F465503

General Info

Members Datasets Scaffolds Average Seq Length
576 271 1150 260

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10022169|Ga0105237_100221692
Length 299
Sequence MRLGRSHRALAGIKQRTATRRSLPPSFQERRLQDRPMLSINNIEVVYDSVILVLRGVSLEVKPGTIATLLGANGAGKTTTLKAISGVLRTERGEVTKGSITFGGLRIDGRRPYDVTQLGISQVFEGRRVFEHLTTEENLIAGGHTQSQSRKVRDGIERVYAYFPLLKERRWQQAGYLSGGEQQMLAIGRALMSGPQVILLDEPSLGLAPMLVEEIFGIVQRLVAQEKLSVLLVEQNAAMALSVAEHGYVMETGRIVLEGSSASLRDNSDIREFYLGLNELGVRKSYRDVKHYKRRKRWL

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 1.22
Rhizosphere 92.01
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10022169 3300009545 Bacteria 6517
2 JGI25406J46586_10013794 3300003203 Bacteria 3455
3 JGI25404J52841_10004098 3300003659 Bacteria 2932
4 Ga0065715_10127440 3300005293 Bacteria 2087
5 Ga0070658_10242776 3300005327 Bacteria 1527
6 Ga0070676_10000399 3300005328 Bacteria 20207
7 Ga0070670_100035964 3300005331 Bacteria 4263
8 Ga0070670_100232805 3300005331 Bacteria 1603
9 Ga0070677_10002155 3300005333 Bacteria 6291
10 Ga0068869_100029011 3300005334 Bacteria 3872
11 Ga0068869_100062638 3300005334 Bacteria 2730
12 Ga0070666_10013757 3300005335 Bacteria 5138
13 Ga0070680_100001533 3300005336 Bacteria 16841
14 Ga0070682_100005933 3300005337 Bacteria 6834
15 Ga0068868_100115665 3300005338 Bacteria 2183
16 Ga0070660_100000294 3300005339 Bacteria 33307
17 Ga0070689_100070424 3300005340 Bacteria 2730
18 Ga0070691_10013765 3300005341 Bacteria 3711
19 Ga0070661_100043172 3300005344 Bacteria 3293
20 Ga0070692_10000718 3300005345 Bacteria 10731
21 Ga0070669_100016006 3300005353 Bacteria 5352
22 Ga0070669_100120230 3300005353 Bacteria 2003
23 Ga0070675_100113468 3300005354 Bacteria 2295
24 Ga0070675_100304721 3300005354 Bacteria 1404
25 Ga0070671_100020266 3300005355 Bacteria 5422
26 Ga0070671_100173496 3300005355 Bacteria 1824
27 Ga0070671_100602485 3300005355 Bacteria 949
28 Ga0070674_100007114 3300005356 Bacteria 6584
29 Ga0070673_100269269 3300005364 Bacteria 1490
30 Ga0070659_100000151 3300005366 Bacteria 53009
31 Ga0070659_100477072 3300005366 Bacteria 1061
32 Ga0070667_100282017 3300005367 Bacteria 1492
33 Ga0070714_100056546 3300005435 Bacteria 3356
34 Ga0070711_100241973 3300005439 Bacteria 1411
35 Ga0070705_100010313 3300005440 Bacteria 4674
36 Ga0070700_100049794 3300005441 Bacteria 2602
37 Ga0070700_100095572 3300005441 Bacteria 1948
38 Ga0070700_100097374 3300005441 Bacteria 1932
39 Ga0070694_100004310 3300005444 Bacteria 8551
40 Ga0070694_100016933 3300005444 Bacteria 4597
41 Ga0070708_100001898 3300005445 Bacteria 16073
42 Ga0070708_100006096 3300005445 Bacteria 9593
43 Ga0070708_100076542 3300005445 Bacteria 3022
44 Ga0070708_100260415 3300005445 Bacteria 1630
45 Ga0070663_100006298 3300005455 Bacteria 7121
46 Ga0070663_100006915 3300005455 Bacteria 6869
47 Ga0070663_100197272 3300005455 Bacteria 1569
48 Ga0070678_100005703 3300005456 Bacteria 7233
49 Ga0070678_100913160 3300005456 Bacteria 803
50 Ga0070662_100012111 3300005457 Bacteria 5710
51 Ga0070662_100277347 3300005457 Bacteria 1356
52 Ga0068867_100005697 3300005459 Bacteria 8828
53 Ga0068867_100023549 3300005459 Bacteria 4408
54 Ga0070685_10218428 3300005466 Bacteria 1248
55 Ga0070685_10485524 3300005466 Bacteria 871
56 Ga0070706_100027679 3300005467 Bacteria 5215
57 Ga0070706_100027858 3300005467 Bacteria 5196
58 Ga0070706_100033274 3300005467 Bacteria 4757
59 Ga0070706_100091335 3300005467 Bacteria 2824
60 Ga0070706_100118229 3300005467 Bacteria 2469
61 Ga0070707_100009939 3300005468 Bacteria 8854
62 Ga0070707_100038387 3300005468 Bacteria 4574
63 Ga0070707_100041607 3300005468 Bacteria 4399
64 Ga0070707_100064235 3300005468 Bacteria 3524
65 Ga0070707_100397158 3300005468 Bacteria 1339
66 Ga0070698_100015254 3300005471 Bacteria 8125
67 Ga0070698_100035890 3300005471 Bacteria 5124
68 Ga0070698_100208544 3300005471 Bacteria 1889
69 Ga0070699_100010525 3300005518 Bacteria 8002
70 Ga0070699_100019931 3300005518 Bacteria 5779
71 Ga0070699_100052904 3300005518 Bacteria 3514
72 Ga0070699_100079156 3300005518 Bacteria 2863
73 Ga0070699_100091658 3300005518 Bacteria 2657
74 Ga0070699_100236690 3300005518 Bacteria 1629
75 Ga0070699_100259817 3300005518 Bacteria 1553
76 Ga0070699_100425136 3300005518 Bacteria 1203
77 Ga0070679_100001088 3300005530 Bacteria 23758
78 Ga0070684_100005850 3300005535 Bacteria 9463
79 Ga0070697_100015984 3300005536 Bacteria 5899
80 Ga0070697_100065646 3300005536 Bacteria 2966
81 Ga0070697_100075728 3300005536 Bacteria 2767
82 Ga0070697_100127547 3300005536 Bacteria 2132
83 Ga0070697_100279255 3300005536 Bacteria 1433
84 Ga0068853_100029933 3300005539 Bacteria 4594
85 Ga0070672_100189949 3300005543 Bacteria 1714
86 Ga0070686_100231904 3300005544 Bacteria 1340
87 Ga0070695_100018028 3300005545 Bacteria 4286
88 Ga0070696_100001176 3300005546 Bacteria 16947
89 Ga0070696_100012135 3300005546 Bacteria 5774
90 Ga0070665_100164664 3300005548 Bacteria 2220
91 Ga0070704_100000990 3300005549 Bacteria 14478
92 Ga0070704_100061396 3300005549 Bacteria 2689
93 Ga0068855_100001154 3300005563 Bacteria 32715
94 Ga0070664_100007461 3300005564 Bacteria 8830
95 Ga0068854_100005822 3300005578 Bacteria 7809
96 Ga0068856_100001162 3300005614 Bacteria 27668
97 Ga0070702_100059932 3300005615 Bacteria 2211
98 Ga0068852_100007158 3300005616 Bacteria 8131
99 Ga0068859_100001630 3300005617 Bacteria 22959
100 Ga0068864_100377610 3300005618 Bacteria 1342
101 Ga0068864_100828378 3300005618 Bacteria 911
102 Ga0068866_10013453 3300005718 Bacteria 3591
103 Ga0068861_100010098 3300005719 Bacteria 6546
104 Ga0068861_100279619 3300005719 Bacteria 1437
105 Ga0068851_10006644 3300005834 Bacteria 5292
106 Ga0068870_10000280 3300005840 Bacteria 18887
107 Ga0068870_10255027 3300005840 Bacteria 1089
108 Ga0068863_100180732 3300005841 Bacteria 2024
109 Ga0068858_100062507 3300005842 Bacteria 3443
110 Ga0068860_100032109 3300005843 Bacteria 5048
111 Ga0068860_100367717 3300005843 Bacteria 1418
112 Ga0068860_100389977 3300005843 Bacteria 1376
113 Ga0068862_100009378 3300005844 Bacteria 8095
114 Ga0068862_100031797 3300005844 Bacteria 4458
115 Ga0068862_100332898 3300005844 Bacteria 1404
116 Ga0081455_10000179 3300005937 Bacteria 79869
117 Ga0081455_10000429 3300005937 Bacteria 55107
118 Ga0081455_10000614 3300005937 Bacteria 46194
119 Ga0081455_10055836 3300005937 Bacteria 3356
120 Ga0081540_1000417 3300005983 Bacteria 42001
121 Ga0081540_1000439 3300005983 Bacteria 41151
122 Ga0081540_1002759 3300005983 Bacteria 14251
123 Ga0081540_1006694 3300005983 Bacteria 8336
124 Ga0081540_1049978 3300005983 Bacteria 2081
125 Ga0081539_10000009 3300005985 Bacteria 509286
126 Ga0081539_10005848 3300005985 Bacteria 12205
127 Ga0081539_10047453 3300005985 Bacteria 2452
128 Ga0070717_10305804 3300006028 Bacteria 1414
129 Ga0075365_10004171 3300006038 Bacteria 7608
130 Ga0075365_10009014 3300006038 Bacteria 5706
131 Ga0075365_10011665 3300006038 Bacteria 5178
132 Ga0075368_10018094 3300006042 Bacteria 2644
133 Ga0075363_100025914 3300006048 Bacteria 2995
134 Ga0075363_100038218 3300006048 Bacteria 2524
135 Ga0075364_10008508 3300006051 Bacteria 6138
136 Ga0075364_10300364 3300006051 Bacteria 1093
137 Ga0070715_10014494 3300006163 Bacteria 2922
138 Ga0070715_10175272 3300006163 Unclassified 1071
139 Ga0075362_10025087 3300006177 Bacteria 2534
140 Ga0075362_10033558 3300006177 Bacteria 2233
141 Ga0075367_10002008 3300006178 Bacteria 9074
142 Ga0075367_10010976 3300006178 Bacteria 4776
143 Ga0075367_10080226 3300006178 Bacteria 1973
144 Ga0075369_10119150 3300006186 Bacteria 1194
145 Ga0075366_10149490 3300006195 Bacteria 1414
146 Ga0097621_100451799 3300006237 Bacteria 1158
147 Ga0075370_10179351 3300006353 Bacteria 1246
148 Ga0068871_100768796 3300006358 Bacteria 886
149 Ga0075428_100000617 3300006844 Bacteria 36390
150 Ga0075428_100011753 3300006844 Bacteria 9748
151 Ga0075428_100030609 3300006844 Bacteria 5951
152 Ga0075428_100079237 3300006844 Bacteria 3586
153 Ga0075428_100112882 3300006844 Bacteria 2960
154 Ga0075428_100178276 3300006844 Bacteria 2301
155 Ga0075428_100297808 3300006844 Bacteria 1734
156 Ga0075430_100016657 3300006846 Bacteria 6259
157 Ga0075430_100017473 3300006846 Bacteria 6110
158 Ga0075430_100025913 3300006846 Bacteria 4990
159 Ga0075431_100000629 3300006847 Bacteria 29777
160 Ga0075431_100006204 3300006847 Bacteria 11869
161 Ga0075431_100006578 3300006847 Bacteria 11549
162 Ga0075431_100009272 3300006847 Bacteria 9877
163 Ga0075431_100034402 3300006847 Bacteria 5220
164 Ga0075431_100053338 3300006847 Bacteria 4169
165 Ga0075431_100083658 3300006847 Bacteria 3294
166 Ga0075431_100142250 3300006847 Bacteria 2473
167 Ga0075431_100429322 3300006847 Bacteria 1320
168 Ga0075433_10001366 3300006852 Bacteria 17911
169 Ga0075433_10001697 3300006852 Bacteria 16428
170 Ga0075433_10003287 3300006852 Bacteria 12487
171 Ga0075433_10292331 3300006852 Bacteria 1443
172 Ga0075433_10297795 3300006852 Bacteria 1428
173 Ga0075434_100006800 3300006871 Bacteria 10518
174 Ga0075434_100053333 3300006871 Bacteria 4018
175 Ga0075434_100180854 3300006871 Bacteria 2129
176 Ga0075434_100305462 3300006871 Bacteria 1611
177 Ga0075429_100010885 3300006880 Bacteria 7866
178 Ga0075429_100020932 3300006880 Bacteria 5675
179 Ga0075429_100032661 3300006880 Bacteria 4524
180 Ga0075429_100043151 3300006880 Bacteria 3923
181 Ga0075429_100050412 3300006880 Bacteria 3621
182 Ga0075429_100054029 3300006880 Bacteria 3495
183 Ga0075436_100000722 3300006914 Bacteria 21877
184 Ga0075436_100042958 3300006914 Bacteria 3117
185 Ga0097620_100001630 3300006931 Bacteria 22959
186 Ga0075435_100009154 3300007076 Bacteria 7149
187 Ga0075435_100009192 3300007076 Bacteria 7136
188 Ga0075435_100033010 3300007076 Bacteria 4090
189 Ga0075435_100060207 3300007076 Bacteria 3078
190 Ga0075435_100114946 3300007076 Bacteria 2240
191 Ga0075435_100134532 3300007076 Bacteria 2070
192 Ga0075435_100195772 3300007076 Bacteria 1711
193 Ga0099794_10006294 3300007265 Bacteria 4796
194 Ga0099794_10007647 3300007265 Bacteria 4450
195 Ga0099794_10190126 3300007265 Bacteria 1050
196 Ga0111539_10015983 3300009094 Bacteria 9322
197 Ga0111539_10016701 3300009094 Bacteria 9096
198 Ga0111539_10056697 3300009094 Bacteria 4655
199 Ga0111539_10061341 3300009094 Bacteria 4455
200 Ga0111539_10086480 3300009094 Bacteria 3684
201 Ga0111539_10113159 3300009094 Bacteria 3183
202 Ga0111539_10632023 3300009094 Bacteria 1247
203 Ga0111539_10778115 3300009094 Bacteria 1114
204 Ga0111539_11216898 3300009094 Bacteria 875
205 Ga0114129_10010340 3300009147 Bacteria 13308
206 Ga0114129_10024814 3300009147 Bacteria 8498
207 Ga0114129_10028563 3300009147 Bacteria 7904
208 Ga0114129_10078683 3300009147 Bacteria 4586
209 Ga0114129_10117692 3300009147 Bacteria 3660
210 Ga0114129_10204292 3300009147 Bacteria 2674
211 Ga0114129_10670679 3300009147 Bacteria 1336
212 Ga0114129_10757899 3300009147 Bacteria 1242
213 Ga0105243_10713516 3300009148 Bacteria 979
214 Ga0105241_10000054 3300009174 Bacteria 93205
215 Ga0105248_10174982 3300009177 Bacteria 2419
216 Ga0105238_10356646 3300009551 Bacteria 1451
217 Ga0105249_10027418 3300009553 Bacteria 5139
218 Ga0157369_10009863 3300013105 Bacteria 10912
219 Ga0157369_10657828 3300013105 Bacteria 1080
220 Ga0157374_10027063 3300013296 Bacteria 5167
221 Ga0157378_10057708 3300013297 Bacteria 3460
222 Ga0157378_10526803 3300013297 Bacteria 1184
223 Ga0157378_10925877 3300013297 Bacteria 903
224 Ga0163162_10331699 3300013306 Bacteria 1654
225 Ga0163162_10334382 3300013306 Bacteria 1647
226 Ga0157372_10002144 3300013307 Bacteria 21446
227 Ga0157375_10073986 3300013308 Bacteria 3427
228 Ga0157375_10267258 3300013308 Bacteria 1872
229 Ga0163163_10248244 3300014325 Bacteria 1830
230 Ga0157380_10077885 3300014326 Bacteria 2703
231 Ga0157380_10121215 3300014326 Bacteria 2215
232 Ga0157377_10036119 3300014745 Bacteria 2716
233 Ga0157379_10529631 3300014968 Bacteria 1094
234 Ga0157376_10027818 3300014969 Bacteria 4487
235 Ga0163161_10328924 3300017792 Bacteria 1210
236 Ga0163161_10368930 3300017792 Bacteria 1145
237 Ga0163161_10566258 3300017792 Bacteria 933
238 Ga0213875_10115168 3300021388 Bacteria 1256
239 Ga0209758_1004299 3300025297 Bacteria 12008
240 Ga0207697_10188593 3300025315 Bacteria 905
241 Ga0207656_10144975 3300025321 Bacteria 1121
242 Ga0207653_10002520 3300025885 Bacteria 5815
243 Ga0207682_10000283 3300025893 Bacteria 23114
244 Ga0207647_10021823 3300025904 Bacteria 4264
245 Ga0207647_10065438 3300025904 Bacteria 2207
246 Ga0207685_10007298 3300025905 Bacteria 3071
247 Ga0207685_10137858 3300025905 Bacteria 1090
248 Ga0207645_10000589 3300025907 Bacteria 30180
249 Ga0207643_10000014 3300025908 Bacteria 128891
250 Ga0207643_10158208 3300025908 Bacteria 1362
251 Ga0207684_10000370 3300025910 Bacteria 60789
252 Ga0207684_10003860 3300025910 Bacteria 14412
253 Ga0207684_10061896 3300025910 Bacteria 3177
254 Ga0207654_10000969 3300025911 Bacteria 15755
255 Ga0207707_10000138 3300025912 Bacteria 74881
256 Ga0207671_10120058 3300025914 Bacteria 2009
257 Ga0207663_10273321 3300025916 Bacteria 1252
258 Ga0207660_10000848 3300025917 Bacteria 20138
259 Ga0207657_10000135 3300025919 Bacteria 75248
260 Ga0207649_10002171 3300025920 Bacteria 11096
261 Ga0207652_10004011 3300025921 Bacteria 12022
262 Ga0207646_10000466 3300025922 Bacteria 54002
263 Ga0207646_10001054 3300025922 Bacteria 35091
264 Ga0207646_10220298 3300025922 Bacteria 1714
265 Ga0207681_10309544 3300025923 Bacteria 1252
266 Ga0207681_10329070 3300025923 Bacteria 1217
267 Ga0207694_10356841 3300025924 Bacteria 1211
268 Ga0207650_10024483 3300025925 Bacteria 4291
269 Ga0207650_10315413 3300025925 Bacteria 1279
270 Ga0207659_10142801 3300025926 Bacteria 1860
271 Ga0207664_10437574 3300025929 Bacteria 1166
272 Ga0207690_10439383 3300025932 Bacteria 1047
273 Ga0207706_10002886 3300025933 Bacteria 16648
274 Ga0207706_10167545 3300025933 Bacteria 1931
275 Ga0207709_10096571 3300025935 Bacteria 1944
276 Ga0207670_10118841 3300025936 Bacteria 1918
277 Ga0207669_10016636 3300025937 Bacteria 3743
278 Ga0207691_10001465 3300025940 Bacteria 23533
279 Ga0207691_10075783 3300025940 Bacteria 3032
280 Ga0207691_10279634 3300025940 Bacteria 1436
281 Ga0207711_10096668 3300025941 Bacteria 2607
282 Ga0207689_10000340 3300025942 Bacteria 43593
283 Ga0207689_10434549 3300025942 Bacteria 1096
284 Ga0207679_10000212 3300025945 Bacteria 46385
285 Ga0207679_10503363 3300025945 Bacteria 1081
286 Ga0207667_10000296 3300025949 Bacteria 68803
287 Ga0207712_10028827 3300025961 Bacteria 3717
288 Ga0207712_10124758 3300025961 Bacteria 1954
289 Ga0207668_10326513 3300025972 Bacteria 1275
290 Ga0207640_10002509 3300025981 Bacteria 9840
291 Ga0207677_10099041 3300026023 Bacteria 2140
292 Ga0207703_10181730 3300026035 Bacteria 1856
293 Ga0207639_10002273 3300026041 Bacteria 12918
294 Ga0207678_10596011 3300026067 Bacteria 969
295 Ga0207708_10024700 3300026075 Bacteria 4545
296 Ga0207708_10128540 3300026075 Bacteria 1979
297 Ga0207708_10203147 3300026075 Bacteria 1581
298 Ga0207702_10001150 3300026078 Bacteria 27070
299 Ga0207648_10001239 3300026089 Bacteria 28649
300 Ga0207648_10006084 3300026089 Bacteria 12033
301 Ga0207648_10491794 3300026089 Bacteria 1122
302 Ga0207648_10756874 3300026089 Bacteria 902
303 Ga0207676_10009662 3300026095 Bacteria 6862
304 Ga0207674_10000684 3300026116 Bacteria 44066
305 Ga0207675_100059411 3300026118 Bacteria 3568
306 Ga0207675_100191946 3300026118 Bacteria 1959
307 Ga0207683_10000814 3300026121 Bacteria 28519
308 Ga0207698_10055963 3300026142 Bacteria 3043
309 Ga0210000_1025743 3300027462 Bacteria 910
310 Ga0209588_1033562 3300027671 Bacteria 1646
311 Ga0209971_1025582 3300027682 Bacteria 1410
312 Ga0209813_10017045 3300027866 Bacteria 1989
313 Ga0209974_10011488 3300027876 Bacteria 2972
314 Ga0207428_10000018 3300027907 Bacteria 293117
315 Ga0207428_10011195 3300027907 Bacteria 7955
316 Ga0207428_10020303 3300027907 Bacteria 5645
317 Ga0207428_10038999 3300027907 Bacteria 3858
318 Ga0207428_10140663 3300027907 Bacteria 1842
319 Ga0207428_10259274 3300027907 Bacteria 1295
320 Ga0268265_10011395 3300028380 Bacteria 6013
321 Ga0268265_10021979 3300028380 Bacteria 4477
322 Ga0268265_10166492 3300028380 Bacteria 1879
323 Ga0268265_10335889 3300028380 Bacteria 1374
324 Ga0268264_10141017 3300028381 Bacteria 2149
325 Ga0268264_10891656 3300028381 Bacteria 892
326 Ga0307513_10299064 3300031456 Bacteria 1377
327 Ga0307408_100485182 3300031548 Bacteria 1079
328 Ga0316575_10000340 3300031665 Bacteria 13144
329 Ga0316579_10018075 3300031691 Bacteria 3099
330 Ga0316578_10001110 3300031728 Bacteria 10505
331 Ga0316578_10168821 3300031728 Bacteria 1319
332 Ga0316578_10226754 3300031728 Bacteria 1123
333 Ga0316577_10004546 3300031733 Bacteria 7177
334 Ga0307409_100105118 3300031995 Bacteria 2353
335 Ga0307416_100252337 3300032002 Bacteria 1718
336 Ga0307411_10117499 3300032005 Bacteria 1917
337 Ga0307411_10333027 3300032005 Bacteria 1231
338 Ga0316583_10000723 3300032133 Bacteria 10248
339 Ga0316583_10103554 3300032133 Bacteria 992
340 Ga0307510_10109953 3300033180 Bacteria 2503
341 Ga0373948_0008895 3300034817 Bacteria 1721
342 Ga0373938_0002014 3300034957 Bacteria 3252
343 Ga0373938_0003166 3300034957 Bacteria 2674
344 Ga0373928_0019044 3300035084 Bacteria 1429
345 Ga0373929_0023688 3300035085 Bacteria 1263
346 Ga0373949_0025231 3300035090 Bacteria 1386
347 Ga0373949_0040393 3300035090 Bacteria 1145
348 Ga0373951_0013217 3300035091 Bacteria 1856
349 Ga0373951_0018746 3300035091 Bacteria 1573
350 Ga0373952_0005416 3300035092 Bacteria 2334
351 Ga0373936_0050690 3300035113 Bacteria 1679
352 Ga0373939_0002841 3300035114 Bacteria 4068
353 Ga0373939_0046869 3300035114 Bacteria 1325
354 Ga0373941_0037201 3300035115 Bacteria 1484
355 Ga0373960_0006510 3300035121 Bacteria 2743
356 Ga0373960_0021332 3300035121 Bacteria 1722
357 Ga0373961_0003687 3300035241 Bacteria 3751
358 Ga0373961_0028216 3300035241 Bacteria 1546
359 Ga0373961_0055624 3300035241 Bacteria 1186
360 Ga0373962_0028998 3300035242 Bacteria 1505
361 Ga0316574_0002112 3300035398 Bacteria 9858
362 Ga0373931_0000715 3300035691 Bacteria 13744
363 Ga0373931_0021680 3300035691 Bacteria 3224
364 Ga0373931_0024944 3300035691 Bacteria 3035
365 Ga0373931_0029381 3300035691 Bacteria 2822
366 Ga0373931_0038501 3300035691 Bacteria 2502
367 Ga0373931_0119013 3300035691 Bacteria 1507
368 Ga0373927_0093270 3300035695 Bacteria 1956
369 Ga0373927_0374602 3300035695 Bacteria 939
370 Ga0373933_0346893 3300035724 Bacteria 964
371 Ga0373947_0125733 3300035725 Bacteria 1632
372 Ga0316582_0001003 3300036647 Bacteria 11769
373 Ga0316582_0018075 3300036647 Bacteria 4095
374 Ga0316582_0034701 3300036647 Bacteria 3109
375 Ga0316582_0285429 3300036647 Bacteria 1133
376 Ga0316582_0338563 3300036647 Bacteria 1035
377 Ga0316584_0000682 3300036712 Bacteria 18695
378 Ga0316584_0258604 3300036712 Unclassified 1270
379 Ga0395900_0227178 3300037418 Bacteria 1879
380 Ga0436364_1277561 3300037853 Bacteria 1628
381 Ga0395901_0056362 3300038443 Bacteria 4088
382 Ga0436365_0276771 3300039437 Bacteria 2476
383 Ga0439441_004461 3300042001 Bacteria 2124
384 Ga0439448_0008866 3300042005 Bacteria 2952
385 Ga0439459_0000674 3300042438 Bacteria 4653
386 Ga0451577_0534599 3300042876 Bacteria 1064
387 Ga0453684_0122234 3300044712 Bacteria 3141
388 Ga0466967_0095490 3300045976 Bacteria 2710
389 Ga0495603_0061040 3300046455 Bacteria 2227
390 Ga0495641_0071953 3300046461 Bacteria 1552
391 Ga0495580_0000551 3300046472 Bacteria 31694
392 Ga0495642_0061229 3300046528 Bacteria 1562
393 Ga0495621_0002773 3300046539 Bacteria 4761
394 Ga0495615_0015912 3300048090 Bacteria 1614
395 Ga0496102_0269586 3300048905 Bacteria 1605
396 Ga0496104_0001978 3300048907 Bacteria 17751
397 Ga0496108_0005996 3300048911 Bacteria 9840
398 Ga0496109_0022511 3300048912 Bacteria 5583
399 Ga0496110_0003146 3300048913 Bacteria 12548
400 Ga0496112_0003807 3300048915 Bacteria 12611
401 Ga0496113_0088678 3300048916 Bacteria 2380
402 Ga0496124_0041274 3300048927 Bacteria 3983
403 Ga0501033_0059149 3300049570 Bacteria 2830
404 Ga0501033_0158614 3300049570 Bacteria 1629
405 Ga0501034_0000032 3300049571 Bacteria 243763
406 Ga0501034_0115555 3300049571 Bacteria 2672
407 Ga0501036_0201364 3300049572 Bacteria 1674
408 Ga0501038_0123911 3300049574 Bacteria 2128
409 Ga0501038_0198885 3300049574 Bacteria 1609
410 Ga0501038_0330710 3300049574 Bacteria 1190
411 Ga0501039_0048590 3300049575 Bacteria 3280
412 Ga0501039_0053436 3300049575 Bacteria 3126
413 Ga0501039_0449281 3300049575 Bacteria 1012
414 Ga0501040_0025557 3300049576 Bacteria 3971
415 Ga0501040_0116902 3300049576 Bacteria 1868
416 Ga0501040_0124174 3300049576 Bacteria 1812
417 Ga0501041_0017366 3300049577 Bacteria 4282
418 Ga0501042_0009868 3300049578 Bacteria 6379
419 Ga0501042_0021895 3300049578 Bacteria 4461
420 Ga0501042_0540238 3300049578 Bacteria 847
421 Ga0501043_0106861 3300049579 Bacteria 2198
422 Ga0501046_0018548 3300049580 Bacteria 5785
423 Ga0501046_0028185 3300049580 Bacteria 4576
424 Ga0501046_0128261 3300049580 Bacteria 1925
425 Ga0501048_0021777 3300049582 Bacteria 4691
426 Ga0501048_0041774 3300049582 Bacteria 3284
427 Ga0501068_0047072 3300049584 Bacteria 2601
428 Ga0501071_0019337 3300049587 Bacteria 4726
429 Ga0501071_0043549 3300049587 Bacteria 3219
430 Ga0501072_0050057 3300049588 Bacteria 3289
431 Ga0501072_0089473 3300049588 Bacteria 2444
432 Ga0501073_0011806 3300049589 Bacteria 6377
433 Ga0501073_0194112 3300049589 Bacteria 1405
434 Ga0501073_0245577 3300049589 Bacteria 1236
435 Ga0501074_0025261 3300049590 Bacteria 4316
436 Ga0501074_0100362 3300049590 Bacteria 2072
437 Ga0501074_0591607 3300049590 Bacteria 785
438 Ga0501075_0077877 3300049591 Bacteria 2509
439 Ga0501075_0252330 3300049591 Bacteria 1345
440 Ga0501075_0458645 3300049591 Bacteria 972
441 Ga0501076_0004037 3300049592 Bacteria 10370
442 Ga0501076_0013676 3300049592 Bacteria 6089
443 Ga0501076_0175236 3300049592 Bacteria 1748
444 Ga0501076_0242058 3300049592 Bacteria 1476
445 Ga0501077_0005626 3300049593 Bacteria 7636
446 Ga0501077_0103353 3300049593 Bacteria 1805
447 Ga0501077_0277074 3300049593 Bacteria 1067
448 Ga0501079_0000054 3300049741 Bacteria 51028
449 Ga0501079_0017702 3300049741 Bacteria 5443
450 Ga0501079_0211725 3300049741 Bacteria 1514
451 Ga0501079_0293203 3300049741 Bacteria 1272
452 Ga0501080_0020145 3300049742 Bacteria 6173
453 Ga0501080_0069343 3300049742 Bacteria 3279
454 Ga0501080_0122681 3300049742 Bacteria 2407
455 Ga0501080_0198793 3300049742 Bacteria 1841
456 Ga0501081_0000414 3300049743 Bacteria 23540
457 Ga0501081_0009693 3300049743 Bacteria 6280
458 Ga0501081_0070792 3300049743 Bacteria 2430
459 Ga0501081_0265833 3300049743 Bacteria 1254
460 Ga0501081_0293517 3300049743 Bacteria 1192
461 Ga0501081_0422070 3300049743 Bacteria 989
462 Ga0501083_0012779 3300049744 Bacteria 5872
463 Ga0501083_0017683 3300049744 Bacteria 4971
464 Ga0501083_0093448 3300049744 Bacteria 1986
465 Ga0501083_0338727 3300049744 Bacteria 978
466 Ga0501035_0135458 3300049822 Bacteria 2145
467 Ga0501044_0134446 3300049823 Bacteria 2465
468 Ga0501045_0006365 3300049824 Bacteria 8171
469 Ga0501045_0018280 3300049824 Bacteria 4985
470 Ga0501045_0056818 3300049824 Bacteria 2863
471 Ga0501045_0088727 3300049824 Bacteria 2284
472 Ga0501045_0115386 3300049824 Bacteria 1992
473 Ga0501045_0424152 3300049824 Bacteria 989
474 nmdc:mga03683_23218_c1 3300050489 Bacteria 2413
475 nmdc:mga03683_68814_c1 3300050489 Bacteria 1509
476 nmdc:mga03n38_3585_c1 3300050490 Bacteria 5013
477 nmdc:mga03n38_3932_c1 3300050490 Bacteria 4844
478 nmdc:mga00v17_125418_c1 3300050491 Bacteria 1638
479 nmdc:mga0yw44_171015_c1 3300050492 Bacteria 1427
480 nmdc:mga0k408_149632_c1 3300050493 Bacteria 1390
481 nmdc:mga06z11_120447_c1 3300050494 Bacteria 1463
482 nmdc:mga06z11_138662_c1 3300050494 Bacteria 1373
483 nmdc:mga06z11_251028_c1 3300050494 Bacteria 1042
484 nmdc:mga06z11_9739_c1 3300050494 Bacteria 4060
485 nmdc:mga04h51_17246_c1 3300050495 Bacteria 2109
486 nmdc:mga05p37_100049_c1 3300050507 Bacteria 3571
487 nmdc:mga05p37_114141_c1 3300050507 Bacteria 3320
488 nmdc:mga05p37_11812_c1 3300050507 Bacteria 10409
489 nmdc:mga05p37_137795_c1 3300050507 Bacteria 2991
490 nmdc:mga05p37_163461_c1 3300050507 Bacteria 2718
491 nmdc:mga05p37_1966_c1 3300050507 Bacteria 23972
492 nmdc:mga05p37_303363_c1 3300050507 Bacteria 1527
493 nmdc:mga05p37_326906_c1 3300050507 Bacteria 1813
494 nmdc:mga05p37_352882_c1 3300050507 Bacteria 1731
495 nmdc:mga05p37_421616_c1 3300050507 Bacteria 1553
496 nmdc:mga05p37_61508_c2 3300050507 Bacteria 2386
497 nmdc:mga05p37_656739_c1 3300050507 Bacteria 1173
498 nmdc:mga05p37_806680_c1 3300050507 Bacteria 1026
499 nmdc:mga05p37_88661_c1 3300050507 Bacteria 3813
500 nmdc:mga09592_173106_c1 3300050508 Bacteria 1867
501 nmdc:mga09592_179797_c1 3300050508 Bacteria 1830
502 nmdc:mga09592_19211_c1 3300050508 Bacteria 5609
503 nmdc:mga09592_30261_c1 3300050508 Bacteria 4505
504 nmdc:mga09592_310121_c1 3300050508 Bacteria 1368
505 nmdc:mga09592_35170_c1 3300050508 Bacteria 4192
506 nmdc:mga09592_40517_c1 3300050508 Bacteria 3913
507 nmdc:mga0qj67_10633_c1 3300050509 Bacteria 6877
508 nmdc:mga0qj67_15838_c1 3300050509 Bacteria 5709
509 nmdc:mga0qj67_169008_c1 3300050509 Bacteria 1775
510 nmdc:mga0qj67_18513_c1 3300050509 Bacteria 5308
511 nmdc:mga0qj67_231844_c1 3300050509 Bacteria 1498
512 nmdc:mga0qj67_8409_c1 3300050509 Bacteria 5017
513 nmdc:mga06r32_126565_c1 3300050510 Bacteria 2524
514 nmdc:mga06r32_204403_c1 3300050510 Bacteria 1963
515 nmdc:mga06r32_30684_c1 3300050510 Bacteria 5045
516 nmdc:mga06r32_339163_c1 3300050510 Bacteria 1488
517 nmdc:mga06r32_43191_c1 3300050510 Bacteria 4289
518 nmdc:mga06r32_468198_c1 3300050510 Bacteria 1239
519 nmdc:mga06r32_4700_c1 3300050510 Bacteria 12268
520 nmdc:mga06r32_669939_c1 3300050510 Bacteria 1005
521 nmdc:mga06r32_69457_c1 3300050510 Bacteria 3405
522 nmdc:mga08y16_108437_c1 3300050511 Bacteria 2891
523 nmdc:mga08y16_1288_c1 3300050511 Bacteria 24890
524 nmdc:mga08y16_180101_c1 3300050511 Bacteria 2194
525 nmdc:mga08y16_288848_c1 3300050511 Bacteria 1691
526 nmdc:mga08y16_47598_c1 3300050511 Bacteria 4489
527 nmdc:mga08y16_52758_c1 3300050511 Bacteria 4254
528 nmdc:mga08y16_60995_c1 3300050511 Bacteria 3938
529 nmdc:mga08y16_67326_c1 3300050511 Bacteria 3736
530 nmdc:mga08y16_92833_c1 3300050511 Bacteria 3145
531 nmdc:mga08y16_949684_c1 3300050511 Bacteria 843
532 nmdc:mga0n895_101096_c1 3300050512 Bacteria 2893
533 nmdc:mga0n895_126738_c1 3300050512 Bacteria 2577
534 nmdc:mga0n895_194609_c1 3300050512 Bacteria 2059
535 nmdc:mga0n895_335125_c1 3300050512 Bacteria 1533
536 nmdc:mga0n895_342_c1 3300050512 Bacteria 31160
537 nmdc:mga0n895_44044_c1 3300050512 Bacteria 4353
538 nmdc:mga0n895_49103_c1 3300050512 Bacteria 4133
539 nmdc:mga0n895_54459_c1 3300050512 Bacteria 3935
540 nmdc:mga0n895_55226_c1 3300050512 Bacteria 3909
541 nmdc:mga0n895_70965_c1 3300050512 Bacteria 3453
542 nmdc:mga0rr50_30940_c1 3300050513 Bacteria 3795
543 nmdc:mga0rr50_428808_c1 3300050513 Bacteria 1119
544 nmdc:mga0rr50_43617_c1 3300050513 Bacteria 3284
545 nmdc:mga0rr50_55521_c1 3300050513 Bacteria 2955
546 nmdc:mga0rr50_72972_c1 3300050513 Bacteria 2623
547 nmdc:mga0rr50_91729_c1 3300050513 Bacteria 2367
548 nmdc:mga0rr50_94246_c1 3300050513 Bacteria 2338
549 nmdc:mga0a205_17404_c1 3300050515 Bacteria 6737
550 nmdc:mga0a205_179285_c1 3300050515 Bacteria 2013
551 nmdc:mga0a205_20074_c1 3300050515 Bacteria 6304
552 nmdc:mga0a205_230181_c1 3300050515 Bacteria 1737
553 nmdc:mga0a205_26848_c1 3300050515 Bacteria 5495
554 nmdc:mga0a205_2698_c1 3300050515 Bacteria 15688
555 nmdc:mga0a205_6409_c1 3300050515 Bacteria 10634
556 nmdc:mga0a205_73074_c1 3300050515 Bacteria 3314
557 nmdc:mga0sz30_31055_c2 3300050516 Bacteria 1874
558 Ga0500593_000705 3300053117 Bacteria 12731
559 Ga0501084_0008128 3300054114 Bacteria 8645
560 Ga0501084_0013346 3300054114 Bacteria 6797
561 Ga0501084_0013968 3300054114 Bacteria 6647
562 Ga0501082_0000389 3300060353 Bacteria 38981
563 Ga0501082_0071101 3300060353 Bacteria 2996
564 Ga0501082_0347363 3300060353 Bacteria 1293
565 Ga0501082_0433705 3300060353 Bacteria 1148
566 Ga0530510_0005974 3300061734 Bacteria 8445
567 Ga0530510_0006084 3300061734 Bacteria 8380
568 Ga0530510_0008649 3300061734 Bacteria 7114
569 Ga0530510_0020070 3300061734 Bacteria 4752
570 Ga0530510_0070625 3300061734 Bacteria 2534
571 Ga0530510_0079281 3300061734 Bacteria 2388
572 Ga0530510_0082443 3300061734 Bacteria 2342
573 Ga0530510_0173557 3300061734 Bacteria 1597
574 Ga0530510_0428149 3300061734 Bacteria 999
575 2837187342 2837183177 Bacteria 4637169
576 Ga0105237_10022169
577 JGI25406J46586_10013794
578 JGI25404J52841_10004098
579 Ga0065715_10127440
580 Ga0070658_10242776
581 Ga0070676_10000399
582 Ga0070670_100035964
583 Ga0070670_100232805
584 Ga0070677_10002155
585 Ga0068869_100029011
586 Ga0068869_100062638
587 Ga0070666_10013757
588 Ga0070680_100001533
589 Ga0070682_100005933
590 Ga0068868_100115665
591 Ga0070660_100000294
592 Ga0070689_100070424
593 Ga0070691_10013765
594 Ga0070661_100043172
595 Ga0070692_10000718
596 Ga0070669_100016006
597 Ga0070669_100120230
598 Ga0070675_100113468
599 Ga0070675_100304721
600 Ga0070671_100020266
601 Ga0070671_100173496
602 Ga0070671_100602485
603 Ga0070674_100007114
604 Ga0070673_100269269
605 Ga0070659_100000151
606 Ga0070659_100477072
607 Ga0070667_100282017
608 Ga0070714_100056546
609 Ga0070711_100241973
610 Ga0070705_100010313
611 Ga0070700_100049794
612 Ga0070700_100095572
613 Ga0070700_100097374
614 Ga0070694_100004310
615 Ga0070694_100016933
616 Ga0070708_100001898
617 Ga0070708_100006096
618 Ga0070708_100076542
619 Ga0070708_100260415
620 Ga0070663_100006298
621 Ga0070663_100006915
622 Ga0070663_100197272
623 Ga0070678_100005703
624 Ga0070678_100913160
625 Ga0070662_100012111
626 Ga0070662_100277347
627 Ga0068867_100005697
628 Ga0068867_100023549
629 Ga0070685_10218428
630 Ga0070685_10485524
631 Ga0070706_100027679
632 Ga0070706_100027858
633 Ga0070706_100033274
634 Ga0070706_100091335
635 Ga0070706_100118229
636 Ga0070707_100009939
637 Ga0070707_100038387
638 Ga0070707_100041607
639 Ga0070707_100064235
640 Ga0070707_100397158
641 Ga0070698_100015254
642 Ga0070698_100035890
643 Ga0070698_100208544
644 Ga0070699_100010525
645 Ga0070699_100019931
646 Ga0070699_100052904
647 Ga0070699_100079156
648 Ga0070699_100091658
649 Ga0070699_100236690
650 Ga0070699_100259817
651 Ga0070699_100425136
652 Ga0070679_100001088
653 Ga0070684_100005850
654 Ga0070697_100015984
655 Ga0070697_100065646
656 Ga0070697_100075728
657 Ga0070697_100127547
658 Ga0070697_100279255
659 Ga0068853_100029933
660 Ga0070672_100189949
661 Ga0070686_100231904
662 Ga0070695_100018028
663 Ga0070696_100001176
664 Ga0070696_100012135
665 Ga0070665_100164664
666 Ga0070704_100000990
667 Ga0070704_100061396
668 Ga0068855_100001154
669 Ga0070664_100007461
670 Ga0068854_100005822
671 Ga0068856_100001162
672 Ga0070702_100059932
673 Ga0068852_100007158
674 Ga0068859_100001630
675 Ga0068864_100377610
676 Ga0068864_100828378
677 Ga0068866_10013453
678 Ga0068861_100010098
679 Ga0068861_100279619
680 Ga0068851_10006644
681 Ga0068870_10000280
682 Ga0068870_10255027
683 Ga0068863_100180732
684 Ga0068858_100062507
685 Ga0068860_100032109
686 Ga0068860_100367717
687 Ga0068860_100389977
688 Ga0068862_100009378
689 Ga0068862_100031797
690 Ga0068862_100332898
691 Ga0081455_10000179
692 Ga0081455_10000429
693 Ga0081455_10000614
694 Ga0081455_10055836
695 Ga0081540_1000417
696 Ga0081540_1000439
697 Ga0081540_1002759
698 Ga0081540_1006694
699 Ga0081540_1049978
700 Ga0081539_10000009
701 Ga0081539_10005848
702 Ga0081539_10047453
703 Ga0070717_10305804
704 Ga0075365_10004171
705 Ga0075365_10009014
706 Ga0075365_10011665
707 Ga0075368_10018094
708 Ga0075363_100025914
709 Ga0075363_100038218
710 Ga0075364_10008508
711 Ga0075364_10300364
712 Ga0070715_10014494
713 Ga0070715_10175272
714 Ga0075362_10025087
715 Ga0075362_10033558
716 Ga0075367_10002008
717 Ga0075367_10010976
718 Ga0075367_10080226
719 Ga0075369_10119150
720 Ga0075366_10149490
721 Ga0097621_100451799
722 Ga0075370_10179351
723 Ga0068871_100768796
724 Ga0075428_100000617
725 Ga0075428_100011753
726 Ga0075428_100030609
727 Ga0075428_100079237
728 Ga0075428_100112882
729 Ga0075428_100178276
730 Ga0075428_100297808
731 Ga0075430_100016657
732 Ga0075430_100017473
733 Ga0075430_100025913
734 Ga0075431_100000629
735 Ga0075431_100006204
736 Ga0075431_100006578
737 Ga0075431_100009272
738 Ga0075431_100034402
739 Ga0075431_100053338
740 Ga0075431_100083658
741 Ga0075431_100142250
742 Ga0075431_100429322
743 Ga0075433_10001366
744 Ga0075433_10001697
745 Ga0075433_10003287
746 Ga0075433_10292331
747 Ga0075433_10297795
748 Ga0075434_100006800
749 Ga0075434_100053333
750 Ga0075434_100180854
751 Ga0075434_100305462
752 Ga0075429_100010885
753 Ga0075429_100020932
754 Ga0075429_100032661
755 Ga0075429_100043151
756 Ga0075429_100050412
757 Ga0075429_100054029
758 Ga0075436_100000722
759 Ga0075436_100042958
760 Ga0097620_100001630
761 Ga0075435_100009154
762 Ga0075435_100009192
763 Ga0075435_100033010
764 Ga0075435_100060207
765 Ga0075435_100114946
766 Ga0075435_100134532
767 Ga0075435_100195772
768 Ga0099794_10006294
769 Ga0099794_10007647
770 Ga0099794_10190126
771 Ga0111539_10015983
772 Ga0111539_10016701
773 Ga0111539_10056697
774 Ga0111539_10061341
775 Ga0111539_10086480
776 Ga0111539_10113159
777 Ga0111539_10632023
778 Ga0111539_10778115
779 Ga0111539_11216898
780 Ga0114129_10010340
781 Ga0114129_10024814
782 Ga0114129_10028563
783 Ga0114129_10078683
784 Ga0114129_10117692
785 Ga0114129_10204292
786 Ga0114129_10670679
787 Ga0114129_10757899
788 Ga0105243_10713516
789 Ga0105241_10000054
790 Ga0105248_10174982
791 Ga0105238_10356646
792 Ga0105249_10027418
793 Ga0157369_10009863
794 Ga0157369_10657828
795 Ga0157374_10027063
796 Ga0157378_10057708
797 Ga0157378_10526803
798 Ga0157378_10925877
799 Ga0163162_10331699
800 Ga0163162_10334382
801 Ga0157372_10002144
802 Ga0157375_10073986
803 Ga0157375_10267258
804 Ga0163163_10248244
805 Ga0157380_10077885
806 Ga0157380_10121215
807 Ga0157377_10036119
808 Ga0157379_10529631
809 Ga0157376_10027818
810 Ga0163161_10328924
811 Ga0163161_10368930
812 Ga0163161_10566258
813 Ga0213875_10115168
814 Ga0209758_1004299
815 Ga0207697_10188593
816 Ga0207656_10144975
817 Ga0207653_10002520
818 Ga0207682_10000283
819 Ga0207647_10021823
820 Ga0207647_10065438
821 Ga0207685_10007298
822 Ga0207685_10137858
823 Ga0207645_10000589
824 Ga0207643_10000014
825 Ga0207643_10158208
826 Ga0207684_10000370
827 Ga0207684_10003860
828 Ga0207684_10061896
829 Ga0207654_10000969
830 Ga0207707_10000138
831 Ga0207671_10120058
832 Ga0207663_10273321
833 Ga0207660_10000848
834 Ga0207657_10000135
835 Ga0207649_10002171
836 Ga0207652_10004011
837 Ga0207646_10000466
838 Ga0207646_10001054
839 Ga0207646_10220298
840 Ga0207681_10309544
841 Ga0207681_10329070
842 Ga0207694_10356841
843 Ga0207650_10024483
844 Ga0207650_10315413
845 Ga0207659_10142801
846 Ga0207664_10437574
847 Ga0207690_10439383
848 Ga0207706_10002886
849 Ga0207706_10167545
850 Ga0207709_10096571
851 Ga0207670_10118841
852 Ga0207669_10016636
853 Ga0207691_10001465
854 Ga0207691_10075783
855 Ga0207691_10279634
856 Ga0207711_10096668
857 Ga0207689_10000340
858 Ga0207689_10434549
859 Ga0207679_10000212
860 Ga0207679_10503363
861 Ga0207667_10000296
862 Ga0207712_10028827
863 Ga0207712_10124758
864 Ga0207668_10326513
865 Ga0207640_10002509
866 Ga0207677_10099041
867 Ga0207703_10181730
868 Ga0207639_10002273
869 Ga0207678_10596011
870 Ga0207708_10024700
871 Ga0207708_10128540
872 Ga0207708_10203147
873 Ga0207702_10001150
874 Ga0207648_10001239
875 Ga0207648_10006084
876 Ga0207648_10491794
877 Ga0207648_10756874
878 Ga0207676_10009662
879 Ga0207674_10000684
880 Ga0207675_100059411
881 Ga0207675_100191946
882 Ga0207683_10000814
883 Ga0207698_10055963
884 Ga0210000_1025743
885 Ga0209588_1033562
886 Ga0209971_1025582
887 Ga0209813_10017045
888 Ga0209974_10011488
889 Ga0207428_10000018
890 Ga0207428_10011195
891 Ga0207428_10020303
892 Ga0207428_10038999
893 Ga0207428_10140663
894 Ga0207428_10259274
895 Ga0268265_10011395
896 Ga0268265_10021979
897 Ga0268265_10166492
898 Ga0268265_10335889
899 Ga0268264_10141017
900 Ga0268264_10891656
901 Ga0307513_10299064
902 Ga0307408_100485182
903 Ga0316575_10000340
904 Ga0316579_10018075
905 Ga0316578_10001110
906 Ga0316578_10168821
907 Ga0316578_10226754
908 Ga0316577_10004546
909 Ga0307409_100105118
910 Ga0307416_100252337
911 Ga0307411_10117499
912 Ga0307411_10333027
913 Ga0316583_10000723
914 Ga0316583_10103554
915 Ga0307510_10109953
916 Ga0373948_0008895
917 Ga0373938_0002014
918 Ga0373938_0003166
919 Ga0373928_0019044
920 Ga0373929_0023688
921 Ga0373949_0025231
922 Ga0373949_0040393
923 Ga0373951_0013217
924 Ga0373951_0018746
925 Ga0373952_0005416
926 Ga0373936_0050690
927 Ga0373939_0002841
928 Ga0373939_0046869
929 Ga0373941_0037201
930 Ga0373960_0006510
931 Ga0373960_0021332
932 Ga0373961_0003687
933 Ga0373961_0028216
934 Ga0373961_0055624
935 Ga0373962_0028998
936 Ga0316574_0002112
937 Ga0373931_0000715
938 Ga0373931_0021680
939 Ga0373931_0024944
940 Ga0373931_0029381
941 Ga0373931_0038501
942 Ga0373931_0119013
943 Ga0373927_0093270
944 Ga0373927_0374602
945 Ga0373933_0346893
946 Ga0373947_0125733
947 Ga0316582_0001003
948 Ga0316582_0018075
949 Ga0316582_0034701
950 Ga0316582_0285429
951 Ga0316582_0338563
952 Ga0316584_0000682
953 Ga0316584_0258604
954 Ga0395900_0227178
955 Ga0436364_1277561
956 Ga0395901_0056362
957 Ga0436365_0276771
958 Ga0439441_004461
959 Ga0439448_0008866
960 Ga0439459_0000674
961 Ga0451577_0534599
962 Ga0453684_0122234
963 Ga0466967_0095490
964 Ga0495603_0061040
965 Ga0495641_0071953
966 Ga0495580_0000551
967 Ga0495642_0061229
968 Ga0495621_0002773
969 Ga0495615_0015912
970 Ga0496102_0269586
971 Ga0496104_0001978
972 Ga0496108_0005996
973 Ga0496109_0022511
974 Ga0496110_0003146
975 Ga0496112_0003807
976 Ga0496113_0088678
977 Ga0496124_0041274
978 Ga0501033_0059149
979 Ga0501033_0158614
980 Ga0501034_0000032
981 Ga0501034_0115555
982 Ga0501036_0201364
983 Ga0501038_0123911
984 Ga0501038_0198885
985 Ga0501038_0330710
986 Ga0501039_0048590
987 Ga0501039_0053436
988 Ga0501039_0449281
989 Ga0501040_0025557
990 Ga0501040_0116902
991 Ga0501040_0124174
992 Ga0501041_0017366
993 Ga0501042_0009868
994 Ga0501042_0021895
995 Ga0501042_0540238
996 Ga0501043_0106861
997 Ga0501046_0018548
998 Ga0501046_0028185
999 Ga0501046_0128261
1000 Ga0501048_0021777
1001 Ga0501048_0041774
1002 Ga0501068_0047072
1003 Ga0501071_0019337
1004 Ga0501071_0043549
1005 Ga0501072_0050057
1006 Ga0501072_0089473
1007 Ga0501073_0011806
1008 Ga0501073_0194112
1009 Ga0501073_0245577
1010 Ga0501074_0025261
1011 Ga0501074_0100362
1012 Ga0501074_0591607
1013 Ga0501075_0077877
1014 Ga0501075_0252330
1015 Ga0501075_0458645
1016 Ga0501076_0004037
1017 Ga0501076_0013676
1018 Ga0501076_0175236
1019 Ga0501076_0242058
1020 Ga0501077_0005626
1021 Ga0501077_0103353
1022 Ga0501077_0277074
1023 Ga0501079_0000054
1024 Ga0501079_0017702
1025 Ga0501079_0211725
1026 Ga0501079_0293203
1027 Ga0501080_0020145
1028 Ga0501080_0069343
1029 Ga0501080_0122681
1030 Ga0501080_0198793
1031 Ga0501081_0000414
1032 Ga0501081_0009693
1033 Ga0501081_0070792
1034 Ga0501081_0265833
1035 Ga0501081_0293517
1036 Ga0501081_0422070
1037 Ga0501083_0012779
1038 Ga0501083_0017683
1039 Ga0501083_0093448
1040 Ga0501083_0338727
1041 Ga0501035_0135458
1042 Ga0501044_0134446
1043 Ga0501045_0006365
1044 Ga0501045_0018280
1045 Ga0501045_0056818
1046 Ga0501045_0088727
1047 Ga0501045_0115386
1048 Ga0501045_0424152
1049 nmdc:mga03683_23218_c1
1050 nmdc:mga03683_68814_c1
1051 nmdc:mga03n38_3585_c1
1052 nmdc:mga03n38_3932_c1
1053 nmdc:mga00v17_125418_c1
1054 nmdc:mga0yw44_171015_c1
1055 nmdc:mga0k408_149632_c1
1056 nmdc:mga06z11_120447_c1
1057 nmdc:mga06z11_138662_c1
1058 nmdc:mga06z11_251028_c1
1059 nmdc:mga06z11_9739_c1
1060 nmdc:mga04h51_17246_c1
1061 nmdc:mga05p37_100049_c1
1062 nmdc:mga05p37_114141_c1
1063 nmdc:mga05p37_11812_c1
1064 nmdc:mga05p37_137795_c1
1065 nmdc:mga05p37_163461_c1
1066 nmdc:mga05p37_1966_c1
1067 nmdc:mga05p37_303363_c1
1068 nmdc:mga05p37_326906_c1
1069 nmdc:mga05p37_352882_c1
1070 nmdc:mga05p37_421616_c1
1071 nmdc:mga05p37_61508_c2
1072 nmdc:mga05p37_656739_c1
1073 nmdc:mga05p37_806680_c1
1074 nmdc:mga05p37_88661_c1
1075 nmdc:mga09592_173106_c1
1076 nmdc:mga09592_179797_c1
1077 nmdc:mga09592_19211_c1
1078 nmdc:mga09592_30261_c1
1079 nmdc:mga09592_310121_c1
1080 nmdc:mga09592_35170_c1
1081 nmdc:mga09592_40517_c1
1082 nmdc:mga0qj67_10633_c1
1083 nmdc:mga0qj67_15838_c1
1084 nmdc:mga0qj67_169008_c1
1085 nmdc:mga0qj67_18513_c1
1086 nmdc:mga0qj67_231844_c1
1087 nmdc:mga0qj67_8409_c1
1088 nmdc:mga06r32_126565_c1
1089 nmdc:mga06r32_204403_c1
1090 nmdc:mga06r32_30684_c1
1091 nmdc:mga06r32_339163_c1
1092 nmdc:mga06r32_43191_c1
1093 nmdc:mga06r32_468198_c1
1094 nmdc:mga06r32_4700_c1
1095 nmdc:mga06r32_669939_c1
1096 nmdc:mga06r32_69457_c1
1097 nmdc:mga08y16_108437_c1
1098 nmdc:mga08y16_1288_c1
1099 nmdc:mga08y16_180101_c1
1100 nmdc:mga08y16_288848_c1
1101 nmdc:mga08y16_47598_c1
1102 nmdc:mga08y16_52758_c1
1103 nmdc:mga08y16_60995_c1
1104 nmdc:mga08y16_67326_c1
1105 nmdc:mga08y16_92833_c1
1106 nmdc:mga08y16_949684_c1
1107 nmdc:mga0n895_101096_c1
1108 nmdc:mga0n895_126738_c1
1109 nmdc:mga0n895_194609_c1
1110 nmdc:mga0n895_335125_c1
1111 nmdc:mga0n895_342_c1
1112 nmdc:mga0n895_44044_c1
1113 nmdc:mga0n895_49103_c1
1114 nmdc:mga0n895_54459_c1
1115 nmdc:mga0n895_55226_c1
1116 nmdc:mga0n895_70965_c1
1117 nmdc:mga0rr50_30940_c1
1118 nmdc:mga0rr50_428808_c1
1119 nmdc:mga0rr50_43617_c1
1120 nmdc:mga0rr50_55521_c1
1121 nmdc:mga0rr50_72972_c1
1122 nmdc:mga0rr50_91729_c1
1123 nmdc:mga0rr50_94246_c1
1124 nmdc:mga0a205_17404_c1
1125 nmdc:mga0a205_179285_c1
1126 nmdc:mga0a205_20074_c1
1127 nmdc:mga0a205_230181_c1
1128 nmdc:mga0a205_26848_c1
1129 nmdc:mga0a205_2698_c1
1130 nmdc:mga0a205_6409_c1
1131 nmdc:mga0a205_73074_c1
1132 nmdc:mga0sz30_31055_c2
1133 Ga0500593_000705
1134 Ga0501084_0008128
1135 Ga0501084_0013346
1136 Ga0501084_0013968
1137 Ga0501082_0000389
1138 Ga0501082_0071101
1139 Ga0501082_0347363
1140 Ga0501082_0433705
1141 Ga0530510_0005974
1142 Ga0530510_0006084
1143 Ga0530510_0008649
1144 Ga0530510_0020070
1145 Ga0530510_0070625
1146 Ga0530510_0079281
1147 Ga0530510_0082443
1148 Ga0530510_0173557
1149 Ga0530510_0428149
1150 2837187342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

205

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9367 1 241
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9329 1 241
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9281 8 237
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9211 7 227
5x41-assembly1.cif.gz_A 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9142 6 232
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9755 3 240 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9715 3 240 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9663 7 239 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9542 7 239 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.928 3 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9818 7 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A417Z7G5-F1-model_v4 ABC transporter ATP-binding protein 0.9804 6 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1Q7D5U6-F1-model_v4 ABC transporter ATP-binding protein 0.98 6 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-H5XUG3-F1-model_v4 ABC-type branched-chain amino acid transport system, ATPase component 0.9786 7 239 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9776 7 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map