F465500
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 576 | 297 | 552 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10000692|Ga0105247_1000069214 |
| Length | 298 |
| Sequence | MKRLAWQMAQRVGRTQPRCWLAAGFGRKAGRVTMLAAIALSALAMTLIVGVRYLLASGGFAWATRLRHPGLYASLAGQIRREIGWSLASAAIYGVPAGIVAWGWQNRGWTSIYSDVADYPLWWLPLSVLVCLFLHDTWFYWTHRWMHRPAPFRLAHAVHHASRPPTAWAAMSFHPIEALTGAVVIPALVFVVPIHVGALALVLTIMTIMGVTNHMGWEMFPQAIVRGALGRWLITASHHQRHHEQYRCNYGLYFRFWDRVCETDRGLGSFDPSGGDRPIGAGNARAGGAAGRGADRVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 6 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 7 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 8 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 9 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 10 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 11 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 12 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 13 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 14 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 15 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 16 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 17 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 18 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 19 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 20 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 21 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 22 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 23 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 24 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 25 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 193 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 244 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 245 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 246 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 247 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 248 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 249 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 279 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 284 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 286 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 290 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 291 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 294 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 296 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 297 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.83 |
| Metatranscriptomes | 0 |
| Isolates | 4.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 19.27 |
| Nodule | 0.52 |
| Rhizoplane | 3.65 |
| Rhizosphere | 66.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2722016 | 2162886007 | Bacteria | 2634 |
| 2 | SwRhRL2b_contig_335976 | 2162886007 | Bacteria | 7116 |
| 3 | JGI24741J21665_1000134 | 3300001915 | Bacteria | 20329 |
| 4 | JGI24740J21852_10008715 | 3300001979 | Bacteria | 4026 |
| 5 | JGI24740J21852_10075336 | 3300001979 | Bacteria | 894 |
| 6 | JGI24739J22299_10074127 | 3300001989 | Bacteria | 1055 |
| 7 | JGI24737J22298_10003189 | 3300001990 | Bacteria | 5817 |
| 8 | JGI24735J21928_10020502 | 3300002067 | Bacteria | 2024 |
| 9 | JGI24738J21930_10002317 | 3300002075 | Bacteria | 5026 |
| 10 | JGI24738J21930_10002792 | 3300002075 | Bacteria | 4485 |
| 11 | JGI24738J21930_10041385 | 3300002075 | Bacteria | 936 |
| 12 | JGI25150J39212_1000368 | 3300002774 | Bacteria | 21777 |
| 13 | JGI25153J46596_10000125 | 3300003215 | Bacteria | 86065 |
| 14 | JGI25153J46596_10000417 | 3300003215 | Bacteria | 27933 |
| 15 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 16 | Ga0055526_1003012 | 3300003771 | Bacteria | 10997 |
| 17 | Ga0055537_1006643 | 3300003773 | Bacteria | 2901 |
| 18 | Ga0055536_1003782 | 3300003781 | Bacteria | 7987 |
| 19 | Ga0055536_1003805 | 3300003781 | Bacteria | 7956 |
| 20 | Ga0055536_1012473 | 3300003781 | Bacteria | 3151 |
| 21 | Ga0055530_10000116 | 3300003791 | Bacteria | 69428 |
| 22 | Ga0055530_10014456 | 3300003791 | Bacteria | 2627 |
| 23 | Ga0055540_1000868 | 3300003792 | Bacteria | 20036 |
| 24 | Ga0055531_10002417 | 3300003794 | Bacteria | 12515 |
| 25 | Ga0055531_10004300 | 3300003794 | Bacteria | 8731 |
| 26 | Ga0055543_1021546 | 3300004625 | Bacteria | 1175 |
| 27 | Ga0065165_1001363 | 3300005262 | Bacteria | 26928 |
| 28 | Ga0065704_10009557 | 3300005289 | Bacteria | 3440 |
| 29 | Ga0065704_10110538 | 3300005289 | Bacteria | 1978 |
| 30 | Ga0065704_10356200 | 3300005289 | Bacteria | 803 |
| 31 | Ga0065707_10082568 | 3300005295 | Bacteria | 13691 |
| 32 | Ga0065707_10152119 | 3300005295 | Bacteria | 1647 |
| 33 | Ga0070670_100001449 | 3300005331 | Bacteria | 19056 |
| 34 | Ga0070666_10000171 | 3300005335 | Bacteria | 44565 |
| 35 | Ga0070666_10041861 | 3300005335 | Bacteria | 3062 |
| 36 | Ga0070660_100019269 | 3300005339 | Bacteria | 4996 |
| 37 | Ga0070660_100168337 | 3300005339 | Bacteria | 1769 |
| 38 | Ga0070661_100007098 | 3300005344 | Bacteria | 7726 |
| 39 | Ga0070661_100045987 | 3300005344 | Bacteria | 3192 |
| 40 | Ga0070661_100059975 | 3300005344 | Bacteria | 2791 |
| 41 | Ga0070668_100009037 | 3300005347 | Bacteria | 7401 |
| 42 | Ga0070668_100122054 | 3300005347 | Bacteria | 2084 |
| 43 | Ga0070668_100219876 | 3300005347 | Bacteria | 1566 |
| 44 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 45 | Ga0070669_100000074 | 3300005353 | Bacteria | 99054 |
| 46 | Ga0070669_100098547 | 3300005353 | Bacteria | 2202 |
| 47 | Ga0070671_100000007 | 3300005355 | Bacteria | 250397 |
| 48 | Ga0070671_100000375 | 3300005355 | Bacteria | 30813 |
| 49 | Ga0070671_100109302 | 3300005355 | Bacteria | 2322 |
| 50 | Ga0070671_100229882 | 3300005355 | Bacteria | 1574 |
| 51 | Ga0070671_100651257 | 3300005355 | Bacteria | 912 |
| 52 | Ga0070674_100019515 | 3300005356 | Bacteria | 4307 |
| 53 | Ga0070674_100036673 | 3300005356 | Bacteria | 3293 |
| 54 | Ga0070659_100069566 | 3300005366 | Bacteria | 2794 |
| 55 | Ga0070667_100001796 | 3300005367 | Bacteria | 19107 |
| 56 | Ga0070667_100001949 | 3300005367 | Bacteria | 18314 |
| 57 | Ga0070667_100005338 | 3300005367 | Bacteria | 10733 |
| 58 | Ga0070705_100014227 | 3300005440 | Bacteria | 4089 |
| 59 | Ga0070663_100009092 | 3300005455 | Bacteria | 6139 |
| 60 | Ga0070663_100035804 | 3300005455 | Bacteria | 3446 |
| 61 | Ga0070663_100213728 | 3300005455 | Bacteria | 1511 |
| 62 | Ga0070678_100001925 | 3300005456 | Bacteria | 11196 |
| 63 | Ga0070662_100023558 | 3300005457 | Bacteria | 4230 |
| 64 | Ga0070662_100114749 | 3300005457 | Bacteria | 2057 |
| 65 | Ga0068853_100064987 | 3300005539 | Bacteria | 3165 |
| 66 | Ga0070672_100107543 | 3300005543 | Bacteria | 2270 |
| 67 | Ga0070665_100000043 | 3300005548 | Bacteria | 279774 |
| 68 | Ga0070665_100001089 | 3300005548 | Bacteria | 33704 |
| 69 | Ga0070665_100051178 | 3300005548 | Bacteria | 4143 |
| 70 | Ga0070665_100359317 | 3300005548 | Bacteria | 1462 |
| 71 | Ga0068855_100032329 | 3300005563 | Bacteria | 6248 |
| 72 | Ga0070664_100089279 | 3300005564 | Bacteria | 2666 |
| 73 | Ga0068857_100017504 | 3300005577 | Bacteria | 6281 |
| 74 | Ga0068857_100163514 | 3300005577 | Bacteria | 2020 |
| 75 | Ga0068857_100252983 | 3300005577 | Bacteria | 1615 |
| 76 | Ga0068857_100423782 | 3300005577 | Bacteria | 1241 |
| 77 | Ga0068857_100454190 | 3300005577 | Bacteria | 1198 |
| 78 | Ga0068854_100014593 | 3300005578 | Bacteria | 5183 |
| 79 | Ga0068854_100033417 | 3300005578 | Bacteria | 3586 |
| 80 | Ga0068854_100056864 | 3300005578 | Bacteria | 2820 |
| 81 | Ga0068854_100143836 | 3300005578 | Bacteria | 1833 |
| 82 | Ga0068854_100218245 | 3300005578 | Bacteria | 1507 |
| 83 | Ga0068854_100230896 | 3300005578 | Bacteria | 1468 |
| 84 | Ga0068854_100467580 | 3300005578 | Bacteria | 1056 |
| 85 | Ga0068856_100072957 | 3300005614 | Bacteria | 3398 |
| 86 | Ga0068852_100002899 | 3300005616 | Bacteria | 11907 |
| 87 | Ga0068852_100016319 | 3300005616 | Bacteria | 5787 |
| 88 | Ga0068859_100004071 | 3300005617 | Bacteria | 14916 |
| 89 | Ga0068859_100050596 | 3300005617 | Bacteria | 4174 |
| 90 | Ga0068864_100000332 | 3300005618 | Bacteria | 41671 |
| 91 | Ga0068861_100002527 | 3300005719 | Bacteria | 11948 |
| 92 | Ga0068861_100279042 | 3300005719 | Bacteria | 1438 |
| 93 | Ga0068851_10024998 | 3300005834 | Bacteria | 2927 |
| 94 | Ga0068851_10082183 | 3300005834 | Bacteria | 1684 |
| 95 | Ga0068851_10090246 | 3300005834 | Bacteria | 1612 |
| 96 | Ga0068851_10128028 | 3300005834 | Bacteria | 1370 |
| 97 | Ga0068863_100000456 | 3300005841 | Bacteria | 41671 |
| 98 | Ga0068863_100000576 | 3300005841 | Bacteria | 37385 |
| 99 | Ga0068863_100016644 | 3300005841 | Bacteria | 7055 |
| 100 | Ga0068863_100021575 | 3300005841 | Bacteria | 6143 |
| 101 | Ga0068858_100001300 | 3300005842 | Bacteria | 25802 |
| 102 | Ga0068860_100000812 | 3300005843 | Bacteria | 34919 |
| 103 | Ga0068860_100002492 | 3300005843 | Bacteria | 19316 |
| 104 | Ga0068860_100006579 | 3300005843 | Bacteria | 11669 |
| 105 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 106 | Ga0068862_100000468 | 3300005844 | Bacteria | 43578 |
| 107 | Ga0068862_100000506 | 3300005844 | Bacteria | 41538 |
| 108 | Ga0068862_100040562 | 3300005844 | Bacteria | 3957 |
| 109 | Ga0081455_10000212 | 3300005937 | Bacteria | 74448 |
| 110 | Ga0075365_10026950 | 3300006038 | Bacteria | 3652 |
| 111 | Ga0075363_100005299 | 3300006048 | Bacteria | 5724 |
| 112 | Ga0075364_10023905 | 3300006051 | Bacteria | 3873 |
| 113 | Ga0075362_10002346 | 3300006177 | Bacteria | 6334 |
| 114 | Ga0075367_10119336 | 3300006178 | Bacteria | 1624 |
| 115 | Ga0075369_10002985 | 3300006186 | Bacteria | 6115 |
| 116 | Ga0075366_10063719 | 3300006195 | Bacteria | 2191 |
| 117 | Ga0075370_10026188 | 3300006353 | Bacteria | 3230 |
| 118 | Ga0075370_10166011 | 3300006353 | Bacteria | 1297 |
| 119 | Ga0075370_10243458 | 3300006353 | Bacteria | 1065 |
| 120 | Ga0068871_100041930 | 3300006358 | Bacteria | 3672 |
| 121 | Ga0068865_100109827 | 3300006881 | Bacteria | 2033 |
| 122 | Ga0097620_100001427 | 3300006931 | Bacteria | 24232 |
| 123 | Ga0097620_100004071 | 3300006931 | Bacteria | 14916 |
| 124 | Ga0097620_100050597 | 3300006931 | Bacteria | 4174 |
| 125 | Ga0079104_1019271 | 3300006946 | Bacteria | 1911 |
| 126 | Ga0079104_1019976 | 3300006946 | Bacteria | 1857 |
| 127 | Ga0105251_10001184 | 3300009011 | Bacteria | 22581 |
| 128 | Ga0105250_10039071 | 3300009092 | Bacteria | 1903 |
| 129 | Ga0105240_10030797 | 3300009093 | Bacteria | 6970 |
| 130 | Ga0105240_10504950 | 3300009093 | Bacteria | 1344 |
| 131 | Ga0105240_10694735 | 3300009093 | Bacteria | 1111 |
| 132 | Ga0111539_10305752 | 3300009094 | Bacteria | 1850 |
| 133 | Ga0105247_10000692 | 3300009101 | Bacteria | 26532 |
| 134 | Ga0105247_10010362 | 3300009101 | Bacteria | 5637 |
| 135 | Ga0105247_10078338 | 3300009101 | Bacteria | 2079 |
| 136 | Ga0105243_10001659 | 3300009148 | Bacteria | 19274 |
| 137 | Ga0105241_10008499 | 3300009174 | Bacteria | 7549 |
| 138 | Ga0105241_10026280 | 3300009174 | Bacteria | 4330 |
| 139 | Ga0105241_10135279 | 3300009174 | Bacteria | 2000 |
| 140 | Ga0105242_10110929 | 3300009176 | Bacteria | 2338 |
| 141 | Ga0105248_10000029 | 3300009177 | Bacteria | 223366 |
| 142 | Ga0105248_10001383 | 3300009177 | Bacteria | 27020 |
| 143 | Ga0105248_10008190 | 3300009177 | Bacteria | 11482 |
| 144 | Ga0105248_10038528 | 3300009177 | Bacteria | 5350 |
| 145 | Ga0105248_10045094 | 3300009177 | Bacteria | 4944 |
| 146 | Ga0105248_10076006 | 3300009177 | Bacteria | 3775 |
| 147 | Ga0105237_10006917 | 3300009545 | Bacteria | 12510 |
| 148 | Ga0105237_10025829 | 3300009545 | Bacteria | 6005 |
| 149 | Ga0105237_10405037 | 3300009545 | Bacteria | 1369 |
| 150 | Ga0105238_10092201 | 3300009551 | Bacteria | 3017 |
| 151 | Ga0105238_10118462 | 3300009551 | Bacteria | 2628 |
| 152 | Ga0105238_10253956 | 3300009551 | Bacteria | 1737 |
| 153 | Ga0105238_10938384 | 3300009551 | Bacteria | 885 |
| 154 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 155 | Ga0105249_10000928 | 3300009553 | Bacteria | 25902 |
| 156 | Ga0105249_10020736 | 3300009553 | Bacteria | 5877 |
| 157 | Ga0105148_100181 | 3300009978 | Bacteria | 9284 |
| 158 | Ga0105239_10000271 | 3300010375 | Bacteria | 76812 |
| 159 | Ga0105239_10139232 | 3300010375 | Bacteria | 2703 |
| 160 | Ga0105239_10372014 | 3300010375 | Bacteria | 1615 |
| 161 | Ga0157373_10028324 | 3300013100 | Bacteria | 4041 |
| 162 | Ga0157373_10051049 | 3300013100 | Bacteria | 2945 |
| 163 | Ga0157373_10079994 | 3300013100 | Bacteria | 2305 |
| 164 | Ga0157371_10001885 | 3300013102 | Bacteria | 20989 |
| 165 | Ga0157371_10015686 | 3300013102 | Bacteria | 5673 |
| 166 | Ga0157370_10029953 | 3300013104 | Bacteria | 5334 |
| 167 | Ga0157370_10094115 | 3300013104 | Bacteria | 2812 |
| 168 | Ga0157369_10115718 | 3300013105 | Bacteria | 2848 |
| 169 | Ga0157369_10179796 | 3300013105 | Bacteria | 2226 |
| 170 | Ga0157369_10465719 | 3300013105 | Bacteria | 1308 |
| 171 | Ga0157378_10729746 | 3300013297 | Bacteria | 1012 |
| 172 | Ga0163162_10002088 | 3300013306 | Bacteria | 18765 |
| 173 | Ga0163162_10051898 | 3300013306 | Bacteria | 4116 |
| 174 | Ga0163162_10121046 | 3300013306 | Bacteria | 2722 |
| 175 | Ga0163162_10364702 | 3300013306 | Bacteria | 1577 |
| 176 | Ga0157380_10000945 | 3300014326 | Bacteria | 18395 |
| 177 | Ga0157380_10142985 | 3300014326 | Bacteria | 2058 |
| 178 | Ga0157379_10014026 | 3300014968 | Bacteria | 7022 |
| 179 | Ga0213875_10000275 | 3300021388 | Bacteria | 50853 |
| 180 | Ga0207425_1000461 | 3300025245 | Bacteria | 26109 |
| 181 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 182 | Ga0209129_1000327 | 3300025258 | Bacteria | 41506 |
| 183 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 184 | Ga0209565_1011046 | 3300025263 | Bacteria | 2215 |
| 185 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 186 | Ga0207673_1005823 | 3300025290 | Bacteria | 1513 |
| 187 | Ga0209675_1000697 | 3300025291 | Bacteria | 23309 |
| 188 | Ga0209676_1000273 | 3300025292 | Bacteria | 107724 |
| 189 | Ga0209676_1000402 | 3300025292 | Bacteria | 78796 |
| 190 | Ga0209676_1001476 | 3300025292 | Bacteria | 21761 |
| 191 | Ga0209676_1008829 | 3300025292 | Bacteria | 4434 |
| 192 | Ga0209676_1025202 | 3300025292 | Bacteria | 1912 |
| 193 | Ga0209676_1027946 | 3300025292 | Bacteria | 1766 |
| 194 | Ga0209025_1001791 | 3300025294 | Bacteria | 25501 |
| 195 | Ga0209025_1009722 | 3300025294 | Bacteria | 6647 |
| 196 | Ga0209025_1025385 | 3300025294 | Bacteria | 3018 |
| 197 | Ga0209564_1000783 | 3300025295 | Bacteria | 44071 |
| 198 | Ga0209564_1011259 | 3300025295 | Bacteria | 4025 |
| 199 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 200 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 201 | Ga0209758_1024549 | 3300025297 | Bacteria | 2683 |
| 202 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 203 | Ga0209050_1000218 | 3300025298 | Bacteria | 128776 |
| 204 | Ga0209050_1004400 | 3300025298 | Bacteria | 9547 |
| 205 | Ga0209050_1016532 | 3300025298 | Bacteria | 3011 |
| 206 | Ga0209051_1000297 | 3300025303 | Bacteria | 79062 |
| 207 | Ga0209257_1000248 | 3300025304 | Bacteria | 125170 |
| 208 | Ga0209257_1000435 | 3300025304 | Bacteria | 80311 |
| 209 | Ga0209257_1001829 | 3300025304 | Bacteria | 23270 |
| 210 | Ga0209257_1001894 | 3300025304 | Bacteria | 22612 |
| 211 | Ga0209257_1010671 | 3300025304 | Bacteria | 4592 |
| 212 | Ga0207697_10001100 | 3300025315 | Bacteria | 14913 |
| 213 | Ga0207697_10029516 | 3300025315 | Bacteria | 2244 |
| 214 | Ga0207656_10002624 | 3300025321 | Bacteria | 6081 |
| 215 | Ga0207656_10038199 | 3300025321 | Bacteria | 2024 |
| 216 | Ga0207696_1001635 | 3300025711 | Bacteria | 11807 |
| 217 | Ga0207713_1004070 | 3300025735 | Bacteria | 9645 |
| 218 | Ga0207713_1005340 | 3300025735 | Bacteria | 8065 |
| 219 | Ga0207710_10001905 | 3300025900 | Bacteria | 10001 |
| 220 | Ga0207710_10131147 | 3300025900 | Bacteria | 1204 |
| 221 | Ga0207688_10027358 | 3300025901 | Bacteria | 3137 |
| 222 | Ga0207680_10001461 | 3300025903 | Bacteria | 11187 |
| 223 | Ga0207680_10020408 | 3300025903 | Bacteria | 3566 |
| 224 | Ga0207647_10000827 | 3300025904 | Bacteria | 24036 |
| 225 | Ga0207647_10002249 | 3300025904 | Bacteria | 14712 |
| 226 | Ga0207647_10065178 | 3300025904 | Bacteria | 2212 |
| 227 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 228 | Ga0207705_10559300 | 3300025909 | Bacteria | 889 |
| 229 | Ga0207654_10000914 | 3300025911 | Bacteria | 16324 |
| 230 | Ga0207654_10002585 | 3300025911 | Bacteria | 9189 |
| 231 | Ga0207695_10001471 | 3300025913 | Bacteria | 39463 |
| 232 | Ga0207695_10005114 | 3300025913 | Bacteria | 17565 |
| 233 | Ga0207695_10060765 | 3300025913 | Bacteria | 3910 |
| 234 | Ga0207695_10088266 | 3300025913 | Bacteria | 3122 |
| 235 | Ga0207695_10431579 | 3300025913 | Bacteria | 1201 |
| 236 | Ga0207671_10001194 | 3300025914 | Bacteria | 30831 |
| 237 | Ga0207657_10030816 | 3300025919 | Bacteria | 4862 |
| 238 | Ga0207657_10038998 | 3300025919 | Bacteria | 4224 |
| 239 | Ga0207649_10000581 | 3300025920 | Bacteria | 25005 |
| 240 | Ga0207649_10403522 | 3300025920 | Bacteria | 1023 |
| 241 | Ga0207646_10360779 | 3300025922 | Bacteria | 1313 |
| 242 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 243 | Ga0207681_10000120 | 3300025923 | Bacteria | 66235 |
| 244 | Ga0207681_10394056 | 3300025923 | Bacteria | 1117 |
| 245 | Ga0207694_10094666 | 3300025924 | Bacteria | 2360 |
| 246 | Ga0207694_10249374 | 3300025924 | Bacteria | 1452 |
| 247 | Ga0207650_10001196 | 3300025925 | Bacteria | 19063 |
| 248 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 249 | Ga0207644_10021517 | 3300025931 | Bacteria | 4394 |
| 250 | Ga0207644_10074468 | 3300025931 | Bacteria | 2492 |
| 251 | Ga0207690_10047872 | 3300025932 | Bacteria | 2839 |
| 252 | Ga0207706_10051465 | 3300025933 | Bacteria | 3637 |
| 253 | Ga0207706_10078008 | 3300025933 | Bacteria | 2913 |
| 254 | Ga0207686_10174831 | 3300025934 | Bacteria | 1517 |
| 255 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 256 | Ga0207669_10004814 | 3300025937 | Bacteria | 5991 |
| 257 | Ga0207669_10094352 | 3300025937 | Bacteria | 1957 |
| 258 | Ga0207704_10109125 | 3300025938 | Bacteria | 1866 |
| 259 | Ga0207691_10114164 | 3300025940 | Bacteria | 2400 |
| 260 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 261 | Ga0207711_10000504 | 3300025941 | Bacteria | 40316 |
| 262 | Ga0207711_10003539 | 3300025941 | Bacteria | 13523 |
| 263 | Ga0207711_10012342 | 3300025941 | Bacteria | 7100 |
| 264 | Ga0207711_10017110 | 3300025941 | Bacteria | 6022 |
| 265 | Ga0207711_10117061 | 3300025941 | Bacteria | 2376 |
| 266 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 267 | Ga0207667_10017581 | 3300025949 | Bacteria | 8041 |
| 268 | Ga0207667_10040850 | 3300025949 | Bacteria | 4936 |
| 269 | Ga0207651_10387169 | 3300025960 | Bacteria | 1186 |
| 270 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 271 | Ga0207712_10000698 | 3300025961 | Bacteria | 25902 |
| 272 | Ga0207712_10010207 | 3300025961 | Bacteria | 5954 |
| 273 | Ga0207668_10000148 | 3300025972 | Bacteria | 48267 |
| 274 | Ga0207668_10218324 | 3300025972 | Bacteria | 1529 |
| 275 | Ga0207668_10450536 | 3300025972 | Bacteria | 1098 |
| 276 | Ga0207640_10008005 | 3300025981 | Bacteria | 5839 |
| 277 | Ga0207640_10038745 | 3300025981 | Bacteria | 3011 |
| 278 | Ga0207658_10000204 | 3300025986 | Bacteria | 61702 |
| 279 | Ga0207658_10000288 | 3300025986 | Bacteria | 52709 |
| 280 | Ga0207658_10488053 | 3300025986 | Bacteria | 1096 |
| 281 | Ga0207703_10000901 | 3300026035 | Bacteria | 29064 |
| 282 | Ga0207703_10004612 | 3300026035 | Bacteria | 11272 |
| 283 | Ga0207703_10201266 | 3300026035 | Bacteria | 1770 |
| 284 | Ga0207639_10001947 | 3300026041 | Bacteria | 13862 |
| 285 | Ga0207639_10006831 | 3300026041 | Bacteria | 7770 |
| 286 | Ga0207639_10015396 | 3300026041 | Bacteria | 5397 |
| 287 | Ga0207639_10525031 | 3300026041 | Bacteria | 1084 |
| 288 | Ga0207678_10000067 | 3300026067 | Bacteria | 81673 |
| 289 | Ga0207678_10015135 | 3300026067 | Bacteria | 6786 |
| 290 | Ga0207678_10026481 | 3300026067 | Bacteria | 5058 |
| 291 | Ga0207702_10009802 | 3300026078 | Bacteria | 8034 |
| 292 | Ga0207702_10014551 | 3300026078 | Bacteria | 6528 |
| 293 | Ga0207702_10019024 | 3300026078 | Bacteria | 5682 |
| 294 | Ga0207702_10043739 | 3300026078 | Bacteria | 3762 |
| 295 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 296 | Ga0207641_10028169 | 3300026088 | Bacteria | 4640 |
| 297 | Ga0207641_10033992 | 3300026088 | Bacteria | 4238 |
| 298 | Ga0207641_10481440 | 3300026088 | Bacteria | 1203 |
| 299 | Ga0207676_10000036 | 3300026095 | Bacteria | 198447 |
| 300 | Ga0207676_10000169 | 3300026095 | Bacteria | 57208 |
| 301 | Ga0207674_10015757 | 3300026116 | Bacteria | 8292 |
| 302 | Ga0207674_10050990 | 3300026116 | Bacteria | 4224 |
| 303 | Ga0207674_10055955 | 3300026116 | Bacteria | 4007 |
| 304 | Ga0207674_10062778 | 3300026116 | Bacteria | 3752 |
| 305 | Ga0207674_10083546 | 3300026116 | Bacteria | 3193 |
| 306 | Ga0207675_100005628 | 3300026118 | Bacteria | 11998 |
| 307 | Ga0207683_10005199 | 3300026121 | Bacteria | 11175 |
| 308 | Ga0207698_10000098 | 3300026142 | Bacteria | 55118 |
| 309 | Ga0207698_10004109 | 3300026142 | Bacteria | 8840 |
| 310 | Ga0207698_10026383 | 3300026142 | Bacteria | 4109 |
| 311 | Ga0209281_1031202 | 3300027111 | Bacteria | 951 |
| 312 | Ga0209813_10000027 | 3300027866 | Bacteria | 69637 |
| 313 | Ga0209813_10000345 | 3300027866 | Bacteria | 11916 |
| 314 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 315 | Ga0268266_10002543 | 3300028379 | Bacteria | 19369 |
| 316 | Ga0268266_10093046 | 3300028379 | Bacteria | 2645 |
| 317 | Ga0268266_10315174 | 3300028379 | Bacteria | 1462 |
| 318 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 319 | Ga0268265_10000059 | 3300028380 | Bacteria | 152531 |
| 320 | Ga0268265_10001875 | 3300028380 | Bacteria | 16712 |
| 321 | Ga0268265_10013242 | 3300028380 | Bacteria | 5604 |
| 322 | Ga0268264_10000304 | 3300028381 | Bacteria | 79130 |
| 323 | Ga0268264_10004589 | 3300028381 | Bacteria | 11744 |
| 324 | Ga0268264_10017062 | 3300028381 | Bacteria | 5945 |
| 325 | Ga0307517_10202696 | 3300028786 | Bacteria | 1237 |
| 326 | Ga0307513_10013706 | 3300031456 | Bacteria | 9941 |
| 327 | Ga0307513_10137822 | 3300031456 | Bacteria | 2372 |
| 328 | Ga0307408_100031023 | 3300031548 | Bacteria | 3717 |
| 329 | Ga0307408_100053020 | 3300031548 | Bacteria | 2927 |
| 330 | Ga0307408_100371586 | 3300031548 | Bacteria | 1219 |
| 331 | Ga0307405_10000247 | 3300031731 | Bacteria | 19718 |
| 332 | Ga0307405_10366242 | 3300031731 | Bacteria | 1117 |
| 333 | Ga0307413_10047379 | 3300031824 | Bacteria | 2563 |
| 334 | Ga0307413_10181164 | 3300031824 | Bacteria | 1502 |
| 335 | Ga0307410_10021626 | 3300031852 | Bacteria | 3959 |
| 336 | Ga0307410_10095538 | 3300031852 | Bacteria | 2119 |
| 337 | Ga0307406_10117500 | 3300031901 | Bacteria | 1842 |
| 338 | Ga0307406_10127686 | 3300031901 | Bacteria | 1779 |
| 339 | Ga0307406_10183904 | 3300031901 | Bacteria | 1524 |
| 340 | Ga0307406_10184288 | 3300031901 | Bacteria | 1523 |
| 341 | Ga0307406_10221600 | 3300031901 | Bacteria | 1406 |
| 342 | Ga0307407_10228688 | 3300031903 | Bacteria | 1262 |
| 343 | Ga0307412_10001662 | 3300031911 | Bacteria | 12283 |
| 344 | Ga0307412_10014331 | 3300031911 | Bacteria | 4672 |
| 345 | Ga0307412_10096021 | 3300031911 | Bacteria | 2085 |
| 346 | Ga0307412_10105728 | 3300031911 | Bacteria | 2000 |
| 347 | Ga0307412_10292034 | 3300031911 | Bacteria | 1284 |
| 348 | Ga0307409_100221421 | 3300031995 | Bacteria | 1709 |
| 349 | Ga0307409_100257924 | 3300031995 | Bacteria | 1598 |
| 350 | Ga0307416_100167698 | 3300032002 | Bacteria | 2039 |
| 351 | Ga0307416_101278593 | 3300032002 | Bacteria | 839 |
| 352 | Ga0307414_10000385 | 3300032004 | Bacteria | 23999 |
| 353 | Ga0307414_10001045 | 3300032004 | Bacteria | 14151 |
| 354 | Ga0307414_10234098 | 3300032004 | Bacteria | 1516 |
| 355 | Ga0307414_10261877 | 3300032004 | Bacteria | 1443 |
| 356 | Ga0307411_10025796 | 3300032005 | Bacteria | 3527 |
| 357 | Ga0307411_10103064 | 3300032005 | Bacteria | 2023 |
| 358 | Ga0307411_10201444 | 3300032005 | Bacteria | 1529 |
| 359 | Ga0307415_100009603 | 3300032126 | Bacteria | 5435 |
| 360 | Ga0307415_100287250 | 3300032126 | Bacteria | 1356 |
| 361 | Ga0436364_0011659 | 3300037853 | Bacteria | 94648 |
| 362 | Ga0237819_00318 | 3300038705 | Bacteria | 17701 |
| 363 | Ga0436365_1863835 | 3300039437 | Bacteria | 2340 |
| 364 | Ga0451802_0212041 | 3300041460 | Bacteria | 1728 |
| 365 | Ga0451807_1151404 | 3300041486 | Bacteria | 2183 |
| 366 | Ga0451835_1202669 | 3300041492 | Bacteria | 1017 |
| 367 | Ga0439432_003940 | 3300042006 | Bacteria | 5460 |
| 368 | Ga0466957_0579977 | 3300044842 | Bacteria | 784 |
| 369 | Ga0495627_000430 | 3300046453 | Bacteria | 36446 |
| 370 | Ga0495638_0000305 | 3300046460 | Bacteria | 63286 |
| 371 | Ga0495638_0016633 | 3300046460 | Bacteria | 4922 |
| 372 | Ga0495650_0000366 | 3300046471 | Bacteria | 79144 |
| 373 | Ga0495639_0160791 | 3300046475 | Bacteria | 1087 |
| 374 | Ga0495585_0011753 | 3300046492 | Bacteria | 5174 |
| 375 | Ga0495596_0000297 | 3300046500 | Bacteria | 32926 |
| 376 | Ga0495596_0048300 | 3300046500 | Bacteria | 1669 |
| 377 | Ga0495607_0005987 | 3300046501 | Bacteria | 8622 |
| 378 | Ga0495607_0205784 | 3300046501 | Bacteria | 971 |
| 379 | Ga0495583_0000577 | 3300046506 | Bacteria | 50418 |
| 380 | Ga0495583_0004928 | 3300046506 | Bacteria | 9280 |
| 381 | Ga0495583_0014239 | 3300046506 | Bacteria | 4397 |
| 382 | Ga0495583_0045880 | 3300046506 | Bacteria | 2018 |
| 383 | Ga0495583_0063124 | 3300046506 | Bacteria | 1647 |
| 384 | Ga0495606_0004121 | 3300046507 | Bacteria | 14762 |
| 385 | Ga0495606_0025574 | 3300046507 | Bacteria | 4224 |
| 386 | Ga0495606_0033365 | 3300046507 | Bacteria | 3551 |
| 387 | Ga0495610_0002812 | 3300046512 | Bacteria | 14203 |
| 388 | Ga0495620_0003493 | 3300046515 | Bacteria | 8992 |
| 389 | Ga0495620_0027773 | 3300046515 | Bacteria | 2643 |
| 390 | Ga0495628_0478844 | 3300046516 | Bacteria | 901 |
| 391 | Ga0495631_0023320 | 3300046518 | Bacteria | 2869 |
| 392 | Ga0495632_0002181 | 3300046519 | Bacteria | 15098 |
| 393 | Ga0495637_0016118 | 3300046520 | Bacteria | 3496 |
| 394 | Ga0495643_0000036 | 3300046522 | Bacteria | 238374 |
| 395 | Ga0495643_0007755 | 3300046522 | Bacteria | 6872 |
| 396 | Ga0495643_0007941 | 3300046522 | Bacteria | 6770 |
| 397 | Ga0495643_0008329 | 3300046522 | Bacteria | 6577 |
| 398 | Ga0495643_0030205 | 3300046522 | Bacteria | 3028 |
| 399 | Ga0495648_0000235 | 3300046524 | Bacteria | 63436 |
| 400 | Ga0495648_0006694 | 3300046524 | Bacteria | 9331 |
| 401 | Ga0495648_0050667 | 3300046524 | Bacteria | 2535 |
| 402 | Ga0495652_0194959 | 3300046529 | Bacteria | 1543 |
| 403 | Ga0495654_0014488 | 3300046530 | Bacteria | 4196 |
| 404 | Ga0495654_0020498 | 3300046530 | Bacteria | 3444 |
| 405 | Ga0495654_0050226 | 3300046530 | Bacteria | 2039 |
| 406 | Ga0495621_0023325 | 3300046539 | Bacteria | 2058 |
| 407 | Ga0495597_0008403 | 3300046542 | Bacteria | 5175 |
| 408 | Ga0495633_0000173 | 3300046558 | Bacteria | 84576 |
| 409 | Ga0495633_0004741 | 3300046558 | Bacteria | 8539 |
| 410 | Ga0495656_0189088 | 3300046615 | Bacteria | 1016 |
| 411 | Ga0495668_0000087 | 3300046616 | Bacteria | 151819 |
| 412 | Ga0495668_0000149 | 3300046616 | Bacteria | 105826 |
| 413 | Ga0495668_0004609 | 3300046616 | Bacteria | 9693 |
| 414 | Ga0495668_0014040 | 3300046616 | Bacteria | 4707 |
| 415 | Ga0495625_0000866 | 3300046660 | Bacteria | 41162 |
| 416 | Ga0495625_0002250 | 3300046660 | Bacteria | 21249 |
| 417 | Ga0495625_0022727 | 3300046660 | Bacteria | 4803 |
| 418 | Ga0495625_0033687 | 3300046660 | Bacteria | 3784 |
| 419 | Ga0495625_0104869 | 3300046660 | Bacteria | 1937 |
| 420 | Ga0495669_0002611 | 3300046684 | Bacteria | 7371 |
| 421 | Ga0495670_0000033 | 3300046691 | Bacteria | 81716 |
| 422 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 423 | Ga0495649_0105681 | 3300046694 | Bacteria | 1494 |
| 424 | Ga0495589_0045709 | 3300046794 | Bacteria | 2175 |
| 425 | Ga0495687_000123 | 3300047443 | Bacteria | 118577 |
| 426 | Ga0495687_001696 | 3300047443 | Bacteria | 19624 |
| 427 | Ga0495677_0002704 | 3300047445 | Bacteria | 6929 |
| 428 | Ga0495673_0000316 | 3300047469 | Bacteria | 62814 |
| 429 | Ga0495681_0000089 | 3300047470 | Bacteria | 79789 |
| 430 | Ga0495686_0000177 | 3300047472 | Bacteria | 121808 |
| 431 | Ga0495686_0008101 | 3300047472 | Bacteria | 7771 |
| 432 | Ga0495686_0017750 | 3300047472 | Bacteria | 4789 |
| 433 | Ga0495626_0007815 | 3300048091 | Bacteria | 5925 |
| 434 | Ga0496100_0008083 | 3300048903 | Bacteria | 5850 |
| 435 | Ga0496100_0022075 | 3300048903 | Bacteria | 3846 |
| 436 | Ga0496101_0159852 | 3300048904 | Bacteria | 1727 |
| 437 | Ga0496102_0000209 | 3300048905 | Bacteria | 78525 |
| 438 | Ga0496102_0045021 | 3300048905 | Bacteria | 4005 |
| 439 | Ga0496103_0000136 | 3300048906 | Bacteria | 76530 |
| 440 | Ga0496103_0095642 | 3300048906 | Bacteria | 1877 |
| 441 | Ga0496104_0006964 | 3300048907 | Bacteria | 9969 |
| 442 | Ga0496104_0155804 | 3300048907 | Bacteria | 2192 |
| 443 | Ga0496105_0210072 | 3300048908 | Bacteria | 1587 |
| 444 | Ga0496107_0032124 | 3300048910 | Bacteria | 3751 |
| 445 | Ga0496111_0074968 | 3300048914 | Bacteria | 2465 |
| 446 | Ga0496112_0010410 | 3300048915 | Bacteria | 8434 |
| 447 | Ga0496113_0017200 | 3300048916 | Bacteria | 5015 |
| 448 | Ga0496113_0017296 | 3300048916 | Bacteria | 5001 |
| 449 | Ga0496114_0044534 | 3300048917 | Bacteria | 3682 |
| 450 | Ga0496115_0002587 | 3300048918 | Bacteria | 12980 |
| 451 | Ga0496115_0091666 | 3300048918 | Bacteria | 2484 |
| 452 | Ga0496117_0000526 | 3300048920 | Bacteria | 63085 |
| 453 | Ga0496117_0008522 | 3300048920 | Bacteria | 9725 |
| 454 | Ga0496117_0075936 | 3300048920 | Bacteria | 2230 |
| 455 | Ga0496118_0003002 | 3300048921 | Bacteria | 21794 |
| 456 | Ga0496118_0004712 | 3300048921 | Bacteria | 15971 |
| 457 | Ga0496118_0240018 | 3300048921 | Bacteria | 1038 |
| 458 | Ga0496119_0017934 | 3300048922 | Bacteria | 5297 |
| 459 | Ga0496119_0054736 | 3300048922 | Bacteria | 2428 |
| 460 | Ga0496120_0100892 | 3300048923 | Bacteria | 1525 |
| 461 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 462 | Ga0496121_0000930 | 3300048924 | Bacteria | 52952 |
| 463 | Ga0496121_0001586 | 3300048924 | Bacteria | 37825 |
| 464 | Ga0496121_0006990 | 3300048924 | Bacteria | 13722 |
| 465 | Ga0496121_0007335 | 3300048924 | Bacteria | 13332 |
| 466 | Ga0496121_0201978 | 3300048924 | Bacteria | 1416 |
| 467 | Ga0496122_0021007 | 3300048925 | Bacteria | 5865 |
| 468 | Ga0496122_0078662 | 3300048925 | Bacteria | 2309 |
| 469 | Ga0496123_0013924 | 3300048926 | Bacteria | 6701 |
| 470 | Ga0496123_0016878 | 3300048926 | Bacteria | 5901 |
| 471 | Ga0496123_0018196 | 3300048926 | Bacteria | 5603 |
| 472 | Ga0496123_0027459 | 3300048926 | Bacteria | 4239 |
| 473 | Ga0496123_0198194 | 3300048926 | Bacteria | 1032 |
| 474 | Ga0496124_0001268 | 3300048927 | Bacteria | 38438 |
| 475 | Ga0496124_0018089 | 3300048927 | Bacteria | 6616 |
| 476 | Ga0496124_0046207 | 3300048927 | Bacteria | 3729 |
| 477 | Ga0496124_0149312 | 3300048927 | Bacteria | 1835 |
| 478 | Ga0496124_0166769 | 3300048927 | Bacteria | 1711 |
| 479 | Ga0496124_0463879 | 3300048927 | Bacteria | 860 |
| 480 | Ga0496125_0003122 | 3300048928 | Bacteria | 20585 |
| 481 | Ga0496125_0016914 | 3300048928 | Bacteria | 6979 |
| 482 | Ga0496125_0025212 | 3300048928 | Bacteria | 5451 |
| 483 | Ga0496125_0111384 | 3300048928 | Bacteria | 1981 |
| 484 | Ga0496125_0226034 | 3300048928 | Bacteria | 1201 |
| 485 | Ga0496126_0000365 | 3300048929 | Bacteria | 93461 |
| 486 | Ga0496126_0003583 | 3300048929 | Bacteria | 19467 |
| 487 | Ga0496126_0450122 | 3300048929 | Bacteria | 1036 |
| 488 | Ga0495682_0025095 | 3300049460 | Bacteria | 2219 |
| 489 | Ga0501032_0062396 | 3300049569 | Bacteria | 2497 |
| 490 | Ga0501034_0169312 | 3300049571 | Bacteria | 2152 |
| 491 | Ga0501036_0028848 | 3300049572 | Bacteria | 4690 |
| 492 | Ga0501037_0033692 | 3300049573 | Bacteria | 3782 |
| 493 | Ga0501039_0102891 | 3300049575 | Bacteria | 2229 |
| 494 | Ga0501048_0068987 | 3300049582 | Bacteria | 2497 |
| 495 | Ga0501249_000160 | 3300049679 | Bacteria | 20848 |
| 496 | Ga0501225_0001006 | 3300049705 | Bacteria | 8840 |
| 497 | Ga0501262_009969 | 3300049759 | Bacteria | 1182 |
| 498 | Ga0501280_001792 | 3300049776 | Bacteria | 3768 |
| 499 | Ga0501035_0330462 | 3300049822 | Bacteria | 1279 |
| 500 | Ga0501044_0022440 | 3300049823 | Bacteria | 6726 |
| 501 | nmdc:mga03683_1099_c1 | 3300050489 | Bacteria | 7910 |
| 502 | nmdc:mga03n38_18717_c1 | 3300050490 | Bacteria | 2739 |
| 503 | nmdc:mga03n38_27433_c1 | 3300050490 | Bacteria | 2362 |
| 504 | nmdc:mga06z11_348_c1 | 3300050494 | Bacteria | 17434 |
| 505 | nmdc:mga04h51_137_c1 | 3300050495 | Bacteria | 21470 |
| 506 | nmdc:mga04h51_48_c1 | 3300050495 | Bacteria | 38959 |
| 507 | nmdc:mga07m45_162686_c1 | 3300050496 | Bacteria | 1296 |
| 508 | nmdc:mga07m45_211_c1 | 3300050496 | Bacteria | 23070 |
| 509 | nmdc:mga07m45_38630_c1 | 3300050496 | Bacteria | 2664 |
| 510 | nmdc:mga07m45_4622_c1 | 3300050496 | Bacteria | 6750 |
| 511 | nmdc:mga0sz30_2451_c1 | 3300050516 | Bacteria | 6610 |
| 512 | Ga0500643_000762 | 3300053087 | Bacteria | 20999 |
| 513 | Ga0500643_003634 | 3300053087 | Bacteria | 7314 |
| 514 | Ga0500643_024575 | 3300053087 | Bacteria | 1911 |
| 515 | Ga0500566_0176000 | 3300053094 | Bacteria | 1102 |
| 516 | Ga0500555_000457 | 3300053103 | Bacteria | 16951 |
| 517 | Ga0500556_0000037 | 3300053104 | Bacteria | 138433 |
| 518 | Ga0500592_000557 | 3300053116 | Bacteria | 6156 |
| 519 | Ga0500595_005149 | 3300053119 | Bacteria | 5738 |
| 520 | Ga0500607_000003 | 3300053121 | Bacteria | 149664 |
| 521 | Ga0500608_004635 | 3300053122 | Bacteria | 5355 |
| 522 | Ga0500608_074197 | 3300053122 | Bacteria | 1614 |
| 523 | Ga0500608_141688 | 3300053122 | Bacteria | 1065 |
| 524 | Ga0500618_012028 | 3300053125 | Bacteria | 2277 |
| 525 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 526 | Ga0500658_0007510 | 3300053134 | Bacteria | 4028 |
| 527 | Ga0500658_0026087 | 3300053134 | Bacteria | 2249 |
| 528 | Ga0500559_0001835 | 3300053136 | Bacteria | 11587 |
| 529 | Ga0500568_0005400 | 3300053139 | Bacteria | 6608 |
| 530 | Ga0500568_0038346 | 3300053139 | Bacteria | 1940 |
| 531 | Ga0500573_0000290 | 3300053140 | Bacteria | 21357 |
| 532 | Ga0500574_112010 | 3300053141 | Bacteria | 809 |
| 533 | Ga0500577_0043130 | 3300053142 | Bacteria | 1655 |
| 534 | Ga0500577_0086213 | 3300053142 | Bacteria | 1261 |
| 535 | Ga0500604_0006284 | 3300053151 | Bacteria | 3139 |
| 536 | Ga0500622_0062246 | 3300053156 | Bacteria | 1901 |
| 537 | Ga0500624_000004 | 3300053157 | Bacteria | 196921 |
| 538 | Ga0500624_000100 | 3300053157 | Bacteria | 41296 |
| 539 | Ga0500624_000115 | 3300053157 | Bacteria | 37706 |
| 540 | Ga0500627_0000013 | 3300053158 | Bacteria | 136204 |
| 541 | Ga0500627_0000446 | 3300053158 | Bacteria | 11187 |
| 542 | Ga0500627_0004248 | 3300053158 | Bacteria | 4565 |
| 543 | Ga0500627_0007639 | 3300053158 | Bacteria | 3782 |
| 544 | Ga0500627_0124292 | 3300053158 | Bacteria | 1164 |
| 545 | Ga0500636_0101442 | 3300053177 | Bacteria | 1635 |
| 546 | Ga0500637_0000006 | 3300053178 | Bacteria | 99157 |
| 547 | Ga0500637_0001510 | 3300053178 | Bacteria | 9926 |
| 548 | Ga0500645_002404 | 3300053730 | Bacteria | 8398 |
| 549 | Ga0500645_003232 | 3300053730 | Bacteria | 6744 |
| 550 | Ga0500596_001300 | 3300053735 | Bacteria | 5046 |
| 551 | Ga0500661_000186 | 3300055283 | Bacteria | 10909 |
| 552 | Ga0500661_015365 | 3300055283 | Bacteria | 1373 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046529 | Ga0495652_0194959 | Ga0495652_0194959_230_1039 | 218 |
| 2 | 3300006353 | Ga0075370_10166011 | Ga0075370_101660112 | 221 |
| 3 | 3300050496 | nmdc:mga07m45_162686_c1 | nmdc:mga07m45_162686_c1_114_902 | 221 |
| 4 | 3300046516 | Ga0495628_0478844 | Ga0495628_0478844_49_858 | 222 |
| 5 | 3300001989 | JGI24739J22299_10074127 | JGI24739J22299_100741272 | 223 |
| 6 | 3300026116 | Ga0207674_10083546 | Ga0207674_100835463 | 225 |
| 7 | 3300042006 | Ga0439432_003940 | Ga0439432_003940_3510_4307 | 226 |
| 8 | 3300009094 | Ga0111539_10305752 | Ga0111539_103057523 | 227 |
| 9 | 3300026095 | Ga0207676_10000169 | Ga0207676_1000016955 | 227 |
| 10 | 3300005577 | Ga0068857_100423782 | Ga0068857_1004237822 | 228 |
| 11 | 3300005578 | Ga0068854_100014593 | Ga0068854_1000145932 | 228 |
| 12 | 3300005719 | Ga0068861_100279042 | Ga0068861_1002790422 | 228 |
| 13 | 3300009093 | Ga0105240_10504950 | Ga0105240_105049502 | 228 |
| 14 | 3300009545 | Ga0105237_10025829 | Ga0105237_100258295 | 228 |
| 15 | 3300025913 | Ga0207695_10431579 | Ga0207695_104315791 | 228 |
| 16 | 3300025986 | Ga0207658_10488053 | Ga0207658_104880532 | 228 |
| 17 | 3300046660 | Ga0495625_0033687 | Ga0495625_0033687_1388_2194 | 228 |
| 18 | 3300048924 | Ga0496121_0201978 | Ga0496121_0201978_482_1279 | 228 |
| 19 | 3300048925 | Ga0496122_0078662 | Ga0496122_0078662_377_1174 | 228 |
| 20 | 3300048926 | Ga0496123_0018196 | Ga0496123_0018196_397_1194 | 228 |
| 21 | 3300048927 | Ga0496124_0001268 | Ga0496124_0001268_34282_35079 | 228 |
| 22 | 3300048927 | Ga0496124_0018089 | Ga0496124_0018089_2433_3230 | 228 |
| 23 | 3300013306 | Ga0163162_10002088 | Ga0163162_1000208810 | 229 |
| 24 | 3300031548 | Ga0307408_100031023 | Ga0307408_1000310233 | 229 |
| 25 | 3300031901 | Ga0307406_10127686 | Ga0307406_101276862 | 229 |
| 26 | 3300031911 | Ga0307412_10014331 | Ga0307412_100143313 | 229 |
| 27 | 3300032002 | Ga0307416_100167698 | Ga0307416_1001676982 | 229 |
| 28 | 3300046506 | Ga0495583_0063124 | Ga0495583_0063124_600_1421 | 229 |
| 29 | 3300046522 | Ga0495643_0007755 | Ga0495643_0007755_412_1176 | 229 |
| 30 | 3300046501 | Ga0495607_0005987 | Ga0495607_0005987_4591_5409 | 230 |
| 31 | 3300046522 | Ga0495643_0007941 | Ga0495643_0007941_1725_2495 | 230 |
| 32 | 3300005295 | Ga0065707_10152119 | Ga0065707_101521192 | 231 |
| 33 | 3300006038 | Ga0075365_10026950 | Ga0075365_100269502 | 231 |
| 34 | 3300006048 | Ga0075363_100005299 | Ga0075363_1000052993 | 231 |
| 35 | 3300006051 | Ga0075364_10023905 | Ga0075364_100239053 | 231 |
| 36 | 3300006177 | Ga0075362_10002346 | Ga0075362_100023462 | 231 |
| 37 | 3300006178 | Ga0075367_10119336 | Ga0075367_101193362 | 231 |
| 38 | 3300006186 | Ga0075369_10002985 | Ga0075369_100029852 | 231 |
| 39 | 3300006195 | Ga0075366_10063719 | Ga0075366_100637193 | 231 |
| 40 | 3300009177 | Ga0105248_10008190 | Ga0105248_1000819012 | 231 |
| 41 | 3300025941 | Ga0207711_10012342 | Ga0207711_100123423 | 231 |
| 42 | 3300026035 | Ga0207703_10000901 | Ga0207703_1000090121 | 231 |
| 43 | 3300027866 | Ga0209813_10000027 | Ga0209813_1000002768 | 231 |
| 44 | 3300032126 | Ga0307415_100287250 | Ga0307415_1002872502 | 231 |
| 45 | 3300047445 | Ga0495677_0002704 | Ga0495677_0002704_4223_4993 | 231 |
| 46 | 3300050489 | nmdc:mga03683_1099_c1 | nmdc:mga03683_1099_c1_1849_2598 | 231 |
| 47 | 3300050490 | nmdc:mga03n38_18717_c1 | nmdc:mga03n38_18717_c1_1116_1865 | 231 |
| 48 | 3300050495 | nmdc:mga04h51_48_c1 | nmdc:mga04h51_48_c1_25047_25796 | 231 |
| 49 | 3300050496 | nmdc:mga07m45_211_c1 | nmdc:mga07m45_211_c1_3761_4510 | 231 |
| 50 | 3300050516 | nmdc:mga0sz30_2451_c1 | nmdc:mga0sz30_2451_c1_4168_4917 | 231 |
| 51 | 3300053142 | Ga0500577_0086213 | Ga0500577_0086213_344_1111 | 231 |
| 52 | 3300005356 | Ga0070674_100019515 | Ga0070674_1000195153 | 232 |
| 53 | 3300009101 | Ga0105247_10010362 | Ga0105247_100103624 | 232 |
| 54 | 3300009545 | Ga0105237_10006917 | Ga0105237_100069174 | 232 |
| 55 | 3300010375 | Ga0105239_10372014 | Ga0105239_103720142 | 232 |
| 56 | 3300025914 | Ga0207671_10001194 | Ga0207671_1000119421 | 232 |
| 57 | 3300031456 | Ga0307513_10137822 | Ga0307513_101378222 | 232 |
| 58 | 3300046660 | Ga0495625_0002250 | Ga0495625_0002250_9696_10418 | 232 |
| 59 | 3300053087 | Ga0500643_003634 | Ga0500643_003634_3264_4055 | 232 |
| 60 | 3300053116 | Ga0500592_000557 | Ga0500592_000557_1527_2327 | 232 |
| 61 | 3300053158 | Ga0500627_0004248 | Ga0500627_0004248_2204_3004 | 232 |
| 62 | 3300004625 | Ga0055543_1021546 | Ga0055543_10215462 | 233 |
| 63 | 3300005262 | Ga0065165_1001363 | Ga0065165_100136328 | 233 |
| 64 | 3300005347 | Ga0070668_100219876 | Ga0070668_1002198762 | 233 |
| 65 | 3300006946 | Ga0079104_1019271 | Ga0079104_10192711 | 233 |
| 66 | 3300025972 | Ga0207668_10218324 | Ga0207668_102183242 | 233 |
| 67 | 3300031548 | Ga0307408_100371586 | Ga0307408_1003715862 | 233 |
| 68 | 3300031824 | Ga0307413_10181164 | Ga0307413_101811641 | 233 |
| 69 | 3300031903 | Ga0307407_10228688 | Ga0307407_102286881 | 233 |
| 70 | 3300046691 | Ga0495670_0000033 | Ga0495670_0000033_77454_78242 | 233 |
| 71 | 3300049776 | Ga0501280_001792 | Ga0501280_001792_2659_3468 | 233 |
| 72 | 3300053730 | Ga0500645_003232 | Ga0500645_003232_5441_6190 | 233 |
| 73 | 3300003763 | Ga0055529_1000004 | Ga0055529_1000004199 | 234 |
| 74 | 3300005347 | Ga0070668_100122054 | Ga0070668_1001220542 | 234 |
| 75 | 3300005355 | Ga0070671_100651257 | Ga0070671_1006512571 | 234 |
| 76 | 3300005356 | Ga0070674_100036673 | Ga0070674_1000366732 | 234 |
| 77 | 3300005367 | Ga0070667_100005338 | Ga0070667_1000053384 | 234 |
| 78 | 3300005841 | Ga0068863_100021575 | Ga0068863_1000215752 | 234 |
| 79 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008690 | 234 |
| 80 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002734 | 234 |
| 81 | 3300025901 | Ga0207688_10027358 | Ga0207688_100273584 | 234 |
| 82 | 3300025937 | Ga0207669_10094352 | Ga0207669_100943523 | 234 |
| 83 | 3300048918 | Ga0496115_0002587 | Ga0496115_0002587_8554_9300 | 234 |
| 84 | 3300009551 | Ga0105238_10253956 | Ga0105238_102539562 | 235 |
| 85 | 3300010375 | Ga0105239_10000271 | Ga0105239_1000027119 | 235 |
| 86 | 3300025913 | Ga0207695_10005114 | Ga0207695_100051145 | 235 |
| 87 | 3300025924 | Ga0207694_10249374 | Ga0207694_102493742 | 235 |
| 88 | 3300046524 | Ga0495648_0006694 | Ga0495648_0006694_1016_1801 | 235 |
| 89 | 3300006946 | Ga0079104_1019976 | Ga0079104_10199762 | 236 |
| 90 | 3300025949 | Ga0207667_10040850 | Ga0207667_100408504 | 236 |
| 91 | 3300031456 | Ga0307513_10013706 | Ga0307513_100137066 | 236 |
| 92 | 3300046475 | Ga0495639_0160791 | Ga0495639_0160791_228_1055 | 236 |
| 93 | 3300046660 | Ga0495625_0104869 | Ga0495625_0104869_146_889 | 236 |
| 94 | 3300053104 | Ga0500556_0000037 | Ga0500556_0000037_116281_117024 | 236 |
| 95 | 3300053122 | Ga0500608_004635 | Ga0500608_004635_2829_3572 | 236 |
| 96 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_758572_759315 | 236 |
| 97 | 3300053156 | Ga0500622_0062246 | Ga0500622_0062246_159_902 | 236 |
| 98 | 3300046558 | Ga0495633_0004741 | Ga0495633_0004741_3675_4490 | 237 |
| 99 | 3300047472 | Ga0495686_0017750 | Ga0495686_0017750_3508_4287 | 237 |
| 100 | 3300001915 | JGI24741J21665_1000134 | JGI24741J21665_100013416 | 238 |
| 101 | 3300002075 | JGI24738J21930_10002792 | JGI24738J21930_100027923 | 238 |
| 102 | 3300005335 | Ga0070666_10000171 | Ga0070666_1000017135 | 238 |
| 103 | 3300005344 | Ga0070661_100007098 | Ga0070661_1000070986 | 238 |
| 104 | 3300005344 | Ga0070661_100059975 | Ga0070661_1000599753 | 238 |
| 105 | 3300005353 | Ga0070669_100000001 | Ga0070669_10000000124 | 238 |
| 106 | 3300005355 | Ga0070671_100000007 | Ga0070671_100000007242 | 238 |
| 107 | 3300005440 | Ga0070705_100014227 | Ga0070705_1000142275 | 238 |
| 108 | 3300005455 | Ga0070663_100009092 | Ga0070663_1000090923 | 238 |
| 109 | 3300005548 | Ga0070665_100359317 | Ga0070665_1003593172 | 238 |
| 110 | 3300005577 | Ga0068857_100252983 | Ga0068857_1002529831 | 238 |
| 111 | 3300005719 | Ga0068861_100002527 | Ga0068861_1000025274 | 238 |
| 112 | 3300005834 | Ga0068851_10128028 | Ga0068851_101280282 | 238 |
| 113 | 3300005841 | Ga0068863_100016644 | Ga0068863_1000166447 | 238 |
| 114 | 3300005844 | Ga0068862_100000468 | Ga0068862_10000046824 | 238 |
| 115 | 3300009174 | Ga0105241_10008499 | Ga0105241_100084993 | 238 |
| 116 | 3300010375 | Ga0105239_10139232 | Ga0105239_101392324 | 238 |
| 117 | 3300013100 | Ga0157373_10028324 | Ga0157373_100283243 | 238 |
| 118 | 3300013104 | Ga0157370_10094115 | Ga0157370_100941153 | 238 |
| 119 | 3300013105 | Ga0157369_10115718 | Ga0157369_101157183 | 238 |
| 120 | 3300025290 | Ga0207673_1005823 | Ga0207673_10058232 | 238 |
| 121 | 3300025315 | Ga0207697_10001100 | Ga0207697_1000110013 | 238 |
| 122 | 3300025903 | Ga0207680_10001461 | Ga0207680_100014614 | 238 |
| 123 | 3300025904 | Ga0207647_10002249 | Ga0207647_100022499 | 238 |
| 124 | 3300025909 | Ga0207705_10559300 | Ga0207705_105593002 | 238 |
| 125 | 3300025913 | Ga0207695_10060765 | Ga0207695_100607654 | 238 |
| 126 | 3300025922 | Ga0207646_10360779 | Ga0207646_103607792 | 238 |
| 127 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002979 | 238 |
| 128 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002917 | 238 |
| 129 | 3300025961 | Ga0207712_10010207 | Ga0207712_100102076 | 238 |
| 130 | 3300026041 | Ga0207639_10006831 | Ga0207639_100068317 | 238 |
| 131 | 3300026067 | Ga0207678_10000067 | Ga0207678_1000006735 | 238 |
| 132 | 3300026078 | Ga0207702_10014551 | Ga0207702_100145512 | 238 |
| 133 | 3300026088 | Ga0207641_10028169 | Ga0207641_100281693 | 238 |
| 134 | 3300026116 | Ga0207674_10055955 | Ga0207674_100559554 | 238 |
| 135 | 3300026118 | Ga0207675_100005628 | Ga0207675_1000056284 | 238 |
| 136 | 3300027111 | Ga0209281_1031202 | Ga0209281_10312021 | 238 |
| 137 | 3300028379 | Ga0268266_10315174 | Ga0268266_103151742 | 238 |
| 138 | 3300028380 | Ga0268265_10001875 | Ga0268265_1000187513 | 238 |
| 139 | 3300031548 | Ga0307408_100053020 | Ga0307408_1000530204 | 238 |
| 140 | 3300032004 | Ga0307414_10234098 | Ga0307414_102340982 | 238 |
| 141 | 3300032005 | Ga0307411_10103064 | Ga0307411_101030642 | 238 |
| 142 | 3300046539 | Ga0495621_0023325 | Ga0495621_0023325_567_1289 | 238 |
| 143 | 3300002075 | JGI24738J21930_10041385 | JGI24738J21930_100413851 | 239 |
| 144 | 3300003781 | Ga0055536_1003805 | Ga0055536_10038058 | 239 |
| 145 | 3300005289 | Ga0065704_10356200 | Ga0065704_103562001 | 239 |
| 146 | 3300005355 | Ga0070671_100229882 | Ga0070671_1002298822 | 239 |
| 147 | 3300005457 | Ga0070662_100114749 | Ga0070662_1001147492 | 239 |
| 148 | 3300005577 | Ga0068857_100454190 | Ga0068857_1004541901 | 239 |
| 149 | 3300005578 | Ga0068854_100218245 | Ga0068854_1002182452 | 239 |
| 150 | 3300005578 | Ga0068854_100230896 | Ga0068854_1002308963 | 239 |
| 151 | 3300005843 | Ga0068860_100002492 | Ga0068860_1000024922 | 239 |
| 152 | 3300006353 | Ga0075370_10243458 | Ga0075370_102434582 | 239 |
| 153 | 3300025292 | Ga0209676_1001476 | Ga0209676_100147626 | 239 |
| 154 | 3300025933 | Ga0207706_10078008 | Ga0207706_100780082 | 239 |
| 155 | 3300026116 | Ga0207674_10062778 | Ga0207674_100627782 | 239 |
| 156 | 3300028381 | Ga0268264_10017062 | Ga0268264_100170622 | 239 |
| 157 | 3300031901 | Ga0307406_10184288 | Ga0307406_101842882 | 239 |
| 158 | 3300031911 | Ga0307412_10292034 | Ga0307412_102920342 | 239 |
| 159 | 3300031995 | Ga0307409_100221421 | Ga0307409_1002214212 | 239 |
| 160 | 3300032005 | Ga0307411_10201444 | Ga0307411_102014442 | 239 |
| 161 | 3300044842 | Ga0466957_0579977 | Ga0466957_0579977_21_743 | 239 |
| 162 | 3300046500 | Ga0495596_0000297 | Ga0495596_0000297_29357_30091 | 239 |
| 163 | 3300046512 | Ga0495610_0002812 | Ga0495610_0002812_3505_4239 | 239 |
| 164 | 3300046522 | Ga0495643_0000036 | Ga0495643_0000036_100506_101234 | 239 |
| 165 | 3300048091 | Ga0495626_0007815 | Ga0495626_0007815_2326_3060 | 239 |
| 166 | 3300048924 | Ga0496121_0001586 | Ga0496121_0001586_17084_17818 | 239 |
| 167 | 3300050496 | nmdc:mga07m45_4622_c1 | nmdc:mga07m45_4622_c1_2528_3262 | 239 |
| 168 | 3300053094 | Ga0500566_0176000 | Ga0500566_0176000_276_1022 | 239 |
| 169 | 3300053121 | Ga0500607_000003 | Ga0500607_000003_107707_108453 | 239 |
| 170 | 3300053122 | Ga0500608_141688 | Ga0500608_141688_101_847 | 239 |
| 171 | 3300053178 | Ga0500637_0001510 | Ga0500637_0001510_546_1292 | 239 |
| 172 | 3300053730 | Ga0500645_002404 | Ga0500645_002404_4035_4781 | 239 |
| 173 | iso_pu_bacteria | 2599185354 | 2600203298 | 239 |
| 174 | iso_pu_bacteria | 2643221588 | 2643951165 | 239 |
| 175 | iso_pu_bacteria | 2751185897 | 2753766876 | 239 |
| 176 | iso_pu_bacteria | 2818991438 | 2819551025 | 239 |
| 177 | iso_pu_bacteria | 2852653556 | 2852656369 | 239 |
| 178 | iso_pu_bacteria | 2928027323 | 2928030267 | 239 |
| 179 | iso_pu_bacteria | 2984564862 | 2984568766 | 239 |
| 180 | iso_pu_bacteria | 2993356040 | 2993359755 | 239 |
| 181 | iso_pu_bacteria | 8054302542 | 8054307547 | 239 |
| 182 | 3300005289 | Ga0065704_10009557 | Ga0065704_100095572 | 240 |
| 183 | 3300005339 | Ga0070660_100019269 | Ga0070660_1000192693 | 240 |
| 184 | 3300005355 | Ga0070671_100109302 | Ga0070671_1001093022 | 240 |
| 185 | 3300005366 | Ga0070659_100069566 | Ga0070659_1000695664 | 240 |
| 186 | 3300005455 | Ga0070663_100035804 | Ga0070663_1000358044 | 240 |
| 187 | 3300005455 | Ga0070663_100213728 | Ga0070663_1002137281 | 240 |
| 188 | 3300005563 | Ga0068855_100032329 | Ga0068855_1000323295 | 240 |
| 189 | 3300005564 | Ga0070664_100089279 | Ga0070664_1000892792 | 240 |
| 190 | 3300005577 | Ga0068857_100163514 | Ga0068857_1001635143 | 240 |
| 191 | 3300005578 | Ga0068854_100056864 | Ga0068854_1000568643 | 240 |
| 192 | 3300005578 | Ga0068854_100467580 | Ga0068854_1004675802 | 240 |
| 193 | 3300005614 | Ga0068856_100072957 | Ga0068856_1000729573 | 240 |
| 194 | 3300005616 | Ga0068852_100002899 | Ga0068852_10000289912 | 240 |
| 195 | 3300005616 | Ga0068852_100016319 | Ga0068852_1000163195 | 240 |
| 196 | 3300005617 | Ga0068859_100004071 | Ga0068859_1000040712 | 240 |
| 197 | 3300005842 | Ga0068858_100001300 | Ga0068858_1000013006 | 240 |
| 198 | 3300005937 | Ga0081455_10000212 | Ga0081455_1000021246 | 240 |
| 199 | 3300006353 | Ga0075370_10026188 | Ga0075370_100261882 | 240 |
| 200 | 3300006931 | Ga0097620_100001427 | Ga0097620_1000014274 | 240 |
| 201 | 3300006931 | Ga0097620_100004071 | Ga0097620_1000040712 | 240 |
| 202 | 3300009093 | Ga0105240_10030797 | Ga0105240_100307978 | 240 |
| 203 | 3300009093 | Ga0105240_10694735 | Ga0105240_106947352 | 240 |
| 204 | 3300009174 | Ga0105241_10135279 | Ga0105241_101352793 | 240 |
| 205 | 3300009177 | Ga0105248_10038528 | Ga0105248_100385284 | 240 |
| 206 | 3300009177 | Ga0105248_10076006 | Ga0105248_100760061 | 240 |
| 207 | 3300009545 | Ga0105237_10405037 | Ga0105237_104050372 | 240 |
| 208 | 3300009551 | Ga0105238_10092201 | Ga0105238_100922012 | 240 |
| 209 | 3300009551 | Ga0105238_10118462 | Ga0105238_101184622 | 240 |
| 210 | 3300009551 | Ga0105238_10938384 | Ga0105238_109383842 | 240 |
| 211 | 3300009978 | Ga0105148_100181 | Ga0105148_1001812 | 240 |
| 212 | 3300013100 | Ga0157373_10079994 | Ga0157373_100799943 | 240 |
| 213 | 3300013102 | Ga0157371_10001885 | Ga0157371_100018858 | 240 |
| 214 | 3300013105 | Ga0157369_10465719 | Ga0157369_104657191 | 240 |
| 215 | 3300014326 | Ga0157380_10000945 | Ga0157380_1000094512 | 240 |
| 216 | 3300025315 | Ga0207697_10029516 | Ga0207697_100295163 | 240 |
| 217 | 3300025904 | Ga0207647_10065178 | Ga0207647_100651782 | 240 |
| 218 | 3300025909 | Ga0207705_10000007 | Ga0207705_10000007553 | 240 |
| 219 | 3300025911 | Ga0207654_10000914 | Ga0207654_1000091416 | 240 |
| 220 | 3300025913 | Ga0207695_10001471 | Ga0207695_1000147132 | 240 |
| 221 | 3300025913 | Ga0207695_10088266 | Ga0207695_100882663 | 240 |
| 222 | 3300025919 | Ga0207657_10030816 | Ga0207657_100308165 | 240 |
| 223 | 3300025924 | Ga0207694_10094666 | Ga0207694_100946661 | 240 |
| 224 | 3300025931 | Ga0207644_10074468 | Ga0207644_100744683 | 240 |
| 225 | 3300025932 | Ga0207690_10047872 | Ga0207690_100478723 | 240 |
| 226 | 3300025941 | Ga0207711_10000504 | Ga0207711_1000050424 | 240 |
| 227 | 3300025941 | Ga0207711_10117061 | Ga0207711_101170612 | 240 |
| 228 | 3300025949 | Ga0207667_10017581 | Ga0207667_100175814 | 240 |
| 229 | 3300025972 | Ga0207668_10450536 | Ga0207668_104505362 | 240 |
| 230 | 3300025981 | Ga0207640_10008005 | Ga0207640_100080054 | 240 |
| 231 | 3300026035 | Ga0207703_10004612 | Ga0207703_100046127 | 240 |
| 232 | 3300026035 | Ga0207703_10201266 | Ga0207703_102012661 | 240 |
| 233 | 3300026041 | Ga0207639_10525031 | Ga0207639_105250312 | 240 |
| 234 | 3300026067 | Ga0207678_10015135 | Ga0207678_100151358 | 240 |
| 235 | 3300026078 | Ga0207702_10019024 | Ga0207702_100190242 | 240 |
| 236 | 3300026078 | Ga0207702_10043739 | Ga0207702_100437393 | 240 |
| 237 | 3300026142 | Ga0207698_10000098 | Ga0207698_100000982 | 240 |
| 238 | 3300026142 | Ga0207698_10004109 | Ga0207698_100041093 | 240 |
| 239 | 3300027866 | Ga0209813_10000345 | Ga0209813_100003458 | 240 |
| 240 | 3300041460 | Ga0451802_0212041 | Ga0451802_0212041_964_1698 | 240 |
| 241 | 3300041486 | Ga0451807_1151404 | Ga0451807_1151404_437_1171 | 240 |
| 242 | 3300046524 | Ga0495648_0050667 | Ga0495648_0050667_192_926 | 240 |
| 243 | 3300046558 | Ga0495633_0000173 | Ga0495633_0000173_41070_41798 | 240 |
| 244 | 3300048907 | Ga0496104_0155804 | Ga0496104_0155804_88_813 | 240 |
| 245 | 3300048908 | Ga0496105_0210072 | Ga0496105_0210072_39_764 | 240 |
| 246 | 3300048917 | Ga0496114_0044534 | Ga0496114_0044534_668_1405 | 240 |
| 247 | 3300048920 | Ga0496117_0075936 | Ga0496117_0075936_1004_1732 | 240 |
| 248 | 3300048921 | Ga0496118_0240018 | Ga0496118_0240018_265_993 | 240 |
| 249 | 3300048922 | Ga0496119_0054736 | Ga0496119_0054736_620_1348 | 240 |
| 250 | 3300048925 | Ga0496122_0021007 | Ga0496122_0021007_3240_3980 | 240 |
| 251 | 3300048926 | Ga0496123_0016878 | Ga0496123_0016878_1923_2663 | 240 |
| 252 | 3300048927 | Ga0496124_0166769 | Ga0496124_0166769_813_1547 | 240 |
| 253 | 3300048927 | Ga0496124_0463879 | Ga0496124_0463879_101_841 | 240 |
| 254 | 3300048928 | Ga0496125_0226034 | Ga0496125_0226034_113_853 | 240 |
| 255 | 3300048929 | Ga0496126_0003583 | Ga0496126_0003583_14443_15180 | 240 |
| 256 | 3300050490 | nmdc:mga03n38_27433_c1 | nmdc:mga03n38_27433_c1_1140_1868 | 240 |
| 257 | 3300050494 | nmdc:mga06z11_348_c1 | nmdc:mga06z11_348_c1_2765_3493 | 240 |
| 258 | 3300050495 | nmdc:mga04h51_137_c1 | nmdc:mga04h51_137_c1_6801_7529 | 240 |
| 259 | 3300050496 | nmdc:mga07m45_38630_c1 | nmdc:mga07m45_38630_c1_1851_2579 | 240 |
| 260 | 3300053139 | Ga0500568_0038346 | Ga0500568_0038346_714_1469 | 240 |
| 261 | 3300053157 | Ga0500624_000115 | Ga0500624_000115_4550_5281 | 240 |
| 262 | iso_pu_bacteria | 2643221563 | 2643834451 | 240 |
| 263 | iso_pu_bacteria | 2643221608 | 2644055377 | 240 |
| 264 | iso_pu_bacteria | 3000865235 | 3000868191 | 240 |
| 265 | 3300005353 | Ga0070669_100098547 | Ga0070669_1000985473 | 241 |
| 266 | 3300025923 | Ga0207681_10394056 | Ga0207681_103940561 | 241 |
| 267 | 3300028786 | Ga0307517_10202696 | Ga0307517_102026961 | 241 |
| 268 | 3300031824 | Ga0307413_10047379 | Ga0307413_100473792 | 241 |
| 269 | 3300031852 | Ga0307410_10021626 | Ga0307410_100216264 | 241 |
| 270 | 3300031852 | Ga0307410_10095538 | Ga0307410_100955381 | 241 |
| 271 | 3300031901 | Ga0307406_10117500 | Ga0307406_101175002 | 241 |
| 272 | 3300031901 | Ga0307406_10183904 | Ga0307406_101839042 | 241 |
| 273 | 3300031911 | Ga0307412_10096021 | Ga0307412_100960212 | 241 |
| 274 | 3300031995 | Ga0307409_100257924 | Ga0307409_1002579242 | 241 |
| 275 | 3300032002 | Ga0307416_101278593 | Ga0307416_1012785931 | 241 |
| 276 | 3300032004 | Ga0307414_10261877 | Ga0307414_102618772 | 241 |
| 277 | 3300032005 | Ga0307411_10025796 | Ga0307411_100257963 | 241 |
| 278 | 3300046453 | Ga0495627_000430 | Ga0495627_000430_30867_31613 | 241 |
| 279 | 3300046471 | Ga0495650_0000366 | Ga0495650_0000366_48128_48874 | 241 |
| 280 | 3300046515 | Ga0495620_0003493 | Ga0495620_0003493_8013_8861 | 241 |
| 281 | 3300046515 | Ga0495620_0027773 | Ga0495620_0027773_579_1325 | 241 |
| 282 | 3300046530 | Ga0495654_0050226 | Ga0495654_0050226_55_801 | 241 |
| 283 | 3300047470 | Ga0495681_0000089 | Ga0495681_0000089_30916_31662 | 241 |
| 284 | 3300049705 | Ga0501225_0001006 | Ga0501225_0001006_457_1188 | 241 |
| 285 | 3300053119 | Ga0500595_005149 | Ga0500595_005149_4405_5232 | 241 |
| 286 | 3300053141 | Ga0500574_112010 | Ga0500574_112010_50_799 | 241 |
| 287 | 3300053157 | Ga0500624_000004 | Ga0500624_000004_137878_138627 | 241 |
| 288 | 3300053178 | Ga0500637_0000006 | Ga0500637_0000006_43585_44334 | 241 |
| 289 | iso_pu_bacteria | 2879163058 | 2879163703 | 241 |
| 290 | iso_pu_bacteria | 2928526807 | 2928530800 | 241 |
| 291 | iso_pu_bacteria | 2928968154 | 2928971127 | 241 |
| 292 | 3300005289 | Ga0065704_10110538 | Ga0065704_101105382 | 242 |
| 293 | 3300005331 | Ga0070670_100001449 | Ga0070670_10000144913 | 242 |
| 294 | 3300005367 | Ga0070667_100001949 | Ga0070667_10000194923 | 242 |
| 295 | 3300005618 | Ga0068864_100000332 | Ga0068864_10000033211 | 242 |
| 296 | 3300005841 | Ga0068863_100000456 | Ga0068863_10000045639 | 242 |
| 297 | 3300005844 | Ga0068862_100000506 | Ga0068862_10000050611 | 242 |
| 298 | 3300009011 | Ga0105251_10001184 | Ga0105251_1000118410 | 242 |
| 299 | 3300009101 | Ga0105247_10078338 | Ga0105247_100783382 | 242 |
| 300 | 3300009177 | Ga0105248_10000029 | Ga0105248_1000002912 | 242 |
| 301 | 3300009553 | Ga0105249_10000928 | Ga0105249_1000092827 | 242 |
| 302 | 3300013306 | Ga0163162_10121046 | Ga0163162_101210463 | 242 |
| 303 | 3300014968 | Ga0157379_10014026 | Ga0157379_100140263 | 242 |
| 304 | 3300025292 | Ga0209676_1027946 | Ga0209676_10279461 | 242 |
| 305 | 3300025294 | Ga0209025_1025385 | Ga0209025_10253853 | 242 |
| 306 | 3300025304 | Ga0209257_1010671 | Ga0209257_10106713 | 242 |
| 307 | 3300025735 | Ga0207713_1005340 | Ga0207713_10053408 | 242 |
| 308 | 3300025900 | Ga0207710_10131147 | Ga0207710_101311472 | 242 |
| 309 | 3300025925 | Ga0207650_10001196 | Ga0207650_1000119610 | 242 |
| 310 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004495 | 242 |
| 311 | 3300025961 | Ga0207712_10000698 | Ga0207712_1000069827 | 242 |
| 312 | 3300025986 | Ga0207658_10000204 | Ga0207658_1000020454 | 242 |
| 313 | 3300026088 | Ga0207641_10000010 | Ga0207641_10000010147 | 242 |
| 314 | 3300026095 | Ga0207676_10000036 | Ga0207676_10000036189 | 242 |
| 315 | 3300028380 | Ga0268265_10000059 | Ga0268265_10000059142 | 242 |
| 316 | 3300032004 | Ga0307414_10000385 | Ga0307414_1000038511 | 242 |
| 317 | 3300041492 | Ga0451835_1202669 | Ga0451835_1202669_142_957 | 242 |
| 318 | 3300046501 | Ga0495607_0205784 | Ga0495607_0205784_18_764 | 242 |
| 319 | 3300046507 | Ga0495606_0004121 | Ga0495606_0004121_5939_6685 | 242 |
| 320 | 3300047472 | Ga0495686_0008101 | Ga0495686_0008101_243_989 | 242 |
| 321 | 3300048906 | Ga0496103_0095642 | Ga0496103_0095642_679_1491 | 242 |
| 322 | 3300048920 | Ga0496117_0008522 | Ga0496117_0008522_1219_1986 | 242 |
| 323 | 3300048921 | Ga0496118_0004712 | Ga0496118_0004712_1984_2751 | 242 |
| 324 | 3300049759 | Ga0501262_009969 | Ga0501262_009969_72_824 | 242 |
| 325 | 3300053122 | Ga0500608_074197 | Ga0500608_074197_712_1449 | 242 |
| 326 | 3300053134 | Ga0500658_0007510 | Ga0500658_0007510_1413_2162 | 242 |
| 327 | 3300053140 | Ga0500573_0000290 | Ga0500573_0000290_2330_3118 | 242 |
| 328 | 3300001979 | JGI24740J21852_10008715 | JGI24740J21852_100087153 | 243 |
| 329 | 3300001990 | JGI24737J22298_10003189 | JGI24737J22298_100031892 | 243 |
| 330 | 3300002067 | JGI24735J21928_10020502 | JGI24735J21928_100205022 | 243 |
| 331 | 3300002075 | JGI24738J21930_10002317 | JGI24738J21930_100023175 | 243 |
| 332 | 3300002774 | JGI25150J39212_1000368 | JGI25150J39212_10003684 | 243 |
| 333 | 3300003215 | JGI25153J46596_10000125 | JGI25153J46596_100001254 | 243 |
| 334 | 3300003773 | Ga0055537_1006643 | Ga0055537_10066432 | 243 |
| 335 | 3300003792 | Ga0055540_1000868 | Ga0055540_100086816 | 243 |
| 336 | 3300005339 | Ga0070660_100168337 | Ga0070660_1001683372 | 243 |
| 337 | 3300005344 | Ga0070661_100045987 | Ga0070661_1000459872 | 243 |
| 338 | 3300005457 | Ga0070662_100023558 | Ga0070662_1000235584 | 243 |
| 339 | 3300005539 | Ga0068853_100064987 | Ga0068853_1000649873 | 243 |
| 340 | 3300005577 | Ga0068857_100017504 | Ga0068857_1000175045 | 243 |
| 341 | 3300005578 | Ga0068854_100033417 | Ga0068854_1000334173 | 243 |
| 342 | 3300005617 | Ga0068859_100050596 | Ga0068859_1000505965 | 243 |
| 343 | 3300005834 | Ga0068851_10024998 | Ga0068851_100249982 | 243 |
| 344 | 3300005841 | Ga0068863_100000576 | Ga0068863_1000005763 | 243 |
| 345 | 3300005843 | Ga0068860_100000812 | Ga0068860_10000081215 | 243 |
| 346 | 3300005844 | Ga0068862_100000014 | Ga0068862_100000014204 | 243 |
| 347 | 3300006931 | Ga0097620_100050597 | Ga0097620_1000505975 | 243 |
| 348 | 3300009174 | Ga0105241_10026280 | Ga0105241_100262803 | 243 |
| 349 | 3300009177 | Ga0105248_10001383 | Ga0105248_1000138327 | 243 |
| 350 | 3300013100 | Ga0157373_10051049 | Ga0157373_100510492 | 243 |
| 351 | 3300013102 | Ga0157371_10015686 | Ga0157371_100156865 | 243 |
| 352 | 3300013104 | Ga0157370_10029953 | Ga0157370_100299535 | 243 |
| 353 | 3300013105 | Ga0157369_10179796 | Ga0157369_101797962 | 243 |
| 354 | 3300013297 | Ga0157378_10729746 | Ga0157378_107297461 | 243 |
| 355 | 3300013306 | Ga0163162_10364702 | Ga0163162_103647022 | 243 |
| 356 | 3300025245 | Ga0207425_1000461 | Ga0207425_10004614 | 243 |
| 357 | 3300025258 | Ga0209129_1000327 | Ga0209129_10003274 | 243 |
| 358 | 3300025263 | Ga0209565_1000052 | Ga0209565_1000052142 | 243 |
| 359 | 3300025263 | Ga0209565_1011046 | Ga0209565_10110463 | 243 |
| 360 | 3300025292 | Ga0209676_1008829 | Ga0209676_10088294 | 243 |
| 361 | 3300025294 | Ga0209025_1001791 | Ga0209025_100179119 | 243 |
| 362 | 3300025295 | Ga0209564_1011259 | Ga0209564_10112593 | 243 |
| 363 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002436 | 243 |
| 364 | 3300025297 | Ga0209758_1024549 | Ga0209758_10245493 | 243 |
| 365 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001382 | 243 |
| 366 | 3300025298 | Ga0209050_1016532 | Ga0209050_10165323 | 243 |
| 367 | 3300025303 | Ga0209051_1000297 | Ga0209051_100029752 | 243 |
| 368 | 3300025304 | Ga0209257_1001829 | Ga0209257_100182928 | 243 |
| 369 | 3300025304 | Ga0209257_1001894 | Ga0209257_100189427 | 243 |
| 370 | 3300025321 | Ga0207656_10038199 | Ga0207656_100381992 | 243 |
| 371 | 3300025900 | Ga0207710_10001905 | Ga0207710_100019053 | 243 |
| 372 | 3300025904 | Ga0207647_10000827 | Ga0207647_100008275 | 243 |
| 373 | 3300025911 | Ga0207654_10002585 | Ga0207654_1000258511 | 243 |
| 374 | 3300025919 | Ga0207657_10038998 | Ga0207657_100389983 | 243 |
| 375 | 3300025920 | Ga0207649_10403522 | Ga0207649_104035222 | 243 |
| 376 | 3300025933 | Ga0207706_10051465 | Ga0207706_100514653 | 243 |
| 377 | 3300025941 | Ga0207711_10003539 | Ga0207711_100035399 | 243 |
| 378 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002565 | 243 |
| 379 | 3300026041 | Ga0207639_10015396 | Ga0207639_100153963 | 243 |
| 380 | 3300026067 | Ga0207678_10026481 | Ga0207678_100264815 | 243 |
| 381 | 3300026078 | Ga0207702_10009802 | Ga0207702_1000980211 | 243 |
| 382 | 3300026088 | Ga0207641_10033992 | Ga0207641_100339923 | 243 |
| 383 | 3300026116 | Ga0207674_10050990 | Ga0207674_100509902 | 243 |
| 384 | 3300026142 | Ga0207698_10026383 | Ga0207698_100263832 | 243 |
| 385 | 3300028380 | Ga0268265_10000048 | Ga0268265_1000004873 | 243 |
| 386 | 3300028381 | Ga0268264_10000304 | Ga0268264_1000030482 | 243 |
| 387 | 3300031731 | Ga0307405_10000247 | Ga0307405_100002473 | 243 |
| 388 | 3300031731 | Ga0307405_10366242 | Ga0307405_103662421 | 243 |
| 389 | 3300031911 | Ga0307412_10001662 | Ga0307412_100016622 | 243 |
| 390 | 3300032004 | Ga0307414_10001045 | Ga0307414_1000104515 | 243 |
| 391 | 3300032126 | Ga0307415_100009603 | Ga0307415_1000096033 | 243 |
| 392 | 3300046460 | Ga0495638_0016633 | Ga0495638_0016633_743_1501 | 243 |
| 393 | 3300046506 | Ga0495583_0000577 | Ga0495583_0000577_22333_23097 | 243 |
| 394 | 3300048905 | Ga0496102_0045021 | Ga0496102_0045021_417_1175 | 243 |
| 395 | 3300049460 | Ga0495682_0025095 | Ga0495682_0025095_171_935 | 243 |
| 396 | 3300049679 | Ga0501249_000160 | Ga0501249_000160_419_1204 | 243 |
| 397 | 3300053087 | Ga0500643_000762 | Ga0500643_000762_15558_16304 | 243 |
| 398 | 3300053103 | Ga0500555_000457 | Ga0500555_000457_14352_15116 | 243 |
| 399 | 3300053136 | Ga0500559_0001835 | Ga0500559_0001835_7512_8258 | 243 |
| 400 | 3300053142 | Ga0500577_0043130 | Ga0500577_0043130_351_1115 | 243 |
| 401 | 3300055283 | Ga0500661_000186 | Ga0500661_000186_4037_4783 | 243 |
| 402 | iso_pu_bacteria | 2738541275 | 2738710566 | 243 |
| 403 | iso_pu_bacteria | 2738541301 | 2738848991 | 243 |
| 404 | iso_pu_bacteria | 2738541304 | 2738864720 | 243 |
| 405 | iso_pu_bacteria | 2738543022 | 2739297238 | 243 |
| 406 | iso_pu_bacteria | 2738543033 | 2739358916 | 243 |
| 407 | iso_pu_bacteria | 2928100450 | 2928100665 | 243 |
| 408 | iso_pu_bacteria | 2928959182 | 2928960728 | 243 |
| 409 | 2162886007 | SwRhRL2b_contig_335976 | SwRhRL2b_0456.00000060 | 244 |
| 410 | 3300003771 | Ga0055526_1003012 | Ga0055526_10030124 | 244 |
| 411 | 3300003781 | Ga0055536_1003782 | Ga0055536_10037827 | 244 |
| 412 | 3300003781 | Ga0055536_1012473 | Ga0055536_10124732 | 244 |
| 413 | 3300003791 | Ga0055530_10000116 | Ga0055530_100001169 | 244 |
| 414 | 3300003791 | Ga0055530_10014456 | Ga0055530_100144563 | 244 |
| 415 | 3300003794 | Ga0055531_10002417 | Ga0055531_100024179 | 244 |
| 416 | 3300003794 | Ga0055531_10004300 | Ga0055531_100043003 | 244 |
| 417 | 3300005548 | Ga0070665_100000043 | Ga0070665_10000004363 | 244 |
| 418 | 3300005548 | Ga0070665_100051178 | Ga0070665_1000511782 | 244 |
| 419 | 3300005578 | Ga0068854_100143836 | Ga0068854_1001438362 | 244 |
| 420 | 3300025291 | Ga0209675_1000697 | Ga0209675_100069718 | 244 |
| 421 | 3300025292 | Ga0209676_1000273 | Ga0209676_100027372 | 244 |
| 422 | 3300025292 | Ga0209676_1000402 | Ga0209676_100040230 | 244 |
| 423 | 3300025292 | Ga0209676_1025202 | Ga0209676_10252022 | 244 |
| 424 | 3300025294 | Ga0209025_1009722 | Ga0209025_10097224 | 244 |
| 425 | 3300025295 | Ga0209564_1000783 | Ga0209564_100078317 | 244 |
| 426 | 3300025298 | Ga0209050_1000218 | Ga0209050_1000218116 | 244 |
| 427 | 3300025298 | Ga0209050_1004400 | Ga0209050_10044005 | 244 |
| 428 | 3300025304 | Ga0209257_1000248 | Ga0209257_100024890 | 244 |
| 429 | 3300025304 | Ga0209257_1000435 | Ga0209257_100043559 | 244 |
| 430 | 3300025981 | Ga0207640_10038745 | Ga0207640_100387454 | 244 |
| 431 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002525 | 244 |
| 432 | 3300028379 | Ga0268266_10093046 | Ga0268266_100930462 | 244 |
| 433 | 3300031901 | Ga0307406_10221600 | Ga0307406_102216002 | 244 |
| 434 | 3300031911 | Ga0307412_10105728 | Ga0307412_101057281 | 244 |
| 435 | 3300038705 | Ga0237819_00318 | Ga0237819_00318_11580_12392 | 244 |
| 436 | 3300046492 | Ga0495585_0011753 | Ga0495585_0011753_2218_2967 | 244 |
| 437 | 3300046522 | Ga0495643_0008329 | Ga0495643_0008329_2499_3257 | 244 |
| 438 | 3300046530 | Ga0495654_0014488 | Ga0495654_0014488_1044_1814 | 244 |
| 439 | 3300046616 | Ga0495668_0014040 | Ga0495668_0014040_856_1626 | 244 |
| 440 | 3300046794 | Ga0495589_0045709 | Ga0495589_0045709_784_1554 | 244 |
| 441 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_124082_124837 | 244 |
| 442 | 3300048924 | Ga0496121_0000930 | Ga0496121_0000930_44263_45033 | 244 |
| 443 | 3300048924 | Ga0496121_0007335 | Ga0496121_0007335_10699_11442 | 244 |
| 444 | 3300048926 | Ga0496123_0198194 | Ga0496123_0198194_208_978 | 244 |
| 445 | 3300048927 | Ga0496124_0149312 | Ga0496124_0149312_941_1711 | 244 |
| 446 | 3300048928 | Ga0496125_0016914 | Ga0496125_0016914_3042_3812 | 244 |
| 447 | 3300048929 | Ga0496126_0450122 | Ga0496126_0450122_48_818 | 244 |
| 448 | 3300053139 | Ga0500568_0005400 | Ga0500568_0005400_3565_4320 | 244 |
| 449 | 3300053158 | Ga0500627_0007639 | Ga0500627_0007639_908_1678 | 244 |
| 450 | 3300053158 | Ga0500627_0124292 | Ga0500627_0124292_249_1004 | 244 |
| 451 | 3300001979 | JGI24740J21852_10075336 | JGI24740J21852_100753361 | 245 |
| 452 | 3300003215 | JGI25153J46596_10000417 | JGI25153J46596_100004174 | 245 |
| 453 | 3300005295 | Ga0065707_10082568 | Ga0065707_100825688 | 245 |
| 454 | 3300005456 | Ga0070678_100001925 | Ga0070678_10000192511 | 245 |
| 455 | 3300005543 | Ga0070672_100107543 | Ga0070672_1001075432 | 245 |
| 456 | 3300005834 | Ga0068851_10082183 | Ga0068851_100821832 | 245 |
| 457 | 3300005834 | Ga0068851_10090246 | Ga0068851_100902462 | 245 |
| 458 | 3300006358 | Ga0068871_100041930 | Ga0068871_1000419302 | 245 |
| 459 | 3300006881 | Ga0068865_100109827 | Ga0068865_1001098271 | 245 |
| 460 | 3300009148 | Ga0105243_10001659 | Ga0105243_1000165918 | 245 |
| 461 | 3300009176 | Ga0105242_10110929 | Ga0105242_101109293 | 245 |
| 462 | 3300021388 | Ga0213875_10000275 | Ga0213875_1000027520 | 245 |
| 463 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007663 | 245 |
| 464 | 3300025321 | Ga0207656_10002624 | Ga0207656_100026247 | 245 |
| 465 | 3300025920 | Ga0207649_10000581 | Ga0207649_1000058113 | 245 |
| 466 | 3300025934 | Ga0207686_10174831 | Ga0207686_101748312 | 245 |
| 467 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005409 | 245 |
| 468 | 3300025937 | Ga0207669_10004814 | Ga0207669_100048144 | 245 |
| 469 | 3300025938 | Ga0207704_10109125 | Ga0207704_101091251 | 245 |
| 470 | 3300025940 | Ga0207691_10114164 | Ga0207691_101141643 | 245 |
| 471 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001901 | 245 |
| 472 | 3300025960 | Ga0207651_10387169 | Ga0207651_103871691 | 245 |
| 473 | 3300026041 | Ga0207639_10001947 | Ga0207639_100019475 | 245 |
| 474 | 3300026116 | Ga0207674_10015757 | Ga0207674_100157577 | 245 |
| 475 | 3300026121 | Ga0207683_10005199 | Ga0207683_100051994 | 245 |
| 476 | 3300037853 | Ga0436364_0011659 | Ga0436364_0011659_65738_66490 | 245 |
| 477 | 3300039437 | Ga0436365_1863835 | Ga0436365_1863835_1553_2305 | 245 |
| 478 | 3300046460 | Ga0495638_0000305 | Ga0495638_0000305_1938_2741 | 245 |
| 479 | 3300046506 | Ga0495583_0014239 | Ga0495583_0014239_1607_2377 | 245 |
| 480 | 3300046507 | Ga0495606_0033365 | Ga0495606_0033365_482_1252 | 245 |
| 481 | 3300046518 | Ga0495631_0023320 | Ga0495631_0023320_261_1031 | 245 |
| 482 | 3300046519 | Ga0495632_0002181 | Ga0495632_0002181_1922_2725 | 245 |
| 483 | 3300046520 | Ga0495637_0016118 | Ga0495637_0016118_1570_2340 | 245 |
| 484 | 3300046522 | Ga0495643_0030205 | Ga0495643_0030205_2160_2930 | 245 |
| 485 | 3300046524 | Ga0495648_0000235 | Ga0495648_0000235_60729_61532 | 245 |
| 486 | 3300046530 | Ga0495654_0020498 | Ga0495654_0020498_2442_3203 | 245 |
| 487 | 3300046542 | Ga0495597_0008403 | Ga0495597_0008403_2057_2827 | 245 |
| 488 | 3300046615 | Ga0495656_0189088 | Ga0495656_0189088_174_977 | 245 |
| 489 | 3300046616 | Ga0495668_0000087 | Ga0495668_0000087_89061_89822 | 245 |
| 490 | 3300046616 | Ga0495668_0000149 | Ga0495668_0000149_101240_102010 | 245 |
| 491 | 3300046616 | Ga0495668_0004609 | Ga0495668_0004609_3749_4561 | 245 |
| 492 | 3300046660 | Ga0495625_0000866 | Ga0495625_0000866_39129_39878 | 245 |
| 493 | 3300046660 | Ga0495625_0022727 | Ga0495625_0022727_1956_2726 | 245 |
| 494 | 3300046684 | Ga0495669_0002611 | Ga0495669_0002611_4475_5245 | 245 |
| 495 | 3300046692 | Ga0495671_0000020 | Ga0495671_0000020_207417_208220 | 245 |
| 496 | 3300046694 | Ga0495649_0105681 | Ga0495649_0105681_201_971 | 245 |
| 497 | 3300047443 | Ga0495687_000123 | Ga0495687_000123_115456_116226 | 245 |
| 498 | 3300047443 | Ga0495687_001696 | Ga0495687_001696_6052_6816 | 245 |
| 499 | 3300047469 | Ga0495673_0000316 | Ga0495673_0000316_60087_60890 | 245 |
| 500 | 3300048903 | Ga0496100_0022075 | Ga0496100_0022075_703_1482 | 245 |
| 501 | 3300048916 | Ga0496113_0017200 | Ga0496113_0017200_3084_3899 | 245 |
| 502 | 3300048926 | Ga0496123_0013924 | Ga0496123_0013924_2821_3636 | 245 |
| 503 | 3300048926 | Ga0496123_0027459 | Ga0496123_0027459_3283_4047 | 245 |
| 504 | 3300048928 | Ga0496125_0003122 | Ga0496125_0003122_15346_16161 | 245 |
| 505 | 3300048928 | Ga0496125_0111384 | Ga0496125_0111384_955_1731 | 245 |
| 506 | 3300049569 | Ga0501032_0062396 | Ga0501032_0062396_1561_2331 | 245 |
| 507 | 3300049571 | Ga0501034_0169312 | Ga0501034_0169312_1302_2063 | 245 |
| 508 | 3300049572 | Ga0501036_0028848 | Ga0501036_0028848_493_1254 | 245 |
| 509 | 3300049573 | Ga0501037_0033692 | Ga0501037_0033692_966_1727 | 245 |
| 510 | 3300049575 | Ga0501039_0102891 | Ga0501039_0102891_187_948 | 245 |
| 511 | 3300049582 | Ga0501048_0068987 | Ga0501048_0068987_1343_2104 | 245 |
| 512 | 3300049822 | Ga0501035_0330462 | Ga0501035_0330462_58_816 | 245 |
| 513 | 3300049823 | Ga0501044_0022440 | Ga0501044_0022440_1920_2681 | 245 |
| 514 | 3300053087 | Ga0500643_024575 | Ga0500643_024575_499_1275 | 245 |
| 515 | 3300053125 | Ga0500618_012028 | Ga0500618_012028_1030_1806 | 245 |
| 516 | 3300053134 | Ga0500658_0026087 | Ga0500658_0026087_415_1176 | 245 |
| 517 | 3300053151 | Ga0500604_0006284 | Ga0500604_0006284_811_1623 | 245 |
| 518 | 3300053157 | Ga0500624_000100 | Ga0500624_000100_5030_5806 | 245 |
| 519 | 3300053158 | Ga0500627_0000013 | Ga0500627_0000013_2439_3200 | 245 |
| 520 | 3300053158 | Ga0500627_0000446 | Ga0500627_0000446_1559_2371 | 245 |
| 521 | 3300053177 | Ga0500636_0101442 | Ga0500636_0101442_639_1415 | 245 |
| 522 | iso_pu_bacteria | 2882806704 | 2882809190 | 246 |
| 523 | 2162886007 | SwRhRL2b_contig_2722016 | SwRhRL2b_0191.00007400 | 247 |
| 524 | 3300005335 | Ga0070666_10041861 | Ga0070666_100418613 | 247 |
| 525 | 3300005347 | Ga0070668_100009037 | Ga0070668_1000090375 | 247 |
| 526 | 3300005353 | Ga0070669_100000074 | Ga0070669_10000007453 | 247 |
| 527 | 3300005355 | Ga0070671_100000375 | Ga0070671_1000003757 | 247 |
| 528 | 3300005367 | Ga0070667_100001796 | Ga0070667_1000017965 | 247 |
| 529 | 3300005548 | Ga0070665_100001089 | Ga0070665_1000010897 | 247 |
| 530 | 3300005843 | Ga0068860_100006579 | Ga0068860_1000065795 | 247 |
| 531 | 3300005844 | Ga0068862_100040562 | Ga0068862_1000405623 | 247 |
| 532 | 3300009092 | Ga0105250_10039071 | Ga0105250_100390712 | 247 |
| 533 | 3300009101 | Ga0105247_10000692 | Ga0105247_1000069214 | 247 |
| 534 | 3300009177 | Ga0105248_10045094 | Ga0105248_100450943 | 247 |
| 535 | 3300009553 | Ga0105249_10000002 | Ga0105249_10000002193 | 247 |
| 536 | 3300009553 | Ga0105249_10020736 | Ga0105249_100207363 | 247 |
| 537 | 3300013306 | Ga0163162_10051898 | Ga0163162_100518983 | 247 |
| 538 | 3300014326 | Ga0157380_10142985 | Ga0157380_101429853 | 247 |
| 539 | 3300025711 | Ga0207696_1001635 | Ga0207696_100163511 | 247 |
| 540 | 3300025735 | Ga0207713_1004070 | Ga0207713_10040705 | 247 |
| 541 | 3300025903 | Ga0207680_10020408 | Ga0207680_100204084 | 247 |
| 542 | 3300025923 | Ga0207681_10000120 | Ga0207681_100001207 | 247 |
| 543 | 3300025931 | Ga0207644_10021517 | Ga0207644_100215175 | 247 |
| 544 | 3300025941 | Ga0207711_10017110 | Ga0207711_100171104 | 247 |
| 545 | 3300025972 | Ga0207668_10000148 | Ga0207668_1000014842 | 247 |
| 546 | 3300025986 | Ga0207658_10000288 | Ga0207658_1000028833 | 247 |
| 547 | 3300026088 | Ga0207641_10481440 | Ga0207641_104814402 | 247 |
| 548 | 3300028379 | Ga0268266_10002543 | Ga0268266_1000254317 | 247 |
| 549 | 3300028380 | Ga0268265_10013242 | Ga0268265_100132423 | 247 |
| 550 | 3300028381 | Ga0268264_10004589 | Ga0268264_100045895 | 247 |
| 551 | 3300046500 | Ga0495596_0048300 | Ga0495596_0048300_362_1141 | 247 |
| 552 | 3300046506 | Ga0495583_0004928 | Ga0495583_0004928_3780_4607 | 247 |
| 553 | 3300046506 | Ga0495583_0045880 | Ga0495583_0045880_614_1393 | 247 |
| 554 | 3300046507 | Ga0495606_0025574 | Ga0495606_0025574_2307_3107 | 247 |
| 555 | 3300047472 | Ga0495686_0000177 | Ga0495686_0000177_119755_120561 | 247 |
| 556 | 3300048903 | Ga0496100_0008083 | Ga0496100_0008083_661_1404 | 247 |
| 557 | 3300048904 | Ga0496101_0159852 | Ga0496101_0159852_238_981 | 247 |
| 558 | 3300048905 | Ga0496102_0000209 | Ga0496102_0000209_46390_47133 | 247 |
| 559 | 3300048906 | Ga0496103_0000136 | Ga0496103_0000136_53521_54264 | 247 |
| 560 | 3300048907 | Ga0496104_0006964 | Ga0496104_0006964_8249_8992 | 247 |
| 561 | 3300048910 | Ga0496107_0032124 | Ga0496107_0032124_1598_2341 | 247 |
| 562 | 3300048914 | Ga0496111_0074968 | Ga0496111_0074968_70_813 | 247 |
| 563 | 3300048915 | Ga0496112_0010410 | Ga0496112_0010410_5822_6565 | 247 |
| 564 | 3300048916 | Ga0496113_0017296 | Ga0496113_0017296_1621_2364 | 247 |
| 565 | 3300048918 | Ga0496115_0091666 | Ga0496115_0091666_690_1433 | 247 |
| 566 | 3300048920 | Ga0496117_0000526 | Ga0496117_0000526_15544_16287 | 247 |
| 567 | 3300048921 | Ga0496118_0003002 | Ga0496118_0003002_10576_11319 | 247 |
| 568 | 3300048922 | Ga0496119_0017934 | Ga0496119_0017934_978_1721 | 247 |
| 569 | 3300048923 | Ga0496120_0100892 | Ga0496120_0100892_509_1252 | 247 |
| 570 | 3300048924 | Ga0496121_0006990 | Ga0496121_0006990_12409_13152 | 247 |
| 571 | 3300048927 | Ga0496124_0046207 | Ga0496124_0046207_2578_3321 | 247 |
| 572 | 3300048928 | Ga0496125_0025212 | Ga0496125_0025212_4471_5214 | 247 |
| 573 | 3300048929 | Ga0496126_0000365 | Ga0496126_0000365_32520_33263 | 247 |
| 574 | 3300053735 | Ga0500596_001300 | Ga0500596_001300_4219_5031 | 247 |
| 575 | 3300055283 | Ga0500661_015365 | Ga0500661_015365_439_1251 | 247 |
| 576 | iso_pu_bacteria | 2643221560 | 2643820046 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7v3z-assembly1.cif.gz_A | structure of cannabinoid receptor type 1(cb1) | 0.2729 | 1 | 188 |
| 8pnl-assembly1.cif.gz_A | outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody | 0.2709 | 1 | 195 |
| 6kp6-assembly1.cif.gz_A | the structural study of mutation induced inactivation of human muscarinic receptor m4 | 0.2641 | 9 | 157 |
| 7uwa-assembly1.cif.gz_j | citrus v-atpase state 1, h in contact with subunits ab | 0.253 | 11 | 186 |
| 4amj-assembly1.cif.gz_A | turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist carvedilol | 0.2378 | 5 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAA7_285_416_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3796 | 1 | 175 | 1.20.1070.10 |
| af_P0AAA7_285_416_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3675 | 1 | 175 | 1.20.1070.10 |
| af_Q9VFE3_49_209_1.20.120.610 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);lithium bound rotor ring of v- atpase | 0.2895 | 5 | 186 | 1.20.120.610 |
| af_Q9VFE3_49_209_1.20.120.610 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);lithium bound rotor ring of v- atpase | 0.2702 | 5 | 186 | 1.20.120.610 |
| af_B0R167_7_318_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2506 | 1 | 184 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E1YYS1-F1-model_v4 | deleted | 0.9866 | 8 | 173 |
|
| AF-A0A085K306-F1-model_v4 | deleted | 0.9709 | 6 | 196 |
|
| AF-A0A258HXE0-F1-model_v4 | Sterol desaturase | 0.9698 | 7 | 235 |
GO:0005506
GO:0008610 GO:0016020 GO:0016491 |
| AF-A0A520JDM5-F1-model_v4 | Fatty acid hydroxylase family protein | 0.9659 | 8 | 239 |
GO:0005506
GO:0008610 GO:0016020 GO:0016491 |
| AF-A0A2A4I489-F1-model_v4 | Sterol desaturase | 0.965 | 8 | 239 |
GO:0005506
GO:0008610 GO:0016020 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar