F465500

General Info

Members Datasets Scaffolds Average Seq Length
576 297 552 251

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10000692|Ga0105247_1000069214
Length 298
Sequence MKRLAWQMAQRVGRTQPRCWLAAGFGRKAGRVTMLAAIALSALAMTLIVGVRYLLASGGFAWATRLRHPGLYASLAGQIRREIGWSLASAAIYGVPAGIVAWGWQNRGWTSIYSDVADYPLWWLPLSVLVCLFLHDTWFYWTHRWMHRPAPFRLAHAVHHASRPPTAWAAMSFHPIEALTGAVVIPALVFVVPIHVGALALVLTIMTIMGVTNHMGWEMFPQAIVRGALGRWLITASHHQRHHEQYRCNYGLYFRFWDRVCETDRGLGSFDPSGGDRPIGAGNARAGGAAGRGADRVG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
14 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
15 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
16 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
17 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
18 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
21 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
22 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
23 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
24 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
25 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
263 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
296 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
297 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 19.27
Nodule 0.52
Rhizoplane 3.65
Rhizosphere 66.15
Stem 0
Stem Tuber 0
Unclassified 10.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2722016 2162886007 Bacteria 2634
2 SwRhRL2b_contig_335976 2162886007 Bacteria 7116
3 JGI24741J21665_1000134 3300001915 Bacteria 20329
4 JGI24740J21852_10008715 3300001979 Bacteria 4026
5 JGI24740J21852_10075336 3300001979 Bacteria 894
6 JGI24739J22299_10074127 3300001989 Bacteria 1055
7 JGI24737J22298_10003189 3300001990 Bacteria 5817
8 JGI24735J21928_10020502 3300002067 Bacteria 2024
9 JGI24738J21930_10002317 3300002075 Bacteria 5026
10 JGI24738J21930_10002792 3300002075 Bacteria 4485
11 JGI24738J21930_10041385 3300002075 Bacteria 936
12 JGI25150J39212_1000368 3300002774 Bacteria 21777
13 JGI25153J46596_10000125 3300003215 Bacteria 86065
14 JGI25153J46596_10000417 3300003215 Bacteria 27933
15 Ga0055529_1000004 3300003763 Bacteria 433331
16 Ga0055526_1003012 3300003771 Bacteria 10997
17 Ga0055537_1006643 3300003773 Bacteria 2901
18 Ga0055536_1003782 3300003781 Bacteria 7987
19 Ga0055536_1003805 3300003781 Bacteria 7956
20 Ga0055536_1012473 3300003781 Bacteria 3151
21 Ga0055530_10000116 3300003791 Bacteria 69428
22 Ga0055530_10014456 3300003791 Bacteria 2627
23 Ga0055540_1000868 3300003792 Bacteria 20036
24 Ga0055531_10002417 3300003794 Bacteria 12515
25 Ga0055531_10004300 3300003794 Bacteria 8731
26 Ga0055543_1021546 3300004625 Bacteria 1175
27 Ga0065165_1001363 3300005262 Bacteria 26928
28 Ga0065704_10009557 3300005289 Bacteria 3440
29 Ga0065704_10110538 3300005289 Bacteria 1978
30 Ga0065704_10356200 3300005289 Bacteria 803
31 Ga0065707_10082568 3300005295 Bacteria 13691
32 Ga0065707_10152119 3300005295 Bacteria 1647
33 Ga0070670_100001449 3300005331 Bacteria 19056
34 Ga0070666_10000171 3300005335 Bacteria 44565
35 Ga0070666_10041861 3300005335 Bacteria 3062
36 Ga0070660_100019269 3300005339 Bacteria 4996
37 Ga0070660_100168337 3300005339 Bacteria 1769
38 Ga0070661_100007098 3300005344 Bacteria 7726
39 Ga0070661_100045987 3300005344 Bacteria 3192
40 Ga0070661_100059975 3300005344 Bacteria 2791
41 Ga0070668_100009037 3300005347 Bacteria 7401
42 Ga0070668_100122054 3300005347 Bacteria 2084
43 Ga0070668_100219876 3300005347 Bacteria 1566
44 Ga0070669_100000001 3300005353 Bacteria 537589
45 Ga0070669_100000074 3300005353 Bacteria 99054
46 Ga0070669_100098547 3300005353 Bacteria 2202
47 Ga0070671_100000007 3300005355 Bacteria 250397
48 Ga0070671_100000375 3300005355 Bacteria 30813
49 Ga0070671_100109302 3300005355 Bacteria 2322
50 Ga0070671_100229882 3300005355 Bacteria 1574
51 Ga0070671_100651257 3300005355 Bacteria 912
52 Ga0070674_100019515 3300005356 Bacteria 4307
53 Ga0070674_100036673 3300005356 Bacteria 3293
54 Ga0070659_100069566 3300005366 Bacteria 2794
55 Ga0070667_100001796 3300005367 Bacteria 19107
56 Ga0070667_100001949 3300005367 Bacteria 18314
57 Ga0070667_100005338 3300005367 Bacteria 10733
58 Ga0070705_100014227 3300005440 Bacteria 4089
59 Ga0070663_100009092 3300005455 Bacteria 6139
60 Ga0070663_100035804 3300005455 Bacteria 3446
61 Ga0070663_100213728 3300005455 Bacteria 1511
62 Ga0070678_100001925 3300005456 Bacteria 11196
63 Ga0070662_100023558 3300005457 Bacteria 4230
64 Ga0070662_100114749 3300005457 Bacteria 2057
65 Ga0068853_100064987 3300005539 Bacteria 3165
66 Ga0070672_100107543 3300005543 Bacteria 2270
67 Ga0070665_100000043 3300005548 Bacteria 279774
68 Ga0070665_100001089 3300005548 Bacteria 33704
69 Ga0070665_100051178 3300005548 Bacteria 4143
70 Ga0070665_100359317 3300005548 Bacteria 1462
71 Ga0068855_100032329 3300005563 Bacteria 6248
72 Ga0070664_100089279 3300005564 Bacteria 2666
73 Ga0068857_100017504 3300005577 Bacteria 6281
74 Ga0068857_100163514 3300005577 Bacteria 2020
75 Ga0068857_100252983 3300005577 Bacteria 1615
76 Ga0068857_100423782 3300005577 Bacteria 1241
77 Ga0068857_100454190 3300005577 Bacteria 1198
78 Ga0068854_100014593 3300005578 Bacteria 5183
79 Ga0068854_100033417 3300005578 Bacteria 3586
80 Ga0068854_100056864 3300005578 Bacteria 2820
81 Ga0068854_100143836 3300005578 Bacteria 1833
82 Ga0068854_100218245 3300005578 Bacteria 1507
83 Ga0068854_100230896 3300005578 Bacteria 1468
84 Ga0068854_100467580 3300005578 Bacteria 1056
85 Ga0068856_100072957 3300005614 Bacteria 3398
86 Ga0068852_100002899 3300005616 Bacteria 11907
87 Ga0068852_100016319 3300005616 Bacteria 5787
88 Ga0068859_100004071 3300005617 Bacteria 14916
89 Ga0068859_100050596 3300005617 Bacteria 4174
90 Ga0068864_100000332 3300005618 Bacteria 41671
91 Ga0068861_100002527 3300005719 Bacteria 11948
92 Ga0068861_100279042 3300005719 Bacteria 1438
93 Ga0068851_10024998 3300005834 Bacteria 2927
94 Ga0068851_10082183 3300005834 Bacteria 1684
95 Ga0068851_10090246 3300005834 Bacteria 1612
96 Ga0068851_10128028 3300005834 Bacteria 1370
97 Ga0068863_100000456 3300005841 Bacteria 41671
98 Ga0068863_100000576 3300005841 Bacteria 37385
99 Ga0068863_100016644 3300005841 Bacteria 7055
100 Ga0068863_100021575 3300005841 Bacteria 6143
101 Ga0068858_100001300 3300005842 Bacteria 25802
102 Ga0068860_100000812 3300005843 Bacteria 34919
103 Ga0068860_100002492 3300005843 Bacteria 19316
104 Ga0068860_100006579 3300005843 Bacteria 11669
105 Ga0068862_100000014 3300005844 Bacteria 251552
106 Ga0068862_100000468 3300005844 Bacteria 43578
107 Ga0068862_100000506 3300005844 Bacteria 41538
108 Ga0068862_100040562 3300005844 Bacteria 3957
109 Ga0081455_10000212 3300005937 Bacteria 74448
110 Ga0075365_10026950 3300006038 Bacteria 3652
111 Ga0075363_100005299 3300006048 Bacteria 5724
112 Ga0075364_10023905 3300006051 Bacteria 3873
113 Ga0075362_10002346 3300006177 Bacteria 6334
114 Ga0075367_10119336 3300006178 Bacteria 1624
115 Ga0075369_10002985 3300006186 Bacteria 6115
116 Ga0075366_10063719 3300006195 Bacteria 2191
117 Ga0075370_10026188 3300006353 Bacteria 3230
118 Ga0075370_10166011 3300006353 Bacteria 1297
119 Ga0075370_10243458 3300006353 Bacteria 1065
120 Ga0068871_100041930 3300006358 Bacteria 3672
121 Ga0068865_100109827 3300006881 Bacteria 2033
122 Ga0097620_100001427 3300006931 Bacteria 24232
123 Ga0097620_100004071 3300006931 Bacteria 14916
124 Ga0097620_100050597 3300006931 Bacteria 4174
125 Ga0079104_1019271 3300006946 Bacteria 1911
126 Ga0079104_1019976 3300006946 Bacteria 1857
127 Ga0105251_10001184 3300009011 Bacteria 22581
128 Ga0105250_10039071 3300009092 Bacteria 1903
129 Ga0105240_10030797 3300009093 Bacteria 6970
130 Ga0105240_10504950 3300009093 Bacteria 1344
131 Ga0105240_10694735 3300009093 Bacteria 1111
132 Ga0111539_10305752 3300009094 Bacteria 1850
133 Ga0105247_10000692 3300009101 Bacteria 26532
134 Ga0105247_10010362 3300009101 Bacteria 5637
135 Ga0105247_10078338 3300009101 Bacteria 2079
136 Ga0105243_10001659 3300009148 Bacteria 19274
137 Ga0105241_10008499 3300009174 Bacteria 7549
138 Ga0105241_10026280 3300009174 Bacteria 4330
139 Ga0105241_10135279 3300009174 Bacteria 2000
140 Ga0105242_10110929 3300009176 Bacteria 2338
141 Ga0105248_10000029 3300009177 Bacteria 223366
142 Ga0105248_10001383 3300009177 Bacteria 27020
143 Ga0105248_10008190 3300009177 Bacteria 11482
144 Ga0105248_10038528 3300009177 Bacteria 5350
145 Ga0105248_10045094 3300009177 Bacteria 4944
146 Ga0105248_10076006 3300009177 Bacteria 3775
147 Ga0105237_10006917 3300009545 Bacteria 12510
148 Ga0105237_10025829 3300009545 Bacteria 6005
149 Ga0105237_10405037 3300009545 Bacteria 1369
150 Ga0105238_10092201 3300009551 Bacteria 3017
151 Ga0105238_10118462 3300009551 Bacteria 2628
152 Ga0105238_10253956 3300009551 Bacteria 1737
153 Ga0105238_10938384 3300009551 Bacteria 885
154 Ga0105249_10000002 3300009553 Bacteria 376207
155 Ga0105249_10000928 3300009553 Bacteria 25902
156 Ga0105249_10020736 3300009553 Bacteria 5877
157 Ga0105148_100181 3300009978 Bacteria 9284
158 Ga0105239_10000271 3300010375 Bacteria 76812
159 Ga0105239_10139232 3300010375 Bacteria 2703
160 Ga0105239_10372014 3300010375 Bacteria 1615
161 Ga0157373_10028324 3300013100 Bacteria 4041
162 Ga0157373_10051049 3300013100 Bacteria 2945
163 Ga0157373_10079994 3300013100 Bacteria 2305
164 Ga0157371_10001885 3300013102 Bacteria 20989
165 Ga0157371_10015686 3300013102 Bacteria 5673
166 Ga0157370_10029953 3300013104 Bacteria 5334
167 Ga0157370_10094115 3300013104 Bacteria 2812
168 Ga0157369_10115718 3300013105 Bacteria 2848
169 Ga0157369_10179796 3300013105 Bacteria 2226
170 Ga0157369_10465719 3300013105 Bacteria 1308
171 Ga0157378_10729746 3300013297 Bacteria 1012
172 Ga0163162_10002088 3300013306 Bacteria 18765
173 Ga0163162_10051898 3300013306 Bacteria 4116
174 Ga0163162_10121046 3300013306 Bacteria 2722
175 Ga0163162_10364702 3300013306 Bacteria 1577
176 Ga0157380_10000945 3300014326 Bacteria 18395
177 Ga0157380_10142985 3300014326 Bacteria 2058
178 Ga0157379_10014026 3300014968 Bacteria 7022
179 Ga0213875_10000275 3300021388 Bacteria 50853
180 Ga0207425_1000461 3300025245 Bacteria 26109
181 Ga0209148_1000008 3300025254 Bacteria 1504371
182 Ga0209129_1000327 3300025258 Bacteria 41506
183 Ga0209565_1000052 3300025263 Bacteria 212056
184 Ga0209565_1011046 3300025263 Bacteria 2215
185 Ga0209455_1000002 3300025272 Bacteria 1505459
186 Ga0207673_1005823 3300025290 Bacteria 1513
187 Ga0209675_1000697 3300025291 Bacteria 23309
188 Ga0209676_1000273 3300025292 Bacteria 107724
189 Ga0209676_1000402 3300025292 Bacteria 78796
190 Ga0209676_1001476 3300025292 Bacteria 21761
191 Ga0209676_1008829 3300025292 Bacteria 4434
192 Ga0209676_1025202 3300025292 Bacteria 1912
193 Ga0209676_1027946 3300025292 Bacteria 1766
194 Ga0209025_1001791 3300025294 Bacteria 25501
195 Ga0209025_1009722 3300025294 Bacteria 6647
196 Ga0209025_1025385 3300025294 Bacteria 3018
197 Ga0209564_1000783 3300025295 Bacteria 44071
198 Ga0209564_1011259 3300025295 Bacteria 4025
199 Ga0209758_1000002 3300025297 Bacteria 1400310
200 Ga0209758_1000007 3300025297 Bacteria 1270410
201 Ga0209758_1024549 3300025297 Bacteria 2683
202 Ga0209050_1000001 3300025298 Bacteria 3563507
203 Ga0209050_1000218 3300025298 Bacteria 128776
204 Ga0209050_1004400 3300025298 Bacteria 9547
205 Ga0209050_1016532 3300025298 Bacteria 3011
206 Ga0209051_1000297 3300025303 Bacteria 79062
207 Ga0209257_1000248 3300025304 Bacteria 125170
208 Ga0209257_1000435 3300025304 Bacteria 80311
209 Ga0209257_1001829 3300025304 Bacteria 23270
210 Ga0209257_1001894 3300025304 Bacteria 22612
211 Ga0209257_1010671 3300025304 Bacteria 4592
212 Ga0207697_10001100 3300025315 Bacteria 14913
213 Ga0207697_10029516 3300025315 Bacteria 2244
214 Ga0207656_10002624 3300025321 Bacteria 6081
215 Ga0207656_10038199 3300025321 Bacteria 2024
216 Ga0207696_1001635 3300025711 Bacteria 11807
217 Ga0207713_1004070 3300025735 Bacteria 9645
218 Ga0207713_1005340 3300025735 Bacteria 8065
219 Ga0207710_10001905 3300025900 Bacteria 10001
220 Ga0207710_10131147 3300025900 Bacteria 1204
221 Ga0207688_10027358 3300025901 Bacteria 3137
222 Ga0207680_10001461 3300025903 Bacteria 11187
223 Ga0207680_10020408 3300025903 Bacteria 3566
224 Ga0207647_10000827 3300025904 Bacteria 24036
225 Ga0207647_10002249 3300025904 Bacteria 14712
226 Ga0207647_10065178 3300025904 Bacteria 2212
227 Ga0207705_10000007 3300025909 Bacteria 597387
228 Ga0207705_10559300 3300025909 Bacteria 889
229 Ga0207654_10000914 3300025911 Bacteria 16324
230 Ga0207654_10002585 3300025911 Bacteria 9189
231 Ga0207695_10001471 3300025913 Bacteria 39463
232 Ga0207695_10005114 3300025913 Bacteria 17565
233 Ga0207695_10060765 3300025913 Bacteria 3910
234 Ga0207695_10088266 3300025913 Bacteria 3122
235 Ga0207695_10431579 3300025913 Bacteria 1201
236 Ga0207671_10001194 3300025914 Bacteria 30831
237 Ga0207657_10030816 3300025919 Bacteria 4862
238 Ga0207657_10038998 3300025919 Bacteria 4224
239 Ga0207649_10000581 3300025920 Bacteria 25005
240 Ga0207649_10403522 3300025920 Bacteria 1023
241 Ga0207646_10360779 3300025922 Bacteria 1313
242 Ga0207681_10000002 3300025923 Bacteria 985597
243 Ga0207681_10000120 3300025923 Bacteria 66235
244 Ga0207681_10394056 3300025923 Bacteria 1117
245 Ga0207694_10094666 3300025924 Bacteria 2360
246 Ga0207694_10249374 3300025924 Bacteria 1452
247 Ga0207650_10001196 3300025925 Bacteria 19063
248 Ga0207644_10000002 3300025931 Bacteria 942221
249 Ga0207644_10021517 3300025931 Bacteria 4394
250 Ga0207644_10074468 3300025931 Bacteria 2492
251 Ga0207690_10047872 3300025932 Bacteria 2839
252 Ga0207706_10051465 3300025933 Bacteria 3637
253 Ga0207706_10078008 3300025933 Bacteria 2913
254 Ga0207686_10174831 3300025934 Bacteria 1517
255 Ga0207709_10000005 3300025935 Bacteria 806813
256 Ga0207669_10004814 3300025937 Bacteria 5991
257 Ga0207669_10094352 3300025937 Bacteria 1957
258 Ga0207704_10109125 3300025938 Bacteria 1866
259 Ga0207691_10114164 3300025940 Bacteria 2400
260 Ga0207711_10000004 3300025941 Bacteria 870636
261 Ga0207711_10000504 3300025941 Bacteria 40316
262 Ga0207711_10003539 3300025941 Bacteria 13523
263 Ga0207711_10012342 3300025941 Bacteria 7100
264 Ga0207711_10017110 3300025941 Bacteria 6022
265 Ga0207711_10117061 3300025941 Bacteria 2376
266 Ga0207667_10000001 3300025949 Bacteria 1178522
267 Ga0207667_10017581 3300025949 Bacteria 8041
268 Ga0207667_10040850 3300025949 Bacteria 4936
269 Ga0207651_10387169 3300025960 Bacteria 1186
270 Ga0207712_10000002 3300025961 Bacteria 706628
271 Ga0207712_10000698 3300025961 Bacteria 25902
272 Ga0207712_10010207 3300025961 Bacteria 5954
273 Ga0207668_10000148 3300025972 Bacteria 48267
274 Ga0207668_10218324 3300025972 Bacteria 1529
275 Ga0207668_10450536 3300025972 Bacteria 1098
276 Ga0207640_10008005 3300025981 Bacteria 5839
277 Ga0207640_10038745 3300025981 Bacteria 3011
278 Ga0207658_10000204 3300025986 Bacteria 61702
279 Ga0207658_10000288 3300025986 Bacteria 52709
280 Ga0207658_10488053 3300025986 Bacteria 1096
281 Ga0207703_10000901 3300026035 Bacteria 29064
282 Ga0207703_10004612 3300026035 Bacteria 11272
283 Ga0207703_10201266 3300026035 Bacteria 1770
284 Ga0207639_10001947 3300026041 Bacteria 13862
285 Ga0207639_10006831 3300026041 Bacteria 7770
286 Ga0207639_10015396 3300026041 Bacteria 5397
287 Ga0207639_10525031 3300026041 Bacteria 1084
288 Ga0207678_10000067 3300026067 Bacteria 81673
289 Ga0207678_10015135 3300026067 Bacteria 6786
290 Ga0207678_10026481 3300026067 Bacteria 5058
291 Ga0207702_10009802 3300026078 Bacteria 8034
292 Ga0207702_10014551 3300026078 Bacteria 6528
293 Ga0207702_10019024 3300026078 Bacteria 5682
294 Ga0207702_10043739 3300026078 Bacteria 3762
295 Ga0207641_10000010 3300026088 Bacteria 402193
296 Ga0207641_10028169 3300026088 Bacteria 4640
297 Ga0207641_10033992 3300026088 Bacteria 4238
298 Ga0207641_10481440 3300026088 Bacteria 1203
299 Ga0207676_10000036 3300026095 Bacteria 198447
300 Ga0207676_10000169 3300026095 Bacteria 57208
301 Ga0207674_10015757 3300026116 Bacteria 8292
302 Ga0207674_10050990 3300026116 Bacteria 4224
303 Ga0207674_10055955 3300026116 Bacteria 4007
304 Ga0207674_10062778 3300026116 Bacteria 3752
305 Ga0207674_10083546 3300026116 Bacteria 3193
306 Ga0207675_100005628 3300026118 Bacteria 11998
307 Ga0207683_10005199 3300026121 Bacteria 11175
308 Ga0207698_10000098 3300026142 Bacteria 55118
309 Ga0207698_10004109 3300026142 Bacteria 8840
310 Ga0207698_10026383 3300026142 Bacteria 4109
311 Ga0209281_1031202 3300027111 Bacteria 951
312 Ga0209813_10000027 3300027866 Bacteria 69637
313 Ga0209813_10000345 3300027866 Bacteria 11916
314 Ga0268266_10000002 3300028379 Bacteria 3059047
315 Ga0268266_10002543 3300028379 Bacteria 19369
316 Ga0268266_10093046 3300028379 Bacteria 2645
317 Ga0268266_10315174 3300028379 Bacteria 1462
318 Ga0268265_10000048 3300028380 Bacteria 178523
319 Ga0268265_10000059 3300028380 Bacteria 152531
320 Ga0268265_10001875 3300028380 Bacteria 16712
321 Ga0268265_10013242 3300028380 Bacteria 5604
322 Ga0268264_10000304 3300028381 Bacteria 79130
323 Ga0268264_10004589 3300028381 Bacteria 11744
324 Ga0268264_10017062 3300028381 Bacteria 5945
325 Ga0307517_10202696 3300028786 Bacteria 1237
326 Ga0307513_10013706 3300031456 Bacteria 9941
327 Ga0307513_10137822 3300031456 Bacteria 2372
328 Ga0307408_100031023 3300031548 Bacteria 3717
329 Ga0307408_100053020 3300031548 Bacteria 2927
330 Ga0307408_100371586 3300031548 Bacteria 1219
331 Ga0307405_10000247 3300031731 Bacteria 19718
332 Ga0307405_10366242 3300031731 Bacteria 1117
333 Ga0307413_10047379 3300031824 Bacteria 2563
334 Ga0307413_10181164 3300031824 Bacteria 1502
335 Ga0307410_10021626 3300031852 Bacteria 3959
336 Ga0307410_10095538 3300031852 Bacteria 2119
337 Ga0307406_10117500 3300031901 Bacteria 1842
338 Ga0307406_10127686 3300031901 Bacteria 1779
339 Ga0307406_10183904 3300031901 Bacteria 1524
340 Ga0307406_10184288 3300031901 Bacteria 1523
341 Ga0307406_10221600 3300031901 Bacteria 1406
342 Ga0307407_10228688 3300031903 Bacteria 1262
343 Ga0307412_10001662 3300031911 Bacteria 12283
344 Ga0307412_10014331 3300031911 Bacteria 4672
345 Ga0307412_10096021 3300031911 Bacteria 2085
346 Ga0307412_10105728 3300031911 Bacteria 2000
347 Ga0307412_10292034 3300031911 Bacteria 1284
348 Ga0307409_100221421 3300031995 Bacteria 1709
349 Ga0307409_100257924 3300031995 Bacteria 1598
350 Ga0307416_100167698 3300032002 Bacteria 2039
351 Ga0307416_101278593 3300032002 Bacteria 839
352 Ga0307414_10000385 3300032004 Bacteria 23999
353 Ga0307414_10001045 3300032004 Bacteria 14151
354 Ga0307414_10234098 3300032004 Bacteria 1516
355 Ga0307414_10261877 3300032004 Bacteria 1443
356 Ga0307411_10025796 3300032005 Bacteria 3527
357 Ga0307411_10103064 3300032005 Bacteria 2023
358 Ga0307411_10201444 3300032005 Bacteria 1529
359 Ga0307415_100009603 3300032126 Bacteria 5435
360 Ga0307415_100287250 3300032126 Bacteria 1356
361 Ga0436364_0011659 3300037853 Bacteria 94648
362 Ga0237819_00318 3300038705 Bacteria 17701
363 Ga0436365_1863835 3300039437 Bacteria 2340
364 Ga0451802_0212041 3300041460 Bacteria 1728
365 Ga0451807_1151404 3300041486 Bacteria 2183
366 Ga0451835_1202669 3300041492 Bacteria 1017
367 Ga0439432_003940 3300042006 Bacteria 5460
368 Ga0466957_0579977 3300044842 Bacteria 784
369 Ga0495627_000430 3300046453 Bacteria 36446
370 Ga0495638_0000305 3300046460 Bacteria 63286
371 Ga0495638_0016633 3300046460 Bacteria 4922
372 Ga0495650_0000366 3300046471 Bacteria 79144
373 Ga0495639_0160791 3300046475 Bacteria 1087
374 Ga0495585_0011753 3300046492 Bacteria 5174
375 Ga0495596_0000297 3300046500 Bacteria 32926
376 Ga0495596_0048300 3300046500 Bacteria 1669
377 Ga0495607_0005987 3300046501 Bacteria 8622
378 Ga0495607_0205784 3300046501 Bacteria 971
379 Ga0495583_0000577 3300046506 Bacteria 50418
380 Ga0495583_0004928 3300046506 Bacteria 9280
381 Ga0495583_0014239 3300046506 Bacteria 4397
382 Ga0495583_0045880 3300046506 Bacteria 2018
383 Ga0495583_0063124 3300046506 Bacteria 1647
384 Ga0495606_0004121 3300046507 Bacteria 14762
385 Ga0495606_0025574 3300046507 Bacteria 4224
386 Ga0495606_0033365 3300046507 Bacteria 3551
387 Ga0495610_0002812 3300046512 Bacteria 14203
388 Ga0495620_0003493 3300046515 Bacteria 8992
389 Ga0495620_0027773 3300046515 Bacteria 2643
390 Ga0495628_0478844 3300046516 Bacteria 901
391 Ga0495631_0023320 3300046518 Bacteria 2869
392 Ga0495632_0002181 3300046519 Bacteria 15098
393 Ga0495637_0016118 3300046520 Bacteria 3496
394 Ga0495643_0000036 3300046522 Bacteria 238374
395 Ga0495643_0007755 3300046522 Bacteria 6872
396 Ga0495643_0007941 3300046522 Bacteria 6770
397 Ga0495643_0008329 3300046522 Bacteria 6577
398 Ga0495643_0030205 3300046522 Bacteria 3028
399 Ga0495648_0000235 3300046524 Bacteria 63436
400 Ga0495648_0006694 3300046524 Bacteria 9331
401 Ga0495648_0050667 3300046524 Bacteria 2535
402 Ga0495652_0194959 3300046529 Bacteria 1543
403 Ga0495654_0014488 3300046530 Bacteria 4196
404 Ga0495654_0020498 3300046530 Bacteria 3444
405 Ga0495654_0050226 3300046530 Bacteria 2039
406 Ga0495621_0023325 3300046539 Bacteria 2058
407 Ga0495597_0008403 3300046542 Bacteria 5175
408 Ga0495633_0000173 3300046558 Bacteria 84576
409 Ga0495633_0004741 3300046558 Bacteria 8539
410 Ga0495656_0189088 3300046615 Bacteria 1016
411 Ga0495668_0000087 3300046616 Bacteria 151819
412 Ga0495668_0000149 3300046616 Bacteria 105826
413 Ga0495668_0004609 3300046616 Bacteria 9693
414 Ga0495668_0014040 3300046616 Bacteria 4707
415 Ga0495625_0000866 3300046660 Bacteria 41162
416 Ga0495625_0002250 3300046660 Bacteria 21249
417 Ga0495625_0022727 3300046660 Bacteria 4803
418 Ga0495625_0033687 3300046660 Bacteria 3784
419 Ga0495625_0104869 3300046660 Bacteria 1937
420 Ga0495669_0002611 3300046684 Bacteria 7371
421 Ga0495670_0000033 3300046691 Bacteria 81716
422 Ga0495671_0000020 3300046692 Bacteria 268306
423 Ga0495649_0105681 3300046694 Bacteria 1494
424 Ga0495589_0045709 3300046794 Bacteria 2175
425 Ga0495687_000123 3300047443 Bacteria 118577
426 Ga0495687_001696 3300047443 Bacteria 19624
427 Ga0495677_0002704 3300047445 Bacteria 6929
428 Ga0495673_0000316 3300047469 Bacteria 62814
429 Ga0495681_0000089 3300047470 Bacteria 79789
430 Ga0495686_0000177 3300047472 Bacteria 121808
431 Ga0495686_0008101 3300047472 Bacteria 7771
432 Ga0495686_0017750 3300047472 Bacteria 4789
433 Ga0495626_0007815 3300048091 Bacteria 5925
434 Ga0496100_0008083 3300048903 Bacteria 5850
435 Ga0496100_0022075 3300048903 Bacteria 3846
436 Ga0496101_0159852 3300048904 Bacteria 1727
437 Ga0496102_0000209 3300048905 Bacteria 78525
438 Ga0496102_0045021 3300048905 Bacteria 4005
439 Ga0496103_0000136 3300048906 Bacteria 76530
440 Ga0496103_0095642 3300048906 Bacteria 1877
441 Ga0496104_0006964 3300048907 Bacteria 9969
442 Ga0496104_0155804 3300048907 Bacteria 2192
443 Ga0496105_0210072 3300048908 Bacteria 1587
444 Ga0496107_0032124 3300048910 Bacteria 3751
445 Ga0496111_0074968 3300048914 Bacteria 2465
446 Ga0496112_0010410 3300048915 Bacteria 8434
447 Ga0496113_0017200 3300048916 Bacteria 5015
448 Ga0496113_0017296 3300048916 Bacteria 5001
449 Ga0496114_0044534 3300048917 Bacteria 3682
450 Ga0496115_0002587 3300048918 Bacteria 12980
451 Ga0496115_0091666 3300048918 Bacteria 2484
452 Ga0496117_0000526 3300048920 Bacteria 63085
453 Ga0496117_0008522 3300048920 Bacteria 9725
454 Ga0496117_0075936 3300048920 Bacteria 2230
455 Ga0496118_0003002 3300048921 Bacteria 21794
456 Ga0496118_0004712 3300048921 Bacteria 15971
457 Ga0496118_0240018 3300048921 Bacteria 1038
458 Ga0496119_0017934 3300048922 Bacteria 5297
459 Ga0496119_0054736 3300048922 Bacteria 2428
460 Ga0496120_0100892 3300048923 Bacteria 1525
461 Ga0496121_0000024 3300048924 Bacteria 462959
462 Ga0496121_0000930 3300048924 Bacteria 52952
463 Ga0496121_0001586 3300048924 Bacteria 37825
464 Ga0496121_0006990 3300048924 Bacteria 13722
465 Ga0496121_0007335 3300048924 Bacteria 13332
466 Ga0496121_0201978 3300048924 Bacteria 1416
467 Ga0496122_0021007 3300048925 Bacteria 5865
468 Ga0496122_0078662 3300048925 Bacteria 2309
469 Ga0496123_0013924 3300048926 Bacteria 6701
470 Ga0496123_0016878 3300048926 Bacteria 5901
471 Ga0496123_0018196 3300048926 Bacteria 5603
472 Ga0496123_0027459 3300048926 Bacteria 4239
473 Ga0496123_0198194 3300048926 Bacteria 1032
474 Ga0496124_0001268 3300048927 Bacteria 38438
475 Ga0496124_0018089 3300048927 Bacteria 6616
476 Ga0496124_0046207 3300048927 Bacteria 3729
477 Ga0496124_0149312 3300048927 Bacteria 1835
478 Ga0496124_0166769 3300048927 Bacteria 1711
479 Ga0496124_0463879 3300048927 Bacteria 860
480 Ga0496125_0003122 3300048928 Bacteria 20585
481 Ga0496125_0016914 3300048928 Bacteria 6979
482 Ga0496125_0025212 3300048928 Bacteria 5451
483 Ga0496125_0111384 3300048928 Bacteria 1981
484 Ga0496125_0226034 3300048928 Bacteria 1201
485 Ga0496126_0000365 3300048929 Bacteria 93461
486 Ga0496126_0003583 3300048929 Bacteria 19467
487 Ga0496126_0450122 3300048929 Bacteria 1036
488 Ga0495682_0025095 3300049460 Bacteria 2219
489 Ga0501032_0062396 3300049569 Bacteria 2497
490 Ga0501034_0169312 3300049571 Bacteria 2152
491 Ga0501036_0028848 3300049572 Bacteria 4690
492 Ga0501037_0033692 3300049573 Bacteria 3782
493 Ga0501039_0102891 3300049575 Bacteria 2229
494 Ga0501048_0068987 3300049582 Bacteria 2497
495 Ga0501249_000160 3300049679 Bacteria 20848
496 Ga0501225_0001006 3300049705 Bacteria 8840
497 Ga0501262_009969 3300049759 Bacteria 1182
498 Ga0501280_001792 3300049776 Bacteria 3768
499 Ga0501035_0330462 3300049822 Bacteria 1279
500 Ga0501044_0022440 3300049823 Bacteria 6726
501 nmdc:mga03683_1099_c1 3300050489 Bacteria 7910
502 nmdc:mga03n38_18717_c1 3300050490 Bacteria 2739
503 nmdc:mga03n38_27433_c1 3300050490 Bacteria 2362
504 nmdc:mga06z11_348_c1 3300050494 Bacteria 17434
505 nmdc:mga04h51_137_c1 3300050495 Bacteria 21470
506 nmdc:mga04h51_48_c1 3300050495 Bacteria 38959
507 nmdc:mga07m45_162686_c1 3300050496 Bacteria 1296
508 nmdc:mga07m45_211_c1 3300050496 Bacteria 23070
509 nmdc:mga07m45_38630_c1 3300050496 Bacteria 2664
510 nmdc:mga07m45_4622_c1 3300050496 Bacteria 6750
511 nmdc:mga0sz30_2451_c1 3300050516 Bacteria 6610
512 Ga0500643_000762 3300053087 Bacteria 20999
513 Ga0500643_003634 3300053087 Bacteria 7314
514 Ga0500643_024575 3300053087 Bacteria 1911
515 Ga0500566_0176000 3300053094 Bacteria 1102
516 Ga0500555_000457 3300053103 Bacteria 16951
517 Ga0500556_0000037 3300053104 Bacteria 138433
518 Ga0500592_000557 3300053116 Bacteria 6156
519 Ga0500595_005149 3300053119 Bacteria 5738
520 Ga0500607_000003 3300053121 Bacteria 149664
521 Ga0500608_004635 3300053122 Bacteria 5355
522 Ga0500608_074197 3300053122 Bacteria 1614
523 Ga0500608_141688 3300053122 Bacteria 1065
524 Ga0500618_012028 3300053125 Bacteria 2277
525 Ga0500642_0000002 3300053130 Bacteria 795093
526 Ga0500658_0007510 3300053134 Bacteria 4028
527 Ga0500658_0026087 3300053134 Bacteria 2249
528 Ga0500559_0001835 3300053136 Bacteria 11587
529 Ga0500568_0005400 3300053139 Bacteria 6608
530 Ga0500568_0038346 3300053139 Bacteria 1940
531 Ga0500573_0000290 3300053140 Bacteria 21357
532 Ga0500574_112010 3300053141 Bacteria 809
533 Ga0500577_0043130 3300053142 Bacteria 1655
534 Ga0500577_0086213 3300053142 Bacteria 1261
535 Ga0500604_0006284 3300053151 Bacteria 3139
536 Ga0500622_0062246 3300053156 Bacteria 1901
537 Ga0500624_000004 3300053157 Bacteria 196921
538 Ga0500624_000100 3300053157 Bacteria 41296
539 Ga0500624_000115 3300053157 Bacteria 37706
540 Ga0500627_0000013 3300053158 Bacteria 136204
541 Ga0500627_0000446 3300053158 Bacteria 11187
542 Ga0500627_0004248 3300053158 Bacteria 4565
543 Ga0500627_0007639 3300053158 Bacteria 3782
544 Ga0500627_0124292 3300053158 Bacteria 1164
545 Ga0500636_0101442 3300053177 Bacteria 1635
546 Ga0500637_0000006 3300053178 Bacteria 99157
547 Ga0500637_0001510 3300053178 Bacteria 9926
548 Ga0500645_002404 3300053730 Bacteria 8398
549 Ga0500645_003232 3300053730 Bacteria 6744
550 Ga0500596_001300 3300053735 Bacteria 5046
551 Ga0500661_000186 3300055283 Bacteria 10909
552 Ga0500661_015365 3300055283 Bacteria 1373

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0194959 Ga0495652_0194959_230_1039 218
2 3300006353 Ga0075370_10166011 Ga0075370_101660112 221
3 3300050496 nmdc:mga07m45_162686_c1 nmdc:mga07m45_162686_c1_114_902 221
4 3300046516 Ga0495628_0478844 Ga0495628_0478844_49_858 222
5 3300001989 JGI24739J22299_10074127 JGI24739J22299_100741272 223
6 3300026116 Ga0207674_10083546 Ga0207674_100835463 225
7 3300042006 Ga0439432_003940 Ga0439432_003940_3510_4307 226
8 3300009094 Ga0111539_10305752 Ga0111539_103057523 227
9 3300026095 Ga0207676_10000169 Ga0207676_1000016955 227
10 3300005577 Ga0068857_100423782 Ga0068857_1004237822 228
11 3300005578 Ga0068854_100014593 Ga0068854_1000145932 228
12 3300005719 Ga0068861_100279042 Ga0068861_1002790422 228
13 3300009093 Ga0105240_10504950 Ga0105240_105049502 228
14 3300009545 Ga0105237_10025829 Ga0105237_100258295 228
15 3300025913 Ga0207695_10431579 Ga0207695_104315791 228
16 3300025986 Ga0207658_10488053 Ga0207658_104880532 228
17 3300046660 Ga0495625_0033687 Ga0495625_0033687_1388_2194 228
18 3300048924 Ga0496121_0201978 Ga0496121_0201978_482_1279 228
19 3300048925 Ga0496122_0078662 Ga0496122_0078662_377_1174 228
20 3300048926 Ga0496123_0018196 Ga0496123_0018196_397_1194 228
21 3300048927 Ga0496124_0001268 Ga0496124_0001268_34282_35079 228
22 3300048927 Ga0496124_0018089 Ga0496124_0018089_2433_3230 228
23 3300013306 Ga0163162_10002088 Ga0163162_1000208810 229
24 3300031548 Ga0307408_100031023 Ga0307408_1000310233 229
25 3300031901 Ga0307406_10127686 Ga0307406_101276862 229
26 3300031911 Ga0307412_10014331 Ga0307412_100143313 229
27 3300032002 Ga0307416_100167698 Ga0307416_1001676982 229
28 3300046506 Ga0495583_0063124 Ga0495583_0063124_600_1421 229
29 3300046522 Ga0495643_0007755 Ga0495643_0007755_412_1176 229
30 3300046501 Ga0495607_0005987 Ga0495607_0005987_4591_5409 230
31 3300046522 Ga0495643_0007941 Ga0495643_0007941_1725_2495 230
32 3300005295 Ga0065707_10152119 Ga0065707_101521192 231
33 3300006038 Ga0075365_10026950 Ga0075365_100269502 231
34 3300006048 Ga0075363_100005299 Ga0075363_1000052993 231
35 3300006051 Ga0075364_10023905 Ga0075364_100239053 231
36 3300006177 Ga0075362_10002346 Ga0075362_100023462 231
37 3300006178 Ga0075367_10119336 Ga0075367_101193362 231
38 3300006186 Ga0075369_10002985 Ga0075369_100029852 231
39 3300006195 Ga0075366_10063719 Ga0075366_100637193 231
40 3300009177 Ga0105248_10008190 Ga0105248_1000819012 231
41 3300025941 Ga0207711_10012342 Ga0207711_100123423 231
42 3300026035 Ga0207703_10000901 Ga0207703_1000090121 231
43 3300027866 Ga0209813_10000027 Ga0209813_1000002768 231
44 3300032126 Ga0307415_100287250 Ga0307415_1002872502 231
45 3300047445 Ga0495677_0002704 Ga0495677_0002704_4223_4993 231
46 3300050489 nmdc:mga03683_1099_c1 nmdc:mga03683_1099_c1_1849_2598 231
47 3300050490 nmdc:mga03n38_18717_c1 nmdc:mga03n38_18717_c1_1116_1865 231
48 3300050495 nmdc:mga04h51_48_c1 nmdc:mga04h51_48_c1_25047_25796 231
49 3300050496 nmdc:mga07m45_211_c1 nmdc:mga07m45_211_c1_3761_4510 231
50 3300050516 nmdc:mga0sz30_2451_c1 nmdc:mga0sz30_2451_c1_4168_4917 231
51 3300053142 Ga0500577_0086213 Ga0500577_0086213_344_1111 231
52 3300005356 Ga0070674_100019515 Ga0070674_1000195153 232
53 3300009101 Ga0105247_10010362 Ga0105247_100103624 232
54 3300009545 Ga0105237_10006917 Ga0105237_100069174 232
55 3300010375 Ga0105239_10372014 Ga0105239_103720142 232
56 3300025914 Ga0207671_10001194 Ga0207671_1000119421 232
57 3300031456 Ga0307513_10137822 Ga0307513_101378222 232
58 3300046660 Ga0495625_0002250 Ga0495625_0002250_9696_10418 232
59 3300053087 Ga0500643_003634 Ga0500643_003634_3264_4055 232
60 3300053116 Ga0500592_000557 Ga0500592_000557_1527_2327 232
61 3300053158 Ga0500627_0004248 Ga0500627_0004248_2204_3004 232
62 3300004625 Ga0055543_1021546 Ga0055543_10215462 233
63 3300005262 Ga0065165_1001363 Ga0065165_100136328 233
64 3300005347 Ga0070668_100219876 Ga0070668_1002198762 233
65 3300006946 Ga0079104_1019271 Ga0079104_10192711 233
66 3300025972 Ga0207668_10218324 Ga0207668_102183242 233
67 3300031548 Ga0307408_100371586 Ga0307408_1003715862 233
68 3300031824 Ga0307413_10181164 Ga0307413_101811641 233
69 3300031903 Ga0307407_10228688 Ga0307407_102286881 233
70 3300046691 Ga0495670_0000033 Ga0495670_0000033_77454_78242 233
71 3300049776 Ga0501280_001792 Ga0501280_001792_2659_3468 233
72 3300053730 Ga0500645_003232 Ga0500645_003232_5441_6190 233
73 3300003763 Ga0055529_1000004 Ga0055529_1000004199 234
74 3300005347 Ga0070668_100122054 Ga0070668_1001220542 234
75 3300005355 Ga0070671_100651257 Ga0070671_1006512571 234
76 3300005356 Ga0070674_100036673 Ga0070674_1000366732 234
77 3300005367 Ga0070667_100005338 Ga0070667_1000053384 234
78 3300005841 Ga0068863_100021575 Ga0068863_1000215752 234
79 3300025254 Ga0209148_1000008 Ga0209148_1000008690 234
80 3300025272 Ga0209455_1000002 Ga0209455_1000002734 234
81 3300025901 Ga0207688_10027358 Ga0207688_100273584 234
82 3300025937 Ga0207669_10094352 Ga0207669_100943523 234
83 3300048918 Ga0496115_0002587 Ga0496115_0002587_8554_9300 234
84 3300009551 Ga0105238_10253956 Ga0105238_102539562 235
85 3300010375 Ga0105239_10000271 Ga0105239_1000027119 235
86 3300025913 Ga0207695_10005114 Ga0207695_100051145 235
87 3300025924 Ga0207694_10249374 Ga0207694_102493742 235
88 3300046524 Ga0495648_0006694 Ga0495648_0006694_1016_1801 235
89 3300006946 Ga0079104_1019976 Ga0079104_10199762 236
90 3300025949 Ga0207667_10040850 Ga0207667_100408504 236
91 3300031456 Ga0307513_10013706 Ga0307513_100137066 236
92 3300046475 Ga0495639_0160791 Ga0495639_0160791_228_1055 236
93 3300046660 Ga0495625_0104869 Ga0495625_0104869_146_889 236
94 3300053104 Ga0500556_0000037 Ga0500556_0000037_116281_117024 236
95 3300053122 Ga0500608_004635 Ga0500608_004635_2829_3572 236
96 3300053130 Ga0500642_0000002 Ga0500642_0000002_758572_759315 236
97 3300053156 Ga0500622_0062246 Ga0500622_0062246_159_902 236
98 3300046558 Ga0495633_0004741 Ga0495633_0004741_3675_4490 237
99 3300047472 Ga0495686_0017750 Ga0495686_0017750_3508_4287 237
100 3300001915 JGI24741J21665_1000134 JGI24741J21665_100013416 238
101 3300002075 JGI24738J21930_10002792 JGI24738J21930_100027923 238
102 3300005335 Ga0070666_10000171 Ga0070666_1000017135 238
103 3300005344 Ga0070661_100007098 Ga0070661_1000070986 238
104 3300005344 Ga0070661_100059975 Ga0070661_1000599753 238
105 3300005353 Ga0070669_100000001 Ga0070669_10000000124 238
106 3300005355 Ga0070671_100000007 Ga0070671_100000007242 238
107 3300005440 Ga0070705_100014227 Ga0070705_1000142275 238
108 3300005455 Ga0070663_100009092 Ga0070663_1000090923 238
109 3300005548 Ga0070665_100359317 Ga0070665_1003593172 238
110 3300005577 Ga0068857_100252983 Ga0068857_1002529831 238
111 3300005719 Ga0068861_100002527 Ga0068861_1000025274 238
112 3300005834 Ga0068851_10128028 Ga0068851_101280282 238
113 3300005841 Ga0068863_100016644 Ga0068863_1000166447 238
114 3300005844 Ga0068862_100000468 Ga0068862_10000046824 238
115 3300009174 Ga0105241_10008499 Ga0105241_100084993 238
116 3300010375 Ga0105239_10139232 Ga0105239_101392324 238
117 3300013100 Ga0157373_10028324 Ga0157373_100283243 238
118 3300013104 Ga0157370_10094115 Ga0157370_100941153 238
119 3300013105 Ga0157369_10115718 Ga0157369_101157183 238
120 3300025290 Ga0207673_1005823 Ga0207673_10058232 238
121 3300025315 Ga0207697_10001100 Ga0207697_1000110013 238
122 3300025903 Ga0207680_10001461 Ga0207680_100014614 238
123 3300025904 Ga0207647_10002249 Ga0207647_100022499 238
124 3300025909 Ga0207705_10559300 Ga0207705_105593002 238
125 3300025913 Ga0207695_10060765 Ga0207695_100607654 238
126 3300025922 Ga0207646_10360779 Ga0207646_103607792 238
127 3300025923 Ga0207681_10000002 Ga0207681_10000002979 238
128 3300025931 Ga0207644_10000002 Ga0207644_10000002917 238
129 3300025961 Ga0207712_10010207 Ga0207712_100102076 238
130 3300026041 Ga0207639_10006831 Ga0207639_100068317 238
131 3300026067 Ga0207678_10000067 Ga0207678_1000006735 238
132 3300026078 Ga0207702_10014551 Ga0207702_100145512 238
133 3300026088 Ga0207641_10028169 Ga0207641_100281693 238
134 3300026116 Ga0207674_10055955 Ga0207674_100559554 238
135 3300026118 Ga0207675_100005628 Ga0207675_1000056284 238
136 3300027111 Ga0209281_1031202 Ga0209281_10312021 238
137 3300028379 Ga0268266_10315174 Ga0268266_103151742 238
138 3300028380 Ga0268265_10001875 Ga0268265_1000187513 238
139 3300031548 Ga0307408_100053020 Ga0307408_1000530204 238
140 3300032004 Ga0307414_10234098 Ga0307414_102340982 238
141 3300032005 Ga0307411_10103064 Ga0307411_101030642 238
142 3300046539 Ga0495621_0023325 Ga0495621_0023325_567_1289 238
143 3300002075 JGI24738J21930_10041385 JGI24738J21930_100413851 239
144 3300003781 Ga0055536_1003805 Ga0055536_10038058 239
145 3300005289 Ga0065704_10356200 Ga0065704_103562001 239
146 3300005355 Ga0070671_100229882 Ga0070671_1002298822 239
147 3300005457 Ga0070662_100114749 Ga0070662_1001147492 239
148 3300005577 Ga0068857_100454190 Ga0068857_1004541901 239
149 3300005578 Ga0068854_100218245 Ga0068854_1002182452 239
150 3300005578 Ga0068854_100230896 Ga0068854_1002308963 239
151 3300005843 Ga0068860_100002492 Ga0068860_1000024922 239
152 3300006353 Ga0075370_10243458 Ga0075370_102434582 239
153 3300025292 Ga0209676_1001476 Ga0209676_100147626 239
154 3300025933 Ga0207706_10078008 Ga0207706_100780082 239
155 3300026116 Ga0207674_10062778 Ga0207674_100627782 239
156 3300028381 Ga0268264_10017062 Ga0268264_100170622 239
157 3300031901 Ga0307406_10184288 Ga0307406_101842882 239
158 3300031911 Ga0307412_10292034 Ga0307412_102920342 239
159 3300031995 Ga0307409_100221421 Ga0307409_1002214212 239
160 3300032005 Ga0307411_10201444 Ga0307411_102014442 239
161 3300044842 Ga0466957_0579977 Ga0466957_0579977_21_743 239
162 3300046500 Ga0495596_0000297 Ga0495596_0000297_29357_30091 239
163 3300046512 Ga0495610_0002812 Ga0495610_0002812_3505_4239 239
164 3300046522 Ga0495643_0000036 Ga0495643_0000036_100506_101234 239
165 3300048091 Ga0495626_0007815 Ga0495626_0007815_2326_3060 239
166 3300048924 Ga0496121_0001586 Ga0496121_0001586_17084_17818 239
167 3300050496 nmdc:mga07m45_4622_c1 nmdc:mga07m45_4622_c1_2528_3262 239
168 3300053094 Ga0500566_0176000 Ga0500566_0176000_276_1022 239
169 3300053121 Ga0500607_000003 Ga0500607_000003_107707_108453 239
170 3300053122 Ga0500608_141688 Ga0500608_141688_101_847 239
171 3300053178 Ga0500637_0001510 Ga0500637_0001510_546_1292 239
172 3300053730 Ga0500645_002404 Ga0500645_002404_4035_4781 239
173 iso_pu_bacteria 2599185354 2600203298 239
174 iso_pu_bacteria 2643221588 2643951165 239
175 iso_pu_bacteria 2751185897 2753766876 239
176 iso_pu_bacteria 2818991438 2819551025 239
177 iso_pu_bacteria 2852653556 2852656369 239
178 iso_pu_bacteria 2928027323 2928030267 239
179 iso_pu_bacteria 2984564862 2984568766 239
180 iso_pu_bacteria 2993356040 2993359755 239
181 iso_pu_bacteria 8054302542 8054307547 239
182 3300005289 Ga0065704_10009557 Ga0065704_100095572 240
183 3300005339 Ga0070660_100019269 Ga0070660_1000192693 240
184 3300005355 Ga0070671_100109302 Ga0070671_1001093022 240
185 3300005366 Ga0070659_100069566 Ga0070659_1000695664 240
186 3300005455 Ga0070663_100035804 Ga0070663_1000358044 240
187 3300005455 Ga0070663_100213728 Ga0070663_1002137281 240
188 3300005563 Ga0068855_100032329 Ga0068855_1000323295 240
189 3300005564 Ga0070664_100089279 Ga0070664_1000892792 240
190 3300005577 Ga0068857_100163514 Ga0068857_1001635143 240
191 3300005578 Ga0068854_100056864 Ga0068854_1000568643 240
192 3300005578 Ga0068854_100467580 Ga0068854_1004675802 240
193 3300005614 Ga0068856_100072957 Ga0068856_1000729573 240
194 3300005616 Ga0068852_100002899 Ga0068852_10000289912 240
195 3300005616 Ga0068852_100016319 Ga0068852_1000163195 240
196 3300005617 Ga0068859_100004071 Ga0068859_1000040712 240
197 3300005842 Ga0068858_100001300 Ga0068858_1000013006 240
198 3300005937 Ga0081455_10000212 Ga0081455_1000021246 240
199 3300006353 Ga0075370_10026188 Ga0075370_100261882 240
200 3300006931 Ga0097620_100001427 Ga0097620_1000014274 240
201 3300006931 Ga0097620_100004071 Ga0097620_1000040712 240
202 3300009093 Ga0105240_10030797 Ga0105240_100307978 240
203 3300009093 Ga0105240_10694735 Ga0105240_106947352 240
204 3300009174 Ga0105241_10135279 Ga0105241_101352793 240
205 3300009177 Ga0105248_10038528 Ga0105248_100385284 240
206 3300009177 Ga0105248_10076006 Ga0105248_100760061 240
207 3300009545 Ga0105237_10405037 Ga0105237_104050372 240
208 3300009551 Ga0105238_10092201 Ga0105238_100922012 240
209 3300009551 Ga0105238_10118462 Ga0105238_101184622 240
210 3300009551 Ga0105238_10938384 Ga0105238_109383842 240
211 3300009978 Ga0105148_100181 Ga0105148_1001812 240
212 3300013100 Ga0157373_10079994 Ga0157373_100799943 240
213 3300013102 Ga0157371_10001885 Ga0157371_100018858 240
214 3300013105 Ga0157369_10465719 Ga0157369_104657191 240
215 3300014326 Ga0157380_10000945 Ga0157380_1000094512 240
216 3300025315 Ga0207697_10029516 Ga0207697_100295163 240
217 3300025904 Ga0207647_10065178 Ga0207647_100651782 240
218 3300025909 Ga0207705_10000007 Ga0207705_10000007553 240
219 3300025911 Ga0207654_10000914 Ga0207654_1000091416 240
220 3300025913 Ga0207695_10001471 Ga0207695_1000147132 240
221 3300025913 Ga0207695_10088266 Ga0207695_100882663 240
222 3300025919 Ga0207657_10030816 Ga0207657_100308165 240
223 3300025924 Ga0207694_10094666 Ga0207694_100946661 240
224 3300025931 Ga0207644_10074468 Ga0207644_100744683 240
225 3300025932 Ga0207690_10047872 Ga0207690_100478723 240
226 3300025941 Ga0207711_10000504 Ga0207711_1000050424 240
227 3300025941 Ga0207711_10117061 Ga0207711_101170612 240
228 3300025949 Ga0207667_10017581 Ga0207667_100175814 240
229 3300025972 Ga0207668_10450536 Ga0207668_104505362 240
230 3300025981 Ga0207640_10008005 Ga0207640_100080054 240
231 3300026035 Ga0207703_10004612 Ga0207703_100046127 240
232 3300026035 Ga0207703_10201266 Ga0207703_102012661 240
233 3300026041 Ga0207639_10525031 Ga0207639_105250312 240
234 3300026067 Ga0207678_10015135 Ga0207678_100151358 240
235 3300026078 Ga0207702_10019024 Ga0207702_100190242 240
236 3300026078 Ga0207702_10043739 Ga0207702_100437393 240
237 3300026142 Ga0207698_10000098 Ga0207698_100000982 240
238 3300026142 Ga0207698_10004109 Ga0207698_100041093 240
239 3300027866 Ga0209813_10000345 Ga0209813_100003458 240
240 3300041460 Ga0451802_0212041 Ga0451802_0212041_964_1698 240
241 3300041486 Ga0451807_1151404 Ga0451807_1151404_437_1171 240
242 3300046524 Ga0495648_0050667 Ga0495648_0050667_192_926 240
243 3300046558 Ga0495633_0000173 Ga0495633_0000173_41070_41798 240
244 3300048907 Ga0496104_0155804 Ga0496104_0155804_88_813 240
245 3300048908 Ga0496105_0210072 Ga0496105_0210072_39_764 240
246 3300048917 Ga0496114_0044534 Ga0496114_0044534_668_1405 240
247 3300048920 Ga0496117_0075936 Ga0496117_0075936_1004_1732 240
248 3300048921 Ga0496118_0240018 Ga0496118_0240018_265_993 240
249 3300048922 Ga0496119_0054736 Ga0496119_0054736_620_1348 240
250 3300048925 Ga0496122_0021007 Ga0496122_0021007_3240_3980 240
251 3300048926 Ga0496123_0016878 Ga0496123_0016878_1923_2663 240
252 3300048927 Ga0496124_0166769 Ga0496124_0166769_813_1547 240
253 3300048927 Ga0496124_0463879 Ga0496124_0463879_101_841 240
254 3300048928 Ga0496125_0226034 Ga0496125_0226034_113_853 240
255 3300048929 Ga0496126_0003583 Ga0496126_0003583_14443_15180 240
256 3300050490 nmdc:mga03n38_27433_c1 nmdc:mga03n38_27433_c1_1140_1868 240
257 3300050494 nmdc:mga06z11_348_c1 nmdc:mga06z11_348_c1_2765_3493 240
258 3300050495 nmdc:mga04h51_137_c1 nmdc:mga04h51_137_c1_6801_7529 240
259 3300050496 nmdc:mga07m45_38630_c1 nmdc:mga07m45_38630_c1_1851_2579 240
260 3300053139 Ga0500568_0038346 Ga0500568_0038346_714_1469 240
261 3300053157 Ga0500624_000115 Ga0500624_000115_4550_5281 240
262 iso_pu_bacteria 2643221563 2643834451 240
263 iso_pu_bacteria 2643221608 2644055377 240
264 iso_pu_bacteria 3000865235 3000868191 240
265 3300005353 Ga0070669_100098547 Ga0070669_1000985473 241
266 3300025923 Ga0207681_10394056 Ga0207681_103940561 241
267 3300028786 Ga0307517_10202696 Ga0307517_102026961 241
268 3300031824 Ga0307413_10047379 Ga0307413_100473792 241
269 3300031852 Ga0307410_10021626 Ga0307410_100216264 241
270 3300031852 Ga0307410_10095538 Ga0307410_100955381 241
271 3300031901 Ga0307406_10117500 Ga0307406_101175002 241
272 3300031901 Ga0307406_10183904 Ga0307406_101839042 241
273 3300031911 Ga0307412_10096021 Ga0307412_100960212 241
274 3300031995 Ga0307409_100257924 Ga0307409_1002579242 241
275 3300032002 Ga0307416_101278593 Ga0307416_1012785931 241
276 3300032004 Ga0307414_10261877 Ga0307414_102618772 241
277 3300032005 Ga0307411_10025796 Ga0307411_100257963 241
278 3300046453 Ga0495627_000430 Ga0495627_000430_30867_31613 241
279 3300046471 Ga0495650_0000366 Ga0495650_0000366_48128_48874 241
280 3300046515 Ga0495620_0003493 Ga0495620_0003493_8013_8861 241
281 3300046515 Ga0495620_0027773 Ga0495620_0027773_579_1325 241
282 3300046530 Ga0495654_0050226 Ga0495654_0050226_55_801 241
283 3300047470 Ga0495681_0000089 Ga0495681_0000089_30916_31662 241
284 3300049705 Ga0501225_0001006 Ga0501225_0001006_457_1188 241
285 3300053119 Ga0500595_005149 Ga0500595_005149_4405_5232 241
286 3300053141 Ga0500574_112010 Ga0500574_112010_50_799 241
287 3300053157 Ga0500624_000004 Ga0500624_000004_137878_138627 241
288 3300053178 Ga0500637_0000006 Ga0500637_0000006_43585_44334 241
289 iso_pu_bacteria 2879163058 2879163703 241
290 iso_pu_bacteria 2928526807 2928530800 241
291 iso_pu_bacteria 2928968154 2928971127 241
292 3300005289 Ga0065704_10110538 Ga0065704_101105382 242
293 3300005331 Ga0070670_100001449 Ga0070670_10000144913 242
294 3300005367 Ga0070667_100001949 Ga0070667_10000194923 242
295 3300005618 Ga0068864_100000332 Ga0068864_10000033211 242
296 3300005841 Ga0068863_100000456 Ga0068863_10000045639 242
297 3300005844 Ga0068862_100000506 Ga0068862_10000050611 242
298 3300009011 Ga0105251_10001184 Ga0105251_1000118410 242
299 3300009101 Ga0105247_10078338 Ga0105247_100783382 242
300 3300009177 Ga0105248_10000029 Ga0105248_1000002912 242
301 3300009553 Ga0105249_10000928 Ga0105249_1000092827 242
302 3300013306 Ga0163162_10121046 Ga0163162_101210463 242
303 3300014968 Ga0157379_10014026 Ga0157379_100140263 242
304 3300025292 Ga0209676_1027946 Ga0209676_10279461 242
305 3300025294 Ga0209025_1025385 Ga0209025_10253853 242
306 3300025304 Ga0209257_1010671 Ga0209257_10106713 242
307 3300025735 Ga0207713_1005340 Ga0207713_10053408 242
308 3300025900 Ga0207710_10131147 Ga0207710_101311472 242
309 3300025925 Ga0207650_10001196 Ga0207650_1000119610 242
310 3300025941 Ga0207711_10000004 Ga0207711_10000004495 242
311 3300025961 Ga0207712_10000698 Ga0207712_1000069827 242
312 3300025986 Ga0207658_10000204 Ga0207658_1000020454 242
313 3300026088 Ga0207641_10000010 Ga0207641_10000010147 242
314 3300026095 Ga0207676_10000036 Ga0207676_10000036189 242
315 3300028380 Ga0268265_10000059 Ga0268265_10000059142 242
316 3300032004 Ga0307414_10000385 Ga0307414_1000038511 242
317 3300041492 Ga0451835_1202669 Ga0451835_1202669_142_957 242
318 3300046501 Ga0495607_0205784 Ga0495607_0205784_18_764 242
319 3300046507 Ga0495606_0004121 Ga0495606_0004121_5939_6685 242
320 3300047472 Ga0495686_0008101 Ga0495686_0008101_243_989 242
321 3300048906 Ga0496103_0095642 Ga0496103_0095642_679_1491 242
322 3300048920 Ga0496117_0008522 Ga0496117_0008522_1219_1986 242
323 3300048921 Ga0496118_0004712 Ga0496118_0004712_1984_2751 242
324 3300049759 Ga0501262_009969 Ga0501262_009969_72_824 242
325 3300053122 Ga0500608_074197 Ga0500608_074197_712_1449 242
326 3300053134 Ga0500658_0007510 Ga0500658_0007510_1413_2162 242
327 3300053140 Ga0500573_0000290 Ga0500573_0000290_2330_3118 242
328 3300001979 JGI24740J21852_10008715 JGI24740J21852_100087153 243
329 3300001990 JGI24737J22298_10003189 JGI24737J22298_100031892 243
330 3300002067 JGI24735J21928_10020502 JGI24735J21928_100205022 243
331 3300002075 JGI24738J21930_10002317 JGI24738J21930_100023175 243
332 3300002774 JGI25150J39212_1000368 JGI25150J39212_10003684 243
333 3300003215 JGI25153J46596_10000125 JGI25153J46596_100001254 243
334 3300003773 Ga0055537_1006643 Ga0055537_10066432 243
335 3300003792 Ga0055540_1000868 Ga0055540_100086816 243
336 3300005339 Ga0070660_100168337 Ga0070660_1001683372 243
337 3300005344 Ga0070661_100045987 Ga0070661_1000459872 243
338 3300005457 Ga0070662_100023558 Ga0070662_1000235584 243
339 3300005539 Ga0068853_100064987 Ga0068853_1000649873 243
340 3300005577 Ga0068857_100017504 Ga0068857_1000175045 243
341 3300005578 Ga0068854_100033417 Ga0068854_1000334173 243
342 3300005617 Ga0068859_100050596 Ga0068859_1000505965 243
343 3300005834 Ga0068851_10024998 Ga0068851_100249982 243
344 3300005841 Ga0068863_100000576 Ga0068863_1000005763 243
345 3300005843 Ga0068860_100000812 Ga0068860_10000081215 243
346 3300005844 Ga0068862_100000014 Ga0068862_100000014204 243
347 3300006931 Ga0097620_100050597 Ga0097620_1000505975 243
348 3300009174 Ga0105241_10026280 Ga0105241_100262803 243
349 3300009177 Ga0105248_10001383 Ga0105248_1000138327 243
350 3300013100 Ga0157373_10051049 Ga0157373_100510492 243
351 3300013102 Ga0157371_10015686 Ga0157371_100156865 243
352 3300013104 Ga0157370_10029953 Ga0157370_100299535 243
353 3300013105 Ga0157369_10179796 Ga0157369_101797962 243
354 3300013297 Ga0157378_10729746 Ga0157378_107297461 243
355 3300013306 Ga0163162_10364702 Ga0163162_103647022 243
356 3300025245 Ga0207425_1000461 Ga0207425_10004614 243
357 3300025258 Ga0209129_1000327 Ga0209129_10003274 243
358 3300025263 Ga0209565_1000052 Ga0209565_1000052142 243
359 3300025263 Ga0209565_1011046 Ga0209565_10110463 243
360 3300025292 Ga0209676_1008829 Ga0209676_10088294 243
361 3300025294 Ga0209025_1001791 Ga0209025_100179119 243
362 3300025295 Ga0209564_1011259 Ga0209564_10112593 243
363 3300025297 Ga0209758_1000002 Ga0209758_1000002436 243
364 3300025297 Ga0209758_1024549 Ga0209758_10245493 243
365 3300025298 Ga0209050_1000001 Ga0209050_1000001382 243
366 3300025298 Ga0209050_1016532 Ga0209050_10165323 243
367 3300025303 Ga0209051_1000297 Ga0209051_100029752 243
368 3300025304 Ga0209257_1001829 Ga0209257_100182928 243
369 3300025304 Ga0209257_1001894 Ga0209257_100189427 243
370 3300025321 Ga0207656_10038199 Ga0207656_100381992 243
371 3300025900 Ga0207710_10001905 Ga0207710_100019053 243
372 3300025904 Ga0207647_10000827 Ga0207647_100008275 243
373 3300025911 Ga0207654_10002585 Ga0207654_1000258511 243
374 3300025919 Ga0207657_10038998 Ga0207657_100389983 243
375 3300025920 Ga0207649_10403522 Ga0207649_104035222 243
376 3300025933 Ga0207706_10051465 Ga0207706_100514653 243
377 3300025941 Ga0207711_10003539 Ga0207711_100035399 243
378 3300025961 Ga0207712_10000002 Ga0207712_10000002565 243
379 3300026041 Ga0207639_10015396 Ga0207639_100153963 243
380 3300026067 Ga0207678_10026481 Ga0207678_100264815 243
381 3300026078 Ga0207702_10009802 Ga0207702_1000980211 243
382 3300026088 Ga0207641_10033992 Ga0207641_100339923 243
383 3300026116 Ga0207674_10050990 Ga0207674_100509902 243
384 3300026142 Ga0207698_10026383 Ga0207698_100263832 243
385 3300028380 Ga0268265_10000048 Ga0268265_1000004873 243
386 3300028381 Ga0268264_10000304 Ga0268264_1000030482 243
387 3300031731 Ga0307405_10000247 Ga0307405_100002473 243
388 3300031731 Ga0307405_10366242 Ga0307405_103662421 243
389 3300031911 Ga0307412_10001662 Ga0307412_100016622 243
390 3300032004 Ga0307414_10001045 Ga0307414_1000104515 243
391 3300032126 Ga0307415_100009603 Ga0307415_1000096033 243
392 3300046460 Ga0495638_0016633 Ga0495638_0016633_743_1501 243
393 3300046506 Ga0495583_0000577 Ga0495583_0000577_22333_23097 243
394 3300048905 Ga0496102_0045021 Ga0496102_0045021_417_1175 243
395 3300049460 Ga0495682_0025095 Ga0495682_0025095_171_935 243
396 3300049679 Ga0501249_000160 Ga0501249_000160_419_1204 243
397 3300053087 Ga0500643_000762 Ga0500643_000762_15558_16304 243
398 3300053103 Ga0500555_000457 Ga0500555_000457_14352_15116 243
399 3300053136 Ga0500559_0001835 Ga0500559_0001835_7512_8258 243
400 3300053142 Ga0500577_0043130 Ga0500577_0043130_351_1115 243
401 3300055283 Ga0500661_000186 Ga0500661_000186_4037_4783 243
402 iso_pu_bacteria 2738541275 2738710566 243
403 iso_pu_bacteria 2738541301 2738848991 243
404 iso_pu_bacteria 2738541304 2738864720 243
405 iso_pu_bacteria 2738543022 2739297238 243
406 iso_pu_bacteria 2738543033 2739358916 243
407 iso_pu_bacteria 2928100450 2928100665 243
408 iso_pu_bacteria 2928959182 2928960728 243
409 2162886007 SwRhRL2b_contig_335976 SwRhRL2b_0456.00000060 244
410 3300003771 Ga0055526_1003012 Ga0055526_10030124 244
411 3300003781 Ga0055536_1003782 Ga0055536_10037827 244
412 3300003781 Ga0055536_1012473 Ga0055536_10124732 244
413 3300003791 Ga0055530_10000116 Ga0055530_100001169 244
414 3300003791 Ga0055530_10014456 Ga0055530_100144563 244
415 3300003794 Ga0055531_10002417 Ga0055531_100024179 244
416 3300003794 Ga0055531_10004300 Ga0055531_100043003 244
417 3300005548 Ga0070665_100000043 Ga0070665_10000004363 244
418 3300005548 Ga0070665_100051178 Ga0070665_1000511782 244
419 3300005578 Ga0068854_100143836 Ga0068854_1001438362 244
420 3300025291 Ga0209675_1000697 Ga0209675_100069718 244
421 3300025292 Ga0209676_1000273 Ga0209676_100027372 244
422 3300025292 Ga0209676_1000402 Ga0209676_100040230 244
423 3300025292 Ga0209676_1025202 Ga0209676_10252022 244
424 3300025294 Ga0209025_1009722 Ga0209025_10097224 244
425 3300025295 Ga0209564_1000783 Ga0209564_100078317 244
426 3300025298 Ga0209050_1000218 Ga0209050_1000218116 244
427 3300025298 Ga0209050_1004400 Ga0209050_10044005 244
428 3300025304 Ga0209257_1000248 Ga0209257_100024890 244
429 3300025304 Ga0209257_1000435 Ga0209257_100043559 244
430 3300025981 Ga0207640_10038745 Ga0207640_100387454 244
431 3300028379 Ga0268266_10000002 Ga0268266_10000002525 244
432 3300028379 Ga0268266_10093046 Ga0268266_100930462 244
433 3300031901 Ga0307406_10221600 Ga0307406_102216002 244
434 3300031911 Ga0307412_10105728 Ga0307412_101057281 244
435 3300038705 Ga0237819_00318 Ga0237819_00318_11580_12392 244
436 3300046492 Ga0495585_0011753 Ga0495585_0011753_2218_2967 244
437 3300046522 Ga0495643_0008329 Ga0495643_0008329_2499_3257 244
438 3300046530 Ga0495654_0014488 Ga0495654_0014488_1044_1814 244
439 3300046616 Ga0495668_0014040 Ga0495668_0014040_856_1626 244
440 3300046794 Ga0495589_0045709 Ga0495589_0045709_784_1554 244
441 3300048924 Ga0496121_0000024 Ga0496121_0000024_124082_124837 244
442 3300048924 Ga0496121_0000930 Ga0496121_0000930_44263_45033 244
443 3300048924 Ga0496121_0007335 Ga0496121_0007335_10699_11442 244
444 3300048926 Ga0496123_0198194 Ga0496123_0198194_208_978 244
445 3300048927 Ga0496124_0149312 Ga0496124_0149312_941_1711 244
446 3300048928 Ga0496125_0016914 Ga0496125_0016914_3042_3812 244
447 3300048929 Ga0496126_0450122 Ga0496126_0450122_48_818 244
448 3300053139 Ga0500568_0005400 Ga0500568_0005400_3565_4320 244
449 3300053158 Ga0500627_0007639 Ga0500627_0007639_908_1678 244
450 3300053158 Ga0500627_0124292 Ga0500627_0124292_249_1004 244
451 3300001979 JGI24740J21852_10075336 JGI24740J21852_100753361 245
452 3300003215 JGI25153J46596_10000417 JGI25153J46596_100004174 245
453 3300005295 Ga0065707_10082568 Ga0065707_100825688 245
454 3300005456 Ga0070678_100001925 Ga0070678_10000192511 245
455 3300005543 Ga0070672_100107543 Ga0070672_1001075432 245
456 3300005834 Ga0068851_10082183 Ga0068851_100821832 245
457 3300005834 Ga0068851_10090246 Ga0068851_100902462 245
458 3300006358 Ga0068871_100041930 Ga0068871_1000419302 245
459 3300006881 Ga0068865_100109827 Ga0068865_1001098271 245
460 3300009148 Ga0105243_10001659 Ga0105243_1000165918 245
461 3300009176 Ga0105242_10110929 Ga0105242_101109293 245
462 3300021388 Ga0213875_10000275 Ga0213875_1000027520 245
463 3300025297 Ga0209758_1000007 Ga0209758_1000007663 245
464 3300025321 Ga0207656_10002624 Ga0207656_100026247 245
465 3300025920 Ga0207649_10000581 Ga0207649_1000058113 245
466 3300025934 Ga0207686_10174831 Ga0207686_101748312 245
467 3300025935 Ga0207709_10000005 Ga0207709_10000005409 245
468 3300025937 Ga0207669_10004814 Ga0207669_100048144 245
469 3300025938 Ga0207704_10109125 Ga0207704_101091251 245
470 3300025940 Ga0207691_10114164 Ga0207691_101141643 245
471 3300025949 Ga0207667_10000001 Ga0207667_10000001901 245
472 3300025960 Ga0207651_10387169 Ga0207651_103871691 245
473 3300026041 Ga0207639_10001947 Ga0207639_100019475 245
474 3300026116 Ga0207674_10015757 Ga0207674_100157577 245
475 3300026121 Ga0207683_10005199 Ga0207683_100051994 245
476 3300037853 Ga0436364_0011659 Ga0436364_0011659_65738_66490 245
477 3300039437 Ga0436365_1863835 Ga0436365_1863835_1553_2305 245
478 3300046460 Ga0495638_0000305 Ga0495638_0000305_1938_2741 245
479 3300046506 Ga0495583_0014239 Ga0495583_0014239_1607_2377 245
480 3300046507 Ga0495606_0033365 Ga0495606_0033365_482_1252 245
481 3300046518 Ga0495631_0023320 Ga0495631_0023320_261_1031 245
482 3300046519 Ga0495632_0002181 Ga0495632_0002181_1922_2725 245
483 3300046520 Ga0495637_0016118 Ga0495637_0016118_1570_2340 245
484 3300046522 Ga0495643_0030205 Ga0495643_0030205_2160_2930 245
485 3300046524 Ga0495648_0000235 Ga0495648_0000235_60729_61532 245
486 3300046530 Ga0495654_0020498 Ga0495654_0020498_2442_3203 245
487 3300046542 Ga0495597_0008403 Ga0495597_0008403_2057_2827 245
488 3300046615 Ga0495656_0189088 Ga0495656_0189088_174_977 245
489 3300046616 Ga0495668_0000087 Ga0495668_0000087_89061_89822 245
490 3300046616 Ga0495668_0000149 Ga0495668_0000149_101240_102010 245
491 3300046616 Ga0495668_0004609 Ga0495668_0004609_3749_4561 245
492 3300046660 Ga0495625_0000866 Ga0495625_0000866_39129_39878 245
493 3300046660 Ga0495625_0022727 Ga0495625_0022727_1956_2726 245
494 3300046684 Ga0495669_0002611 Ga0495669_0002611_4475_5245 245
495 3300046692 Ga0495671_0000020 Ga0495671_0000020_207417_208220 245
496 3300046694 Ga0495649_0105681 Ga0495649_0105681_201_971 245
497 3300047443 Ga0495687_000123 Ga0495687_000123_115456_116226 245
498 3300047443 Ga0495687_001696 Ga0495687_001696_6052_6816 245
499 3300047469 Ga0495673_0000316 Ga0495673_0000316_60087_60890 245
500 3300048903 Ga0496100_0022075 Ga0496100_0022075_703_1482 245
501 3300048916 Ga0496113_0017200 Ga0496113_0017200_3084_3899 245
502 3300048926 Ga0496123_0013924 Ga0496123_0013924_2821_3636 245
503 3300048926 Ga0496123_0027459 Ga0496123_0027459_3283_4047 245
504 3300048928 Ga0496125_0003122 Ga0496125_0003122_15346_16161 245
505 3300048928 Ga0496125_0111384 Ga0496125_0111384_955_1731 245
506 3300049569 Ga0501032_0062396 Ga0501032_0062396_1561_2331 245
507 3300049571 Ga0501034_0169312 Ga0501034_0169312_1302_2063 245
508 3300049572 Ga0501036_0028848 Ga0501036_0028848_493_1254 245
509 3300049573 Ga0501037_0033692 Ga0501037_0033692_966_1727 245
510 3300049575 Ga0501039_0102891 Ga0501039_0102891_187_948 245
511 3300049582 Ga0501048_0068987 Ga0501048_0068987_1343_2104 245
512 3300049822 Ga0501035_0330462 Ga0501035_0330462_58_816 245
513 3300049823 Ga0501044_0022440 Ga0501044_0022440_1920_2681 245
514 3300053087 Ga0500643_024575 Ga0500643_024575_499_1275 245
515 3300053125 Ga0500618_012028 Ga0500618_012028_1030_1806 245
516 3300053134 Ga0500658_0026087 Ga0500658_0026087_415_1176 245
517 3300053151 Ga0500604_0006284 Ga0500604_0006284_811_1623 245
518 3300053157 Ga0500624_000100 Ga0500624_000100_5030_5806 245
519 3300053158 Ga0500627_0000013 Ga0500627_0000013_2439_3200 245
520 3300053158 Ga0500627_0000446 Ga0500627_0000446_1559_2371 245
521 3300053177 Ga0500636_0101442 Ga0500636_0101442_639_1415 245
522 iso_pu_bacteria 2882806704 2882809190 246
523 2162886007 SwRhRL2b_contig_2722016 SwRhRL2b_0191.00007400 247
524 3300005335 Ga0070666_10041861 Ga0070666_100418613 247
525 3300005347 Ga0070668_100009037 Ga0070668_1000090375 247
526 3300005353 Ga0070669_100000074 Ga0070669_10000007453 247
527 3300005355 Ga0070671_100000375 Ga0070671_1000003757 247
528 3300005367 Ga0070667_100001796 Ga0070667_1000017965 247
529 3300005548 Ga0070665_100001089 Ga0070665_1000010897 247
530 3300005843 Ga0068860_100006579 Ga0068860_1000065795 247
531 3300005844 Ga0068862_100040562 Ga0068862_1000405623 247
532 3300009092 Ga0105250_10039071 Ga0105250_100390712 247
533 3300009101 Ga0105247_10000692 Ga0105247_1000069214 247
534 3300009177 Ga0105248_10045094 Ga0105248_100450943 247
535 3300009553 Ga0105249_10000002 Ga0105249_10000002193 247
536 3300009553 Ga0105249_10020736 Ga0105249_100207363 247
537 3300013306 Ga0163162_10051898 Ga0163162_100518983 247
538 3300014326 Ga0157380_10142985 Ga0157380_101429853 247
539 3300025711 Ga0207696_1001635 Ga0207696_100163511 247
540 3300025735 Ga0207713_1004070 Ga0207713_10040705 247
541 3300025903 Ga0207680_10020408 Ga0207680_100204084 247
542 3300025923 Ga0207681_10000120 Ga0207681_100001207 247
543 3300025931 Ga0207644_10021517 Ga0207644_100215175 247
544 3300025941 Ga0207711_10017110 Ga0207711_100171104 247
545 3300025972 Ga0207668_10000148 Ga0207668_1000014842 247
546 3300025986 Ga0207658_10000288 Ga0207658_1000028833 247
547 3300026088 Ga0207641_10481440 Ga0207641_104814402 247
548 3300028379 Ga0268266_10002543 Ga0268266_1000254317 247
549 3300028380 Ga0268265_10013242 Ga0268265_100132423 247
550 3300028381 Ga0268264_10004589 Ga0268264_100045895 247
551 3300046500 Ga0495596_0048300 Ga0495596_0048300_362_1141 247
552 3300046506 Ga0495583_0004928 Ga0495583_0004928_3780_4607 247
553 3300046506 Ga0495583_0045880 Ga0495583_0045880_614_1393 247
554 3300046507 Ga0495606_0025574 Ga0495606_0025574_2307_3107 247
555 3300047472 Ga0495686_0000177 Ga0495686_0000177_119755_120561 247
556 3300048903 Ga0496100_0008083 Ga0496100_0008083_661_1404 247
557 3300048904 Ga0496101_0159852 Ga0496101_0159852_238_981 247
558 3300048905 Ga0496102_0000209 Ga0496102_0000209_46390_47133 247
559 3300048906 Ga0496103_0000136 Ga0496103_0000136_53521_54264 247
560 3300048907 Ga0496104_0006964 Ga0496104_0006964_8249_8992 247
561 3300048910 Ga0496107_0032124 Ga0496107_0032124_1598_2341 247
562 3300048914 Ga0496111_0074968 Ga0496111_0074968_70_813 247
563 3300048915 Ga0496112_0010410 Ga0496112_0010410_5822_6565 247
564 3300048916 Ga0496113_0017296 Ga0496113_0017296_1621_2364 247
565 3300048918 Ga0496115_0091666 Ga0496115_0091666_690_1433 247
566 3300048920 Ga0496117_0000526 Ga0496117_0000526_15544_16287 247
567 3300048921 Ga0496118_0003002 Ga0496118_0003002_10576_11319 247
568 3300048922 Ga0496119_0017934 Ga0496119_0017934_978_1721 247
569 3300048923 Ga0496120_0100892 Ga0496120_0100892_509_1252 247
570 3300048924 Ga0496121_0006990 Ga0496121_0006990_12409_13152 247
571 3300048927 Ga0496124_0046207 Ga0496124_0046207_2578_3321 247
572 3300048928 Ga0496125_0025212 Ga0496125_0025212_4471_5214 247
573 3300048929 Ga0496126_0000365 Ga0496126_0000365_32520_33263 247
574 3300053735 Ga0500596_001300 Ga0500596_001300_4219_5031 247
575 3300055283 Ga0500661_015365 Ga0500661_015365_439_1251 247
576 iso_pu_bacteria 2643221560 2643820046 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

128

263

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v3z-assembly1.cif.gz_A structure of cannabinoid receptor type 1(cb1) 0.2729 1 188
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.2709 1 195
6kp6-assembly1.cif.gz_A the structural study of mutation induced inactivation of human muscarinic receptor m4 0.2641 9 157
7uwa-assembly1.cif.gz_j citrus v-atpase state 1, h in contact with subunits ab 0.253 11 186
4amj-assembly1.cif.gz_A turkey beta1 adrenergic receptor with stabilising mutations and bound biased agonist carvedilol 0.2378 5 162
ID Description Score Start End Superfamily
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3796 1 175 1.20.1070.10
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3675 1 175 1.20.1070.10
af_Q9VFE3_49_209_1.20.120.610 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);lithium bound rotor ring of v- atpase 0.2895 5 186 1.20.120.610
af_Q9VFE3_49_209_1.20.120.610 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);lithium bound rotor ring of v- atpase 0.2702 5 186 1.20.120.610
af_B0R167_7_318_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2506 1 184 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2E1YYS1-F1-model_v4 deleted 0.9866 8 173
AF-A0A085K306-F1-model_v4 deleted 0.9709 6 196
AF-A0A258HXE0-F1-model_v4 Sterol desaturase 0.9698 7 235 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A520JDM5-F1-model_v4 Fatty acid hydroxylase family protein 0.9659 8 239 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A2A4I489-F1-model_v4 Sterol desaturase 0.965 8 239 GO:0005506
GO:0008610
GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
82.77 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map