557 441
262 3300046459 Ga0495629_0009468 Ga0495629_0009468_5654_7006 441
263 3300046460 Ga0495638_0004088 Ga0495638_0004088_4674_6026 441
264 3300046463 Ga0495653_0000446 Ga0495653_0000446_5251_6603 441
265 3300046463 Ga0495653_0013384 Ga0495653_0013384_2766_4118 441
266 3300046472 Ga0495580_0002848 Ga0495580_0002848_8495_9847 441
267 3300046472 Ga0495580_0007637 Ga0495580_0007637_3758_5110 441
268 3300046473 Ga0495582_0002241 Ga0495582_0002241_8171_9523 441
269 3300046473 Ga0495582_0050932 Ga0495582_0050932_945_2273 441
270 3300046474 Ga0495605_0009908 Ga0495605_0009908_3183_4535 441
271 3300046506 Ga0495583_0003588 Ga0495583_0003588_4630_5982 441
272 3300046516 Ga0495628_0004238 Ga0495628_0004238_6153_7505 441
273 3300046517 Ga0495630_0003840 Ga0495630_0003840_5114_6466 441
274 3300046524 Ga0495648_0024280 Ga0495648_0024280_710_2062 441
275 3300046524 Ga0495648_0078045 Ga0495648_0078045_397_1749 441
276 3300046526 Ga0495666_0001806 Ga0495666_0001806_5519_6871 441
277 3300046529 Ga0495652_0014832 Ga0495652_0014832_4455_5807 441
278 3300046531 Ga0495665_0018966 Ga0495665_0018966_517_1869 441
279 3300046533 Ga0495640_0012679 Ga0495640_0012679_2222_3574 441
280 3300046535 Ga0495586_0006751 Ga0495586_0006751_4164_5516 441
281 3300046543 Ga0495645_0006001 Ga0495645_0006001_3087_4439 441
282 3300046642 Ga0495634_0012451 Ga0495634_0012451_4569_5921 441
283 3300046648 Ga0495611_0057110 Ga0495611_0057110_206_1558 441
284 3300046660 Ga0495625_0037942 Ga0495625_0037942_997_2349 441
285 3300046663 Ga0495635_0002054 Ga0495635_0002054_7674_9026 441
286 3300046679 Ga0495623_0023322 Ga0495623_0023322_2301_3653 441
287 3300046684 Ga0495669_0040223 Ga0495669_0040223_688_2040 441
288 3300046689 Ga0495613_0004866 Ga0495613_0004866_3962_5314 441
289 3300046690 Ga0495624_0008826 Ga0495624_0008826_615_1967 441
290 3300046690 Ga0495624_0009706 Ga0495624_0009706_4752_6104 441
291 3300047315 Ga0495581_0003464 Ga0495581_0003464_5209_6561 441
292 3300047319 Ga0495674_0012860 Ga0495674_0012860_3962_5314 441
293 3300047319 Ga0495674_0134161 Ga0495674_0134161_615_1967 441
294 3300047320 Ga0495672_0012479 Ga0495672_0012479_181_1533 441
295 3300047321 Ga0495676_0012375 Ga0495676_0012375_5464_6816 441
296 3300047321 Ga0495676_0029297 Ga0495676_0029297_1362_2714 441
297 3300047322 Ga0495680_0007070 Ga0495680_0007070_4896_6248 441
298 3300047443 Ga0495687_016804 Ga0495687_016804_757_2109 441
299 3300047444 Ga0495675_0014782 Ga0495675_0014782_2127_3479 441
300 3300047446 Ga0495679_000036 Ga0495679_000036_144904_146256 441
301 3300047446 Ga0495679_000345 Ga0495679_000345_10709_12061 441
302 3300047471 Ga0495684_0005507 Ga0495684_0005507_4557_5909 441
303 3300047472 Ga0495686_0025429 Ga0495686_0025429_1703_3055 441
304 3300047673 Ga0495593_0004070 Ga0495593_0004070_4990_6342 441
305 3300048088 Ga0495602_0023268 Ga0495602_0023268_235_1587 441
306 3300048088 Ga0495602_0183895 Ga0495602_0183895_139_1491 441
307 3300048089 Ga0495614_0001261 Ga0495614_0001261_6109_7461 441
308 3300048089 Ga0495614_0036449 Ga0495614_0036449_347_1699 441
309 3300048921 Ga0496118_0013136 Ga0496118_0013136_1215_2543 441
310 3300048921 Ga0496118_0044806 Ga0496118_0044806_51_1403 441
311 3300048924 Ga0496121_0003588 Ga0496121_0003588_902_2230 441
312 3300048924 Ga0496121_0011954 Ga0496121_0011954_3150_4502 441
313 3300048929 Ga0496126_0015198 Ga0496126_0015198_1180_2532 441
314 3300049460 Ga0495682_0047455 Ga0495682_0047455_34_1386 441
315 3300050511 nmdc:mga08y16_75561_c1 nmdc:mga08y16_75561_c1_453_1781 441
316 3300053125 Ga0500618_004181 Ga0500618_004181_2879_4279 441
317 3300005341 Ga0070691_10029638 Ga0070691_100296381 442
318 3300005435 Ga0070714_100064859 Ga0070714_1000648592 442
319 3300005444 Ga0070694_100021398 Ga0070694_1000213984 442
320 3300005455 Ga0070663_100000451 Ga0070663_10000045117 442
321 3300005545 Ga0070695_100001841 Ga0070695_1000018414 442
322 3300005983 Ga0081540_1024793 Ga0081540_10247933 442
323 3300006175 Ga0070712_100017798 Ga0070712_1000177988 442
324 3300006175 Ga0070712_100086364 Ga0070712_1000863642 442
325 3300006844 Ga0075428_100040726 Ga0075428_1000407262 442
326 3300006880 Ga0075429_100063333 Ga0075429_1000633332 442
327 3300009093 Ga0105240_10018445 Ga0105240_100184453 442
328 3300009551 Ga0105238_10029091 Ga0105238_100290914 442
329 3300025297 Ga0209758_1003980 Ga0209758_10039803 442
330 3300025915 Ga0207693_10000828 Ga0207693_1000082816 442
331 3300025915 Ga0207693_10120391 Ga0207693_101203911 442
332 3300025924 Ga0207694_10006459 Ga0207694_100064593 442
333 3300025929 Ga0207664_10047651 Ga0207664_100476515 442
334 3300026067 Ga0207678_10008614 Ga0207678_100086144 442
335 3300035089 Ga0373944_0012483 Ga0373944_0012483_164_1495 442
336 3300035170 Ga0373943_0000492 Ga0373943_0000492_15334_16665 442
337 3300035171 Ga0373946_0001057 Ga0373946_0001057_596_1927 442
338 3300035692 Ga0373935_0085591 Ga0373935_0085591_492_1823 442
339 3300035695 Ga0373927_0001141 Ga0373927_0001141_4046_5377 442
340 3300035725 Ga0373947_0003127 Ga0373947_0003127_1550_2881 442
341 3300037068 Ga0373925_0074285 Ga0373925_0074285_1158_2489 442
342 3300039437 Ga0436365_0664371 Ga0436365_0664371_1119_2450 442
343 3300046454 Ga0495592_0127416 Ga0495592_0127416_76_1407 442
344 3300046459 Ga0495629_0035061 Ga0495629_0035061_1141_2472 442
345 3300046472 Ga0495580_0008581 Ga0495580_0008581_228_1589 442
346 3300046472 Ga0495580_0089303 Ga0495580_0089303_345_1676 442
347 3300046517 Ga0495630_0001163 Ga0495630_0001163_3700_5031 442
348 3300046536 Ga0495587_0046890 Ga0495587_0046890_979_2310 442
349 3300046689 Ga0495613_0014024 Ga0495613_0014024_4420_5751 442
350 3300047315 Ga0495581_0004873 Ga0495581_0004873_3760_5091 442
351 3300047471 Ga0495684_0010002 Ga0495684_0010002_2953_4284 442
352 3300050508 nmdc:mga09592_10752_c1 nmdc:mga09592_10752_c1_4476_5807 442
353 3300053119 Ga0500595_000343 Ga0500595_000343_12228_13559 442
354 3300005331 Ga0070670_100078153 Ga0070670_1000781533 443
355 3300005334 Ga0068869_100043661 Ga0068869_1000436612 443
356 3300005340 Ga0070689_100014709 Ga0070689_1000147095 443
357 3300005341 Ga0070691_10034176 Ga0070691_100341761 443
358 3300005353 Ga0070669_100040898 Ga0070669_1000408983 443
359 3300005354 Ga0070675_100052908 Ga0070675_1000529083 443
360 3300005434 Ga0070709_10108742 Ga0070709_101087421 443
361 3300005435 Ga0070714_100148553 Ga0070714_1001485532 443
362 3300005444 Ga0070694_100129865 Ga0070694_1001298652 443
363 3300005455 Ga0070663_100149043 Ga0070663_1001490431 443
364 3300005459 Ga0068867_100051720 Ga0068867_1000517202 443
365 3300005535 Ga0070684_100033013 Ga0070684_1000330132 443
366 3300005543 Ga0070672_100112458 Ga0070672_1001124581 443
367 3300005578 Ga0068854_100009305 Ga0068854_1000093053 443
368 3300005615 Ga0070702_100010331 Ga0070702_1000103312 443
369 3300005616 Ga0068852_100086168 Ga0068852_1000861683 443
370 3300005719 Ga0068861_100035421 Ga0068861_1000354212 443
371 3300005842 Ga0068858_100048009 Ga0068858_1000480092 443
372 3300006038 Ga0075365_10054021 Ga0075365_100540212 443
373 3300006177 Ga0075362_10030415 Ga0075362_100304152 443
374 3300006178 Ga0075367_10038185 Ga0075367_100381852 443
375 3300006237 Ga0097621_100066201 Ga0097621_1000662013 443
376 3300006871 Ga0075434_100109950 Ga0075434_1001099503 443
377 3300006881 Ga0068865_100067191 Ga0068865_1000671911 443
378 3300007788 Ga0099795_10031872 Ga0099795_100318722 443
379 3300009094 Ga0111539_10063999 Ga0111539_100639992 443
380 3300009101 Ga0105247_10008565 Ga0105247_100085652 443
381 3300009147 Ga0114129_10009585 Ga0114129_1000958525 443
382 3300009147 Ga0114129_10024927 Ga0114129_100249273 443
383 3300009545 Ga0105237_10059075 Ga0105237_100590753 443
384 3300009551 Ga0105238_10093250 Ga0105238_100932503 443
385 3300010159 Ga0099796_10013301 Ga0099796_100133012 443
386 3300010375 Ga0105239_10135402 Ga0105239_101354021 443
387 3300014325 Ga0163163_10260043 Ga0163163_102600432 443
388 3300014745 Ga0157377_10001914 Ga0157377_100019146 443
389 3300025908 Ga0207643_10000233 Ga0207643_1000023314 443
390 3300025918 Ga0207662_10012424 Ga0207662_100124241 443
391 3300025919 Ga0207657_10034859 Ga0207657_100348592 443
392 3300025924 Ga0207694_10144756 Ga0207694_101447562 443
393 3300025925 Ga0207650_10094737 Ga0207650_100947372 443
394 3300025927 Ga0207687_10045165 Ga0207687_100451652 443
395 3300025929 Ga0207664_10140353 Ga0207664_101403532 443
396 3300025933 Ga0207706_10003937 Ga0207706_100039378 443
397 3300025940 Ga0207691_10032224 Ga0207691_100322242 443
398 3300025960 Ga0207651_10051446 Ga0207651_100514462 443
399 3300025961 Ga0207712_10018184 Ga0207712_100181842 443
400 3300026067 Ga0207678_10015183 Ga0207678_100151836 443
401 3300026075 Ga0207708_10000911 Ga0207708_100009112 443
402 3300026116 Ga0207674_10122403 Ga0207674_101224032 443
403 3300026118 Ga0207675_100005973 Ga0207675_1000059733 443
404 3300026142 Ga0207698_10056130 Ga0207698_100561303 443
405 3300027512 Ga0209179_1003277 Ga0209179_10032772 443
406 3300027907 Ga0207428_10085020 Ga0207428_100850202 443
407 3300028379 Ga0268266_10058883 Ga0268266_100588833 443
408 3300028800 Ga0265338_10007619 Ga0265338_1000761914 443
409 3300028800 Ga0265338_10102309 Ga0265338_101023093 443
410 3300031235 Ga0265330_10012904 Ga0265330_100129042 443
411 3300031241 Ga0265325_10010113 Ga0265325_100101132 443
412 3300031241 Ga0265325_10032102 Ga0265325_100321022 443
413 3300031247 Ga0265340_10026558 Ga0265340_100265583 443
414 3300031344 Ga0265316_10004646 Ga0265316_100046465 443
415 3300031595 Ga0265313_10021023 Ga0265313_100210233 443
416 3300031595 Ga0265313_10053409 Ga0265313_100534092 443
417 3300031712 Ga0265342_10023388 Ga0265342_100233884 443
418 3300035089 Ga0373944_0005991 Ga0373944_0005991_69_1403 443
419 3300035090 Ga0373949_0015790 Ga0373949_0015790_223_1557 443
420 3300035113 Ga0373936_0022227 Ga0373936_0022227_612_1946 443
421 3300035116 Ga0373945_0001338 Ga0373945_0001338_970_2304 443
422 3300035170 Ga0373943_0009828 Ga0373943_0009828_214_1548 443
423 3300035171 Ga0373946_0050017 Ga0373946_0050017_192_1526 443
424 3300035692 Ga0373935_0034718 Ga0373935_0034718_444_1778 443
425 3300035692 Ga0373935_0158758 Ga0373935_0158758_34_1368 443
426 3300035695 Ga0373927_0021771 Ga0373927_0021771_2547_3881 443
427 3300035725 Ga0373947_0006841 Ga0373947_0006841_3725_5059 443
428 3300035725 Ga0373947_0065598 Ga0373947_0065598_13_1347 443
429 3300036401 Ga0373937_0022352 Ga0373937_0022352_1938_3272 443
430 3300036401 Ga0373937_0034794 Ga0373937_0034794_133_1467 443
431 3300037068 Ga0373925_0002878 Ga0373925_0002878_11450_12784 443
432 3300039437 Ga0436365_1652334 Ga0436365_1652334_210_1544 443
433 3300046455 Ga0495603_0015424 Ga0495603_0015424_2455_3789 443
434 3300046459 Ga0495629_0022819 Ga0495629_0022819_1944_3278 443
435 3300046461 Ga0495641_0037115 Ga0495641_0037115_442_1776 443
436 3300046473 Ga0495582_0015023 Ga0495582_0015023_786_2120 443
437 3300046517 Ga0495630_0006265 Ga0495630_0006265_1166_2500 443
438 3300046533 Ga0495640_0043740 Ga0495640_0043740_51_1466 443
439 3300046539 Ga0495621_0038518 Ga0495621_0038518_215_1582 443
440 3300046543 Ga0495645_0101050 Ga0495645_0101050_477_1811 443
441 3300046663 Ga0495635_0010307 Ga0495635_0010307_1326_2660 443
442 3300046690 Ga0495624_0079688 Ga0495624_0079688_529_1863 443
443 3300047317 Ga0495604_0061181 Ga0495604_0061181_289_1623 443
444 3300047321 Ga0495676_0034143 Ga0495676_0034143_2316_3650 443
445 3300047470 Ga0495681_0047132 Ga0495681_0047132_298_1632 443
446 3300048905 Ga0496102_0137287 Ga0496102_0137287_640_1974 443
447 3300048906 Ga0496103_0063963 Ga0496103_0063963_779_2113 443
448 3300048907 Ga0496104_0052295 Ga0496104_0052295_488_1822 443
449 3300048909 Ga0496106_0061578 Ga0496106_0061578_475_1809 443
450 3300048910 Ga0496107_0217981 Ga0496107_0217981_47_1381 443
451 3300048911 Ga0496108_0010386 Ga0496108_0010386_3665_4999 443
452 3300048911 Ga0496108_0036535 Ga0496108_0036535_1596_2930 443
453 3300048912 Ga0496109_0024349 Ga0496109_0024349_2783_4117 443
454 3300048912 Ga0496109_0039169 Ga0496109_0039169_850_2184 443
455 3300048913 Ga0496110_0093710 Ga0496110_0093710_727_2061 443
456 3300048913 Ga0496110_0157611 Ga0496110_0157611_633_1967 443
457 3300048914 Ga0496111_0038873 Ga0496111_0038873_2001_3335 443
458 3300048915 Ga0496112_0004542 Ga0496112_0004542_3250_4584 443
459 3300048916 Ga0496113_0013645 Ga0496113_0013645_447_1781 443
460 3300048917 Ga0496114_0072436 Ga0496114_0072436_308_1642 443
461 3300048917 Ga0496114_0073911 Ga0496114_0073911_563_1897 443
462 3300050491 nmdc:mga00v17_107801_c1 nmdc:mga00v17_107801_c1_386_1720 443
463 3300050492 nmdc:mga0yw44_12570_c1 nmdc:mga0yw44_12570_c1_2116_3450 443
464 3300050507 nmdc:mga05p37_25194_c1 nmdc:mga05p37_25194_c1_5005_6339 443
465 3300050511 nmdc:mga08y16_305920_c1 nmdc:mga08y16_305920_c1_143_1477 443
466 3300053077 Ga0495601_0003272 Ga0495601_0003272_1116_2450 443
467 3300053085 Ga0495619_0001146 Ga0495619_0001146_15894_17228 443
468 3300053087 Ga0500643_000617 Ga0500643_000617_9666_11000 443
469 3300053119 Ga0500595_000022 Ga0500595_000022_73499_74833 443
470 3300053119 Ga0500595_018738 Ga0500595_018738_918_2279 443
471 3300053130 Ga0500642_0050863 Ga0500642_0050863_257_1591 443
472 3300053131 Ga0500652_000016 Ga0500652_000016_124028_125389 443
473 3300053139 Ga0500568_0033964 Ga0500568_0033964_547_1881 443
474 3300005434 Ga0070709_10091406 Ga0070709_100914061 444
475 3300006914 Ga0075436_100004329 Ga0075436_1000043292 444
476 3300007076 Ga0075435_100095244 Ga0075435_1000952442 444
477 3300021388 Ga0213875_10001351 Ga0213875_100013517 444
478 3300037853 Ga0436364_1075760 Ga0436364_1075760_7935_9272 444
479 3300050513 nmdc:mga0rr50_59997_c1 nmdc:mga0rr50_59997_c1_875_2311 444
480 3300050514 nmdc:mga08x19_5972_c1 nmdc:mga08x19_5972_c1_737_2173 444
481 3300005336 Ga0070680_100076467 Ga0070680_1000764672 445
482 3300005615 Ga0070702_100102084 Ga0070702_1001020841 445
483 3300025918 Ga0207662_10115738 Ga0207662_101157382 445
484 3300005295 Ga0065707_10095351 Ga0065707_100953512 449
485 3300005468 Ga0070707_100017912 Ga0070707_1000179121 449
486 3300005471 Ga0070698_100078682 Ga0070698_1000786822 449
487 3300005536 Ga0070697_100122601 Ga0070697_1001226012 449
488 3300005549 Ga0070704_100004652 Ga0070704_1000046526 449
489 3300009147 Ga0114129_10092130 Ga0114129_100921304 449
490 3300009148 Ga0105243_10018193 Ga0105243_100181934 449
491 3300044683 Ga0466965_0044777 Ga0466965_0044777_328_1680 449
492 3300046538 Ga0495609_0017184 Ga0495609_0017184_66_1418 449
493 3300047318 Ga0495636_0003571 Ga0495636_0003571_1396_2748 449
494 3300005518 Ga0070699_100001070 Ga0070699_10000107024 450
495 3300005546 Ga0070696_100069223 Ga0070696_1000692232 450
496 3300037471 Ga0395905_0001030 Ga0395905_0001030_27190_28545 450
497 3300046492 Ga0495585_0013503 Ga0495585_0013503_2526_3881 450
498 3300046513 Ga0495616_0037014 Ga0495616_0037014_54_1409 450
499 3300050513 nmdc:mga0rr50_116449_c1 nmdc:mga0rr50_116449_c1_455_1813 451
500 iso_pu_bacteria 2513237166 2514047036 455
501 iso_pu_bacteria 2562617112 2563064900 455
502 iso_pu_bacteria 2711768613 2713482111 455
503 3300003354 JGI25160J50197_1000039 JGI25160J50197_100003925 457
504 3300005262 Ga0065165_1000319 Ga0065165_100031950 457
505 3300025284 Ga0209130_1003787 Ga0209130_10037873 457
506 3300025302 Ga0207426_1000018 Ga0207426_1000018209 457
507 3300044901 Ga0466960_0012351 Ga0466960_0012351_308_1702 457
508 3300003320 rootH2_10067189 rootH2_100671893 458
509 3300003323 rootH1_10050528 rootH1_100505283 458
510 3300048909 Ga0496106_0000032 Ga0496106_0000032_115980_117365 458
511 3300048924 Ga0496121_0005258 Ga0496121_0005258_12680_14065 458
512 3300048927 Ga0496124_0103653 Ga0496124_0103653_461_1846 458
513 3300003354 JGI25160J50197_1000652 JGI25160J50197_100065210 459
514 3300005262 Ga0065165_1000319 Ga0065165_100031971 459
515 3300025284 Ga0209130_1002965 Ga0209130_10029657 459
516 3300025302 Ga0207426_1000018 Ga0207426_1000018230 459
517 3300037471 Ga0395905_0001135 Ga0395905_0001135_21944_23323 459
518 3300046455 Ga0495603_0035565 Ga0495603_0035565_1003_2382 459
519 3300046472 Ga0495580_0036026 Ga0495580_0036026_1815_3194 459
520 3300046474 Ga0495605_0025718 Ga0495605_0025718_160_1539 459
521 3300046506 Ga0495583_0005487 Ga0495583_0005487_1847_3226 459
522 3300046524 Ga0495648_0052277 Ga0495648_0052277_509_1888 459
523 3300046531 Ga0495665_0028332 Ga0495665_0028332_834_2213 459
524 3300046557 Ga0495622_0003932 Ga0495622_0003932_4083_5462 459
525 3300046694 Ga0495649_0021882 Ga0495649_0021882_860_2239 459
526 3300046794 Ga0495589_0019368 Ga0495589_0019368_792_2171 459
527 3300047319 Ga0495674_0008140 Ga0495674_0008140_8236_9615 459
528 3300047323 Ga0495683_0045001 Ga0495683_0045001_476_1855 459
529 3300047469 Ga0495673_0015972 Ga0495673_0015972_897_2276 459
530 3300048903 Ga0496100_0014315 Ga0496100_0014315_1084_2463 459
531 3300048915 Ga0496112_0003353 Ga0496112_0003353_6464_7843 459
532 3300048916 Ga0496113_0002993 Ga0496113_0002993_2188_3567 459
533 3300048918 Ga0496115_0031112 Ga0496115_0031112_1652_3031 459
534 3300048921 Ga0496118_0066688 Ga0496118_0066688_404_1876 459
535 3300048924 Ga0496121_0002263 Ga0496121_0002263_25114_26493 459
536 iso_pu_bacteria 2508501125 2509129573 459
537 3300048929 Ga0496126_0007159 Ga0496126_0007159_1640_3040 460
538 3300046459 Ga0495629_0000042 Ga0495629_0000042_26024_27418 461
539 3300046463 Ga0495653_0000321 Ga0495653_0000321_15599_16993 461
540 3300046472 Ga0495580_0003831 Ga0495580_0003831_8523_9917 461
541 3300046516 Ga0495628_0001775 Ga0495628_0001775_10214_11608 461
542 3300046524 Ga0495648_0003381 Ga0495648_0003381_10470_11864 461
543 3300046531 Ga0495665_0003795 Ga0495665_0003795_1804_3198 461
544 3300046680 Ga0495646_0000273 Ga0495646_0000273_13255_14649 461
545 3300046689 Ga0495613_0045610 Ga0495613_0045610_1510_2904 461
546 3300046690 Ga0495624_0000216 Ga0495624_0000216_26024_27418 461
547 3300047319 Ga0495674_0011538 Ga0495674_0011538_3691_5085 461
548 3300047321 Ga0495676_0065974 Ga0495676_0065974_334_1728 461
549 3300047673 Ga0495593_0000149 Ga0495593_0000149_22818_24212 461
550 iso_pu_bacteria 2904483920 2904486501 462
551 iso_pu_bacteria 8055301274 8055304502 462
552 iso_pu_bacteria 2738541296 2738822668 463
553 iso_pu_bacteria 2738541298 2738834875 463
554 iso_pu_bacteria 2738541306 2738876354 463
555 iso_pu_bacteria 2738543002 2739188298 463
556 iso_pu_bacteria 2738543008 2739222951 463
557 iso_pu_bacteria 2945934425 2945940031 463
558 iso_pu_bacteria 2990703756 2990707155 463
559 iso_pu_bacteria 641736151 642424110 463
560 3300046457 Ga0495590_0001787 Ga0495590_0001787_1482_2915 466
561 3300046507 Ga0495606_0007081 Ga0495606_0007081_4721_6154 466
562 3300046542 Ga0495597_0032947 Ga0495597_0032947_65_1498 466
563 3300046694 Ga0495649_0001737 Ga0495649_0001737_12960_14393 466
564 3300047323 Ga0495683_0000360 Ga0495683_0000360_9432_10865 466
565 3300047443 Ga0495687_011638 Ga0495687_011638_1524_2957 466
566 3300001979 JGI24740J21852_10010481 JGI24740J21852_100104813 467
567 3300001989 JGI24739J22299_10004836 JGI24739J22299_100048363 467
568 3300002075 JGI24738J21930_10005402 JGI24738J21930_100054022 467
569 3300005455 Ga0070663_100158070 Ga0070663_1001580702 467
570 3300013105 Ga0157369_10128014 Ga0157369_101280142 467
571 3300026067 Ga0207678_10018843 Ga0207678_100188432 467
572 3300031911 Ga0307412_10000053 Ga0307412_1000005328 467
573 3300046474 Ga0495605_0002503 Ga0495605_0002503_476_1879 467
574 3300046512 Ga0495610_0001257 Ga0495610_0001257_5668_7071 467
575 3300046810 Ga0495660_0088169 Ga0495660_0088169_139_1542 467
576 3300047323 Ga0495683_0050657 Ga0495683_0050657_67_1470 467

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

66

490

0.84

PF07690

MFS_1

Major Facilitator Superfamily

329

488

0.83

PF07690

MFS_1

Major Facilitator Superfamily

73

342

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8598 44 452
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8532 45 456
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8513 44 462
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8468 45 456
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8449 44 462
ID Description Score Start End Superfamily
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.929 43 233 1.20.1250.20
af_P77589_11_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9251 40 232 1.20.1250.20
af_A0A0R0GUC5_71_252_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9245 41 221 1.20.1250.20
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9128 92 228 1.20.1250.20
af_P25744_212_408_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9121 43 223 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2N2MRZ7-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9079 39 456 GO:0005886
GO:0046943
AF-A0A839XN35-F1-model_v4 Putative MFS family arabinose efflux permease 0.9072 44 228 GO:0005886
GO:0022857
AF-F7S474-F1-model_v4 Major facilitator transporter 0.8934 19 342 GO:0005886
GO:0046943
AF-C0XND7-F1-model_v4 Drug resistance transporter, EmrB/QacA family 0.89 35 221 GO:0005886
GO:0022857
AF-A0A1Q8QWG6-F1-model_v4 Sialic acid transporter (Permease) NanT 0.8869 39 259 GO:0005886
GO:0046943

Feature Viewer

pLDDT pTM Quality
86.08 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map