F465474

General Info

Members Datasets Scaffolds Average Seq Length
576 294 561 296

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10002353|JGI25405J52794_100023534
Length 347
Sequence MLRAPRAHDGIDMPEGDGRSAMPPGKAEIAMSGSLLETHKAQAQTWFEALRDDICAAFETLEADLPAGAPLADRAPGRFVRTPWSRTNHSGGQPTSDLPEIGNSSARSAKADPGGGGVMSIMKGRVFEKVGVHVSTVFGEFAPEFRKDIPGAEADPHFWASGISLIAHLHNPHVPAVHMNTRLVSTSKSWFGGGADLTPVLDARRRQDDPDTIAFHAAMXQACDAHARVAPYAKYKQWCDEYFYLKHRNEMRGIGGIFYDYLDSGDRAADFAFTQDVGRAFLRVYPELVRRNFATPWSEAEREEQLVRRGRYVEFNLLYDRGTIFGLRTGGNVDAILSSLPPVVKWP

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
4 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
5 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
6 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
7 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
8 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
9 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
10 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
11 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
12 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
13 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
279 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
280 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
281 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
282 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
285 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
286 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
294 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 1.39
Rhizoplane 8.33
Rhizosphere 80.03
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1011718 3300001915 Bacteria 1525
2 JGI24739J22299_10000994 3300001989 Bacteria 10559
3 JGI24737J22298_10002808 3300001990 Bacteria 6167
4 JGI25153J46596_10008989 3300003215 Bacteria 4704
5 JGI25405J52794_10002353 3300003911 Bacteria 3245
6 Ga0070658_10362565 3300005327 Bacteria 1241
7 Ga0070683_100160309 3300005329 Bacteria 2134
8 Ga0070670_100007802 3300005331 Bacteria 9106
9 Ga0070660_100056216 3300005339 Bacteria 3044
10 Ga0070659_100032517 3300005366 Bacteria 4047
11 Ga0070709_10002579 3300005434 Bacteria 9800
12 Ga0070709_10005804 3300005434 Bacteria 6688
13 Ga0070714_100008494 3300005435 Bacteria 8025
14 Ga0070714_100058980 3300005435 Bacteria 3290
15 Ga0070714_100071409 3300005435 Bacteria 3001
16 Ga0070713_100017576 3300005436 Bacteria 5412
17 Ga0070713_100023787 3300005436 Bacteria 4761
18 Ga0070713_100247239 3300005436 Bacteria 1626
19 Ga0070710_10000243 3300005437 Bacteria 25537
20 Ga0070711_100005828 3300005439 Bacteria 7394
21 Ga0070711_100039692 3300005439 Bacteria 3172
22 Ga0070711_100138558 3300005439 Bacteria 1821
23 Ga0070705_100039351 3300005440 Bacteria 2682
24 Ga0070662_100246732 3300005457 Bacteria 1434
25 Ga0070681_10039210 3300005458 Bacteria 4749
26 Ga0070706_100144696 3300005467 Bacteria 2220
27 Ga0070699_100010972 3300005518 Bacteria 7834
28 Ga0070699_100203202 3300005518 Bacteria 1762
29 Ga0070684_100010118 3300005535 Bacteria 7458
30 Ga0070684_100593075 3300005535 Bacteria 1030
31 Ga0068853_100280940 3300005539 Bacteria 1535
32 Ga0070695_100223666 3300005545 Bacteria 1357
33 Ga0070696_100016750 3300005546 Bacteria 4943
34 Ga0070696_100042295 3300005546 Bacteria 3151
35 Ga0070696_100129063 3300005546 Bacteria 1838
36 Ga0070704_100007997 3300005549 Bacteria 6315
37 Ga0068855_100020255 3300005563 Bacteria 7984
38 Ga0068855_100093688 3300005563 Bacteria 3464
39 Ga0068855_100120346 3300005563 Bacteria 3005
40 Ga0068857_100010911 3300005577 Bacteria 7909
41 Ga0068856_100000477 3300005614 Bacteria 44284
42 Ga0068856_100013826 3300005614 Bacteria 7803
43 Ga0068856_100112772 3300005614 Bacteria 2717
44 Ga0068856_100283985 3300005614 Bacteria 1672
45 Ga0068852_100124265 3300005616 Bacteria 2367
46 Ga0068858_100178235 3300005842 Bacteria 2006
47 Ga0081455_10001871 3300005937 Bacteria 25308
48 Ga0081455_10003729 3300005937 Bacteria 17413
49 Ga0081455_10011253 3300005937 Bacteria 9002
50 Ga0081455_10016554 3300005937 Bacteria 7113
51 Ga0081455_10034433 3300005937 Bacteria 4537
52 Ga0081455_10049916 3300005937 Bacteria 3603
53 Ga0081455_10053665 3300005937 Bacteria 3442
54 Ga0081455_10058158 3300005937 Bacteria 3273
55 Ga0081455_10140953 3300005937 Bacteria 1872
56 Ga0081540_1003265 3300005983 Bacteria 12889
57 Ga0081540_1003527 3300005983 Bacteria 12331
58 Ga0081539_10021209 3300005985 Bacteria 4351
59 Ga0070717_10000485 3300006028 Bacteria 25249
60 Ga0070717_10019455 3300006028 Bacteria 5324
61 Ga0070717_10066017 3300006028 Bacteria 3009
62 Ga0075365_10019686 3300006038 Bacteria 4172
63 Ga0075365_10203565 3300006038 Bacteria 1387
64 Ga0075368_10014502 3300006042 Bacteria 2913
65 Ga0070715_10001137 3300006163 Bacteria 7597
66 Ga0070715_10034945 3300006163 Bacteria 2064
67 Ga0070716_100016960 3300006173 Bacteria 3768
68 Ga0070716_100034233 3300006173 Bacteria 2784
69 Ga0070712_100197660 3300006175 Bacteria 1577
70 Ga0075367_10077723 3300006178 Bacteria 2004
71 Ga0075369_10028272 3300006186 Bacteria 2349
72 Ga0075428_100015591 3300006844 Bacteria 8426
73 Ga0075428_100805365 3300006844 Bacteria 998
74 Ga0075431_100000105 3300006847 Bacteria 53256
75 Ga0075431_100015573 3300006847 Bacteria 7706
76 Ga0075431_100464292 3300006847 Bacteria 1260
77 Ga0075434_100031153 3300006871 Bacteria 5256
78 Ga0075434_100035379 3300006871 Bacteria 4938
79 Ga0075434_100076481 3300006871 Bacteria 3343
80 Ga0075434_100112512 3300006871 Bacteria 2734
81 Ga0075434_100221889 3300006871 Bacteria 1910
82 Ga0075429_100002470 3300006880 Bacteria 15552
83 Ga0075435_100014832 3300007076 Bacteria 5841
84 Ga0075435_100031407 3300007076 Bacteria 4184
85 Ga0099794_10078031 3300007265 Bacteria 1630
86 Ga0105240_10031140 3300009093 Bacteria 6922
87 Ga0105240_10056305 3300009093 Bacteria 4921
88 Ga0105240_10238864 3300009093 Bacteria 2107
89 Ga0105240_10302561 3300009093 Bacteria 1829
90 Ga0111539_10011548 3300009094 Bacteria 11084
91 Ga0111539_10089968 3300009094 Bacteria 3607
92 Ga0111539_10103829 3300009094 Bacteria 3335
93 Ga0111539_10621501 3300009094 Bacteria 1258
94 Ga0105247_10046504 3300009101 Bacteria 2664
95 Ga0105247_10247070 3300009101 Bacteria 1218
96 Ga0114129_10002163 3300009147 Bacteria 27081
97 Ga0114129_10024067 3300009147 Bacteria 8629
98 Ga0114129_10026177 3300009147 Bacteria 8259
99 Ga0114129_10539122 3300009147 Bacteria 1519
100 Ga0105241_10422157 3300009174 Bacteria 1174
101 Ga0105248_10086403 3300009177 Bacteria 3529
102 Ga0105237_10029563 3300009545 Bacteria 5568
103 Ga0105237_10061989 3300009545 Bacteria 3739
104 Ga0105238_10017548 3300009551 Bacteria 7278
105 Ga0105238_10031279 3300009551 Bacteria 5418
106 Ga0105238_10041663 3300009551 Bacteria 4650
107 Ga0105238_10314565 3300009551 Bacteria 1551
108 Ga0105249_10001791 3300009553 Bacteria 18701
109 Ga0105239_10027064 3300010375 Bacteria 6313
110 Ga0105239_10034795 3300010375 Bacteria 5533
111 Ga0105239_10062423 3300010375 Bacteria 4090
112 Ga0105239_10632444 3300010375 Bacteria 1222
113 Ga0105246_10185311 3300011119 Bacteria 1606
114 Ga0157371_10067033 3300013102 Bacteria 2541
115 Ga0157369_10007048 3300013105 Bacteria 12962
116 Ga0157374_10014870 3300013296 Bacteria 6820
117 Ga0157372_10047014 3300013307 Bacteria 4793
118 Ga0157372_10134443 3300013307 Bacteria 2847
119 Ga0157375_10467960 3300013308 Bacteria 1426
120 Ga0157375_10827417 3300013308 Bacteria 1074
121 Ga0163163_10011174 3300014325 Bacteria 8131
122 Ga0157379_10091639 3300014968 Bacteria 2726
123 Ga0182005_1004233 3300015265 Bacteria 4684
124 Ga0213876_10007688 3300021384 Bacteria 5852
125 Ga0209233_1000933 3300025261 Bacteria 12708
126 Ga0209758_1050096 3300025297 Bacteria 1468
127 Ga0207653_10108344 3300025885 Bacteria 989
128 Ga0207692_10000282 3300025898 Bacteria 17493
129 Ga0207692_10003656 3300025898 Bacteria 6025
130 Ga0207692_10005126 3300025898 Bacteria 5229
131 Ga0207685_10006711 3300025905 Bacteria 3157
132 Ga0207685_10017678 3300025905 Bacteria 2312
133 Ga0207699_10000577 3300025906 Bacteria 18050
134 Ga0207705_10012022 3300025909 Bacteria 6254
135 Ga0207684_10154662 3300025910 Bacteria 1974
136 Ga0207695_10040729 3300025913 Bacteria 4977
137 Ga0207695_10247058 3300025913 Bacteria 1684
138 Ga0207671_10040116 3300025914 Bacteria 3466
139 Ga0207671_10090609 3300025914 Bacteria 2303
140 Ga0207671_10177214 3300025914 Bacteria 1658
141 Ga0207693_10021249 3300025915 Bacteria 5158
142 Ga0207663_10001206 3300025916 Bacteria 11940
143 Ga0207663_10008914 3300025916 Bacteria 5276
144 Ga0207657_10002856 3300025919 Bacteria 18574
145 Ga0207652_10063657 3300025921 Bacteria 3190
146 Ga0207694_10012428 3300025924 Bacteria 6417
147 Ga0207694_10017237 3300025924 Bacteria 5458
148 Ga0207694_10043771 3300025924 Bacteria 3456
149 Ga0207650_10060570 3300025925 Bacteria 2825
150 Ga0207700_10000848 3300025928 Bacteria 17629
151 Ga0207700_10013608 3300025928 Bacteria 5301
152 Ga0207700_10061229 3300025928 Bacteria 2854
153 Ga0207700_10205510 3300025928 Bacteria 1662
154 Ga0207700_10248908 3300025928 Bacteria 1518
155 Ga0207664_10006915 3300025929 Bacteria 7848
156 Ga0207664_10012974 3300025929 Bacteria 5970
157 Ga0207664_10112013 3300025929 Bacteria 2271
158 Ga0207665_10004132 3300025939 Bacteria 9671
159 Ga0207665_10013741 3300025939 Bacteria 5325
160 Ga0207665_10038971 3300025939 Bacteria 3166
161 Ga0207711_10033638 3300025941 Bacteria 4339
162 Ga0207661_10001720 3300025944 Bacteria 14979
163 Ga0207661_10278370 3300025944 Bacteria 1495
164 Ga0207667_10022560 3300025949 Bacteria 6950
165 Ga0207667_10061306 3300025949 Bacteria 3935
166 Ga0207667_10200742 3300025949 Bacteria 2046
167 Ga0207667_10543958 3300025949 Bacteria 1175
168 Ga0207712_10009741 3300025961 Bacteria 6089
169 Ga0207703_10122438 3300026035 Bacteria 2235
170 Ga0207678_10091745 3300026067 Bacteria 2596
171 Ga0207678_10234204 3300026067 Bacteria 1572
172 Ga0207702_10000744 3300026078 Bacteria 34789
173 Ga0207702_10046859 3300026078 Bacteria 3641
174 Ga0207702_10106923 3300026078 Bacteria 2480
175 Ga0207702_10189788 3300026078 Bacteria 1898
176 Ga0207676_10328372 3300026095 Bacteria 1407
177 Ga0207674_10017516 3300026116 Bacteria 7815
178 Ga0207698_10207371 3300026142 Bacteria 1760
179 Ga0207428_10012894 3300027907 Bacteria 7329
180 Ga0207428_10054962 3300027907 Bacteria 3168
181 Ga0265334_10015714 3300028573 Bacteria 3141
182 Ga0265336_10002175 3300028666 Bacteria 8281
183 Ga0265338_10000116 3300028800 Bacteria 146839
184 Ga0265324_10004388 3300029957 Bacteria 6398
185 Ga0265330_10017046 3300031235 Bacteria 3349
186 Ga0265332_10037816 3300031238 Bacteria 2093
187 Ga0265328_10020747 3300031239 Bacteria 2513
188 Ga0265328_10028367 3300031239 Bacteria 2094
189 Ga0265325_10033747 3300031241 Bacteria 2727
190 Ga0265325_10173613 3300031241 Bacteria 1007
191 Ga0265340_10007199 3300031247 Bacteria 6057
192 Ga0265340_10044483 3300031247 Bacteria 2172
193 Ga0265339_10005164 3300031249 Bacteria 8751
194 Ga0265339_10024640 3300031249 Bacteria 3464
195 Ga0265316_10005377 3300031344 Bacteria 12459
196 Ga0307509_10158340 3300031507 Bacteria 2167
197 Ga0265313_10009058 3300031595 Bacteria 6516
198 Ga0307508_10000008 3300031616 Bacteria 265023
199 Ga0265342_10006821 3300031712 Bacteria 8441
200 Ga0307516_10066581 3300031730 Bacteria 3474
201 Ga0307507_10204366 3300033179 Bacteria 1360
202 Ga0373926_0077522 3300035083 Bacteria 1226
203 Ga0373923_0087526 3300035111 Bacteria 1359
204 Ga0373936_0000741 3300035113 Bacteria 11445
205 Ga0373945_0004474 3300035116 Bacteria 4443
206 Ga0373953_0002125 3300035117 Bacteria 5926
207 Ga0373954_0000381 3300035118 Bacteria 16501
208 Ga0373954_0002341 3300035118 Bacteria 7915
209 Ga0373956_0020178 3300035119 Bacteria 2833
210 Ga0373956_0028172 3300035119 Bacteria 2443
211 Ga0373957_0007751 3300035120 Bacteria 3448
212 Ga0373943_0007879 3300035170 Bacteria 4781
213 Ga0373943_0020836 3300035170 Bacteria 3026
214 Ga0373943_0147219 3300035170 Bacteria 1273
215 Ga0373946_0001413 3300035171 Bacteria 8330
216 Ga0373946_0111034 3300035171 Bacteria 1241
217 Ga0373955_0000504 3300035172 Bacteria 16576
218 Ga0373955_0210592 3300035172 Bacteria 1159
219 Ga0373961_0009070 3300035241 Bacteria 2428
220 Ga0373962_0034220 3300035242 Bacteria 1406
221 Ga0373924_0000932 3300035410 Bacteria 9223
222 Ga0373931_0017094 3300035691 Bacteria 3580
223 Ga0373935_0000038 3300035692 Bacteria 51446
224 Ga0373935_0061409 3300035692 Bacteria 2406
225 Ga0373935_0180986 3300035692 Bacteria 1447
226 Ga0373935_0228156 3300035692 Bacteria 1296
227 Ga0373935_0366764 3300035692 Bacteria 1029
228 Ga0373935_0371763 3300035692 Bacteria 1022
229 Ga0373927_0031221 3300035695 Bacteria 3473
230 Ga0373927_0039237 3300035695 Bacteria 3073
231 Ga0373927_0046710 3300035695 Bacteria 2801
232 Ga0373927_0200405 3300035695 Bacteria 1310
233 Ga0373933_0007615 3300035724 Bacteria 5912
234 Ga0373947_0000229 3300035725 Bacteria 31423
235 Ga0373947_0126027 3300035725 Bacteria 1631
236 Ga0373947_0143869 3300035725 Bacteria 1531
237 Ga0373937_0000004 3300036401 Bacteria 212269
238 Ga0373937_0001725 3300036401 Bacteria 18379
239 Ga0373925_0290686 3300037068 Bacteria 1318
240 Ga0395900_0107503 3300037418 Bacteria 2866
241 Ga0395900_0122865 3300037418 Bacteria 2663
242 Ga0395898_0006221 3300037466 Bacteria 12787
243 Ga0436364_0817478 3300037853 Bacteria 3584
244 Ga0395901_0074714 3300038443 Bacteria 3536
245 Ga0395901_0111508 3300038443 Bacteria 2873
246 Ga0395901_0315186 3300038443 Bacteria 1619
247 Ga0436365_0271615 3300039437 Bacteria 1358
248 Ga0436365_0788813 3300039437 Bacteria 7082
249 Ga0436361_0407903 3300039447 Bacteria 3899
250 Ga0436363_0335225 3300039450 Bacteria 1460
251 Ga0439465_0002288 3300041413 Bacteria 6290
252 Ga0451807_1983576 3300041486 Bacteria 1927
253 Ga0466966_0260931 3300044684 Bacteria 1043
254 Ga0466963_0121054 3300044694 Bacteria 1801
255 Ga0466959_0027870 3300045049 Bacteria 4190
256 Ga0466959_0133557 3300045049 Bacteria 1758
257 Ga0495603_0002928 3300046455 Bacteria 10092
258 Ga0495603_0016023 3300046455 Bacteria 4532
259 Ga0495603_0179929 3300046455 Bacteria 1223
260 Ga0495629_0001232 3300046459 Bacteria 20103
261 Ga0495629_0055936 3300046459 Bacteria 2759
262 Ga0495638_0027817 3300046460 Bacteria 3657
263 Ga0495641_0088667 3300046461 Bacteria 1383
264 Ga0495651_0000799 3300046462 Bacteria 24378
265 Ga0495651_0001901 3300046462 Bacteria 16158
266 Ga0495651_0034560 3300046462 Bacteria 3940
267 Ga0495651_0115534 3300046462 Bacteria 1979
268 Ga0495651_0123862 3300046462 Bacteria 1895
269 Ga0495653_0000012 3300046463 Bacteria 266880
270 Ga0495653_0001172 3300046463 Bacteria 20251
271 Ga0495653_0018454 3300046463 Bacteria 5664
272 Ga0495580_0068755 3300046472 Bacteria 2476
273 Ga0495582_0031519 3300046473 Bacteria 2914
274 Ga0495639_0027847 3300046475 Bacteria 2502
275 Ga0495639_0047220 3300046475 Bacteria 1950
276 Ga0495662_0020452 3300046476 Bacteria 3202
277 Ga0495662_0032039 3300046476 Bacteria 2539
278 Ga0495664_0000004 3300046477 Bacteria 489411
279 Ga0495664_0119968 3300046477 Bacteria 1590
280 Ga0495585_0092313 3300046492 Bacteria 1629
281 Ga0495608_0000017 3300046511 Bacteria 192929
282 Ga0495608_0000272 3300046511 Bacteria 36948
283 Ga0495618_0000006 3300046514 Bacteria 229906
284 Ga0495628_0000001 3300046516 Bacteria 917742
285 Ga0495628_0021841 3300046516 Bacteria 5260
286 Ga0495628_0304198 3300046516 Bacteria 1180
287 Ga0495630_0005871 3300046517 Bacteria 8684
288 Ga0495630_0163928 3300046517 Bacteria 1692
289 Ga0495652_0000002 3300046529 Bacteria 946606
290 Ga0495652_0045854 3300046529 Bacteria 3755
291 Ga0495652_0333000 3300046529 Bacteria 1093
292 Ga0495665_0022181 3300046531 Bacteria 3414
293 Ga0495640_0000001 3300046533 Bacteria 853827
294 Ga0495587_0000008 3300046536 Bacteria 271097
295 Ga0495587_0007120 3300046536 Bacteria 7256
296 Ga0495598_0001843 3300046537 Bacteria 4269
297 Ga0495645_0000002 3300046543 Bacteria 651644
298 Ga0495645_0135871 3300046543 Bacteria 1720
299 Ga0495633_0077761 3300046558 Bacteria 1545
300 Ga0495667_0000124 3300046559 Bacteria 55660
301 Ga0495667_0011432 3300046559 Bacteria 6006
302 Ga0495667_0061363 3300046559 Bacteria 2465
303 Ga0495656_0004314 3300046615 Bacteria 4861
304 Ga0495668_0160577 3300046616 Bacteria 1231
305 Ga0495634_0000003 3300046642 Bacteria 206222
306 Ga0495634_0014482 3300046642 Bacteria 5685
307 Ga0495635_0000002 3300046663 Bacteria 490490
308 Ga0495635_0000500 3300046663 Bacteria 24766
309 Ga0495635_0004998 3300046663 Bacteria 9230
310 Ga0495635_0174731 3300046663 Bacteria 1460
311 Ga0495588_0170737 3300046674 Bacteria 1150
312 Ga0495657_0000054 3300046675 Bacteria 99620
313 Ga0495657_0014481 3300046675 Bacteria 5789
314 Ga0495657_0034655 3300046675 Bacteria 3504
315 Ga0495657_0229789 3300046675 Bacteria 1122
316 Ga0495599_0000005 3300046678 Bacteria 300169
317 Ga0495599_0018645 3300046678 Bacteria 4323
318 Ga0495623_0000148 3300046679 Bacteria 43192
319 Ga0495623_0005093 3300046679 Bacteria 8622
320 Ga0495646_0000002 3300046680 Bacteria 310568
321 Ga0495647_0004214 3300046681 Bacteria 4657
322 Ga0495658_0002178 3300046683 Bacteria 9911
323 Ga0495658_0006226 3300046683 Bacteria 5863
324 Ga0495669_0059400 3300046684 Bacteria 1727
325 Ga0495613_0014301 3300046689 Bacteria 5889
326 Ga0495613_0015932 3300046689 Bacteria 5597
327 Ga0495613_0102094 3300046689 Bacteria 2071
328 Ga0495624_0008567 3300046690 Bacteria 7121
329 Ga0495624_0056351 3300046690 Bacteria 2473
330 Ga0495624_0068661 3300046690 Bacteria 2209
331 Ga0495624_0127588 3300046690 Bacteria 1560
332 Ga0495670_0011251 3300046691 Bacteria 4398
333 Ga0495589_0122430 3300046794 Bacteria 1252
334 Ga0495600_0000012 3300046809 Bacteria 119798
335 Ga0495600_0001148 3300046809 Bacteria 14481
336 Ga0495581_0026555 3300047315 Bacteria 3356
337 Ga0495604_0000009 3300047317 Bacteria 326341
338 Ga0495604_0004436 3300047317 Bacteria 11115
339 Ga0495604_0051100 3300047317 Bacteria 3206
340 Ga0495674_0000002 3300047319 Bacteria 642785
341 Ga0495680_0001385 3300047322 Bacteria 26203
342 Ga0495680_0001508 3300047322 Bacteria 24960
343 Ga0495675_0000028 3300047444 Bacteria 105848
344 Ga0495675_0000362 3300047444 Bacteria 31645
345 Ga0495684_0000006 3300047471 Bacteria 247568
346 Ga0495684_0028479 3300047471 Bacteria 4288
347 Ga0495684_0248044 3300047471 Bacteria 1296
348 Ga0495686_0023990 3300047472 Bacteria 4012
349 Ga0495593_0000140 3300047673 Bacteria 35205
350 Ga0495593_0050350 3300047673 Bacteria 2207
351 Ga0495602_0000005 3300048088 Bacteria 325957
352 Ga0495602_0005892 3300048088 Bacteria 12874
353 Ga0495602_0042945 3300048088 Bacteria 4115
354 Ga0495602_0122658 3300048088 Bacteria 2088
355 Ga0495614_0084288 3300048089 Bacteria 1379
356 Ga0496100_0015421 3300048903 Bacteria 4462
357 Ga0496100_0029450 3300048903 Bacteria 3396
358 Ga0496100_0041015 3300048903 Bacteria 2948
359 Ga0496100_0171275 3300048903 Bacteria 1564
360 Ga0496101_0002395 3300048904 Bacteria 11503
361 Ga0496101_0010276 3300048904 Bacteria 6179
362 Ga0496102_0002614 3300048905 Bacteria 15316
363 Ga0496102_0089830 3300048905 Bacteria 2842
364 Ga0496102_0215790 3300048905 Bacteria 1808
365 Ga0496103_0021349 3300048906 Bacteria 3894
366 Ga0496104_0021951 3300048907 Bacteria 5863
367 Ga0496104_0066189 3300048907 Bacteria 3430
368 Ga0496104_0091129 3300048907 Bacteria 2913
369 Ga0496105_0003019 3300048908 Bacteria 12365
370 Ga0496105_0007082 3300048908 Bacteria 8644
371 Ga0496105_0013076 3300048908 Bacteria 6581
372 Ga0496105_0032830 3300048908 Bacteria 4260
373 Ga0496106_0001912 3300048909 Bacteria 15607
374 Ga0496106_0003207 3300048909 Bacteria 12247
375 Ga0496106_0018657 3300048909 Bacteria 5135
376 Ga0496106_0061023 3300048909 Bacteria 2859
377 Ga0496106_0079659 3300048909 Bacteria 2515
378 Ga0496107_0000684 3300048910 Bacteria 19232
379 Ga0496107_0008466 3300048910 Bacteria 7119
380 Ga0496108_0000951 3300048911 Bacteria 22499
381 Ga0496108_0002201 3300048911 Bacteria 15605
382 Ga0496109_0036779 3300048912 Bacteria 4420
383 Ga0496109_0109183 3300048912 Bacteria 2571
384 Ga0496109_0174491 3300048912 Bacteria 2017
385 Ga0496110_0025021 3300048913 Bacteria 5096
386 Ga0496110_0049864 3300048913 Bacteria 3674
387 Ga0496110_0177180 3300048913 Bacteria 1935
388 Ga0496111_0007619 3300048914 Bacteria 7113
389 Ga0496111_0088518 3300048914 Bacteria 2268
390 Ga0496112_0006785 3300048915 Bacteria 10091
391 Ga0496112_0023680 3300048915 Bacteria 5872
392 Ga0496112_0085546 3300048915 Bacteria 3120
393 Ga0496113_0000043 3300048916 Bacteria 52544
394 Ga0496113_0003867 3300048916 Bacteria 9067
395 Ga0496113_0017042 3300048916 Bacteria 5033
396 Ga0496114_0029897 3300048917 Bacteria 4479
397 Ga0496114_0072474 3300048917 Bacteria 2897
398 Ga0496114_0098816 3300048917 Bacteria 2489
399 Ga0496115_0017339 3300048918 Bacteria 5503
400 Ga0496115_0130197 3300048918 Bacteria 2074
401 Ga0496115_0136450 3300048918 Bacteria 2023
402 Ga0496118_0008409 3300048921 Bacteria 10672
403 Ga0496119_0038526 3300048922 Bacteria 3087
404 Ga0496120_0007337 3300048923 Bacteria 8224
405 Ga0496121_0000104 3300048924 Bacteria 192186
406 Ga0496121_0000365 3300048924 Bacteria 92822
407 Ga0496121_0000881 3300048924 Bacteria 54361
408 Ga0496121_0001293 3300048924 Bacteria 43066
409 Ga0496121_0221079 3300048924 Bacteria 1334
410 Ga0496122_0019295 3300048925 Bacteria 6237
411 Ga0496124_0002671 3300048927 Bacteria 22854
412 Ga0496124_0029811 3300048927 Bacteria 4854
413 Ga0496124_0286484 3300048927 Bacteria 1198
414 Ga0496125_0019036 3300048928 Bacteria 6496
415 Ga0496126_0009177 3300048929 Bacteria 10550
416 Ga0496126_0080901 3300048929 Bacteria 2873
417 Ga0496126_0110937 3300048929 Bacteria 2389
418 Ga0496126_0233642 3300048929 Bacteria 1539
419 Ga0501031_0002596 3300049568 Bacteria 11509
420 Ga0501032_0000366 3300049569 Bacteria 37562
421 Ga0501032_0098879 3300049569 Bacteria 1933
422 Ga0501033_0000707 3300049570 Bacteria 30694
423 Ga0501033_0089241 3300049570 Bacteria 2255
424 Ga0501034_0000332 3300049571 Bacteria 82900
425 Ga0501034_0009154 3300049571 Bacteria 10389
426 Ga0501034_0029876 3300049571 Bacteria 5540
427 Ga0501034_0049799 3300049571 Bacteria 4227
428 Ga0501034_0051508 3300049571 Bacteria 4151
429 Ga0501036_0000220 3300049572 Bacteria 38322
430 Ga0501036_0053292 3300049572 Bacteria 3426
431 Ga0501036_0069688 3300049572 Bacteria 2974
432 Ga0501037_0000054 3300049573 Bacteria 109898
433 Ga0501037_0001926 3300049573 Bacteria 15044
434 Ga0501037_0051222 3300049573 Bacteria 3020
435 Ga0501038_0002737 3300049574 Bacteria 16426
436 Ga0501038_0055484 3300049574 Bacteria 3403
437 Ga0501038_0062439 3300049574 Bacteria 3183
438 Ga0501038_0063864 3300049574 Bacteria 3142
439 Ga0501038_0069285 3300049574 Bacteria 2996
440 Ga0501038_0134334 3300049574 Bacteria 2028
441 Ga0501038_0137169 3300049574 Bacteria 2003
442 Ga0501038_0451786 3300049574 Bacteria 988
443 Ga0501039_0475807 3300049575 Bacteria 981
444 Ga0501043_0000338 3300049579 Bacteria 42452
445 Ga0501043_0018792 3300049579 Bacteria 5424
446 Ga0501043_0026568 3300049579 Bacteria 4542
447 Ga0501043_0037069 3300049579 Bacteria 3836
448 Ga0501043_0130559 3300049579 Bacteria 1969
449 Ga0501043_0383847 3300049579 Bacteria 1063
450 Ga0501046_0000011 3300049580 Bacteria 326457
451 Ga0501046_0000087 3300049580 Bacteria 99252
452 Ga0501047_0001092 3300049581 Bacteria 27014
453 Ga0501047_0026666 3300049581 Bacteria 5561
454 Ga0501047_0052499 3300049581 Bacteria 3940
455 Ga0501047_0060428 3300049581 Bacteria 3657
456 Ga0501047_0236321 3300049581 Bacteria 1679
457 Ga0501048_0001217 3300049582 Bacteria 19492
458 Ga0501048_0009539 3300049582 Bacteria 7285
459 Ga0501067_0001618 3300049583 Bacteria 12343
460 Ga0501067_0065573 3300049583 Bacteria 2010
461 Ga0501068_0000069 3300049584 Bacteria 40615
462 Ga0501069_0007811 3300049585 Bacteria 5616
463 Ga0501070_0045569 3300049586 Bacteria 3647
464 Ga0501070_0047258 3300049586 Bacteria 3578
465 Ga0501070_0195930 3300049586 Bacteria 1659
466 Ga0501070_0381089 3300049586 Bacteria 1142
467 Ga0501070_0417179 3300049586 Bacteria 1084
468 Ga0501071_0049661 3300049587 Bacteria 3020
469 Ga0501072_0010024 3300049588 Bacteria 7207
470 Ga0501072_0045316 3300049588 Bacteria 3457
471 Ga0501073_0000112 3300049589 Bacteria 52280
472 Ga0501073_0007067 3300049589 Bacteria 8363
473 Ga0501073_0019544 3300049589 Bacteria 4889
474 Ga0501073_0027377 3300049589 Bacteria 4076
475 Ga0501073_0035773 3300049589 Bacteria 3528
476 Ga0501073_0133750 3300049589 Bacteria 1719
477 Ga0501074_0003367 3300049590 Bacteria 11324
478 Ga0501074_0015427 3300049590 Bacteria 5553
479 Ga0501074_0020775 3300049590 Bacteria 4770
480 Ga0501074_0131798 3300049590 Bacteria 1788
481 Ga0501079_0001029 3300049741 Bacteria 19331
482 Ga0501079_0180654 3300049741 Bacteria 1646
483 Ga0501079_0319383 3300049741 Bacteria 1216
484 Ga0501080_0001149 3300049742 Bacteria 21844
485 Ga0501080_0003274 3300049742 Bacteria 14300
486 Ga0501080_0060868 3300049742 Bacteria 3515
487 Ga0501080_0063417 3300049742 Bacteria 3439
488 Ga0501080_0099160 3300049742 Bacteria 2703
489 Ga0501080_0118209 3300049742 Bacteria 2457
490 Ga0501080_0144572 3300049742 Bacteria 2198
491 Ga0501083_0008891 3300049744 Bacteria 7093
492 Ga0501083_0009300 3300049744 Bacteria 6937
493 Ga0501083_0022562 3300049744 Bacteria 4368
494 Ga0501083_0049616 3300049744 Bacteria 2828
495 Ga0501083_0197461 3300049744 Bacteria 1312
496 Ga0501035_0001855 3300049822 Bacteria 21278
497 Ga0501035_0014587 3300049822 Bacteria 7252
498 Ga0501035_0016398 3300049822 Bacteria 6834
499 Ga0501035_0044722 3300049822 Bacteria 3986
500 Ga0501035_0081878 3300049822 Bacteria 2848
501 Ga0501035_0157443 3300049822 Bacteria 1968
502 Ga0501044_0000163 3300049823 Bacteria 82581
503 Ga0501044_0012345 3300049823 Bacteria 9247
504 Ga0501044_0038026 3300049823 Bacteria 5026
505 Ga0501044_0049022 3300049823 Bacteria 4359
506 Ga0501044_0160361 3300049823 Bacteria 2226
507 Ga0501045_0003296 3300049824 Bacteria 11026
508 nmdc:mga00v17_21264_c1 3300050491 Bacteria 3728
509 nmdc:mga0yw44_1178_c1 3300050492 Bacteria 10193
510 nmdc:mga0yw44_215220_c1 3300050492 Bacteria 1272
511 nmdc:mga0yw44_28448_c1 3300050492 Bacteria 3215
512 nmdc:mga06z11_32863_c1 3300050494 Bacteria 2533
513 nmdc:mga04h51_21686_c1 3300050495 Bacteria 1935
514 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
515 nmdc:mga05p37_267187_c1 3300050507 Bacteria 2045
516 nmdc:mga05p37_533808_c1 3300050507 Bacteria 1339
517 nmdc:mga09592_1649_c1 3300050508 Bacteria 17953
518 nmdc:mga06r32_107119_c1 3300050510 Bacteria 2746
519 nmdc:mga06r32_719_c1 3300050510 Bacteria 29006
520 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
521 nmdc:mga08y16_7940_c1 3300050511 Bacteria 11107
522 nmdc:mga0n895_150524_c1 3300050512 Bacteria 2357
523 nmdc:mga0n895_234560_c1 3300050512 Bacteria 1862
524 nmdc:mga0n895_296488_c1 3300050512 Bacteria 1639
525 nmdc:mga0n895_3613_c1 3300050512 Bacteria 12500
526 nmdc:mga0n895_80372_c1 3300050512 Bacteria 3248
527 nmdc:mga0n895_94631_c1 3300050512 Bacteria 2991
528 nmdc:mga0rr50_249584_c1 3300050513 Bacteria 1473
529 nmdc:mga0rr50_38037_c1 3300050513 Bacteria 3478
530 nmdc:mga0sz30_56585_c1 3300050516 Bacteria 1670
531 Ga0495601_0000002 3300053077 Bacteria 528704
532 Ga0495601_0001735 3300053077 Bacteria 12053
533 Ga0495601_0247737 3300053077 Bacteria 1163
534 Ga0495612_0000010 3300053078 Bacteria 227618
535 Ga0495612_0066243 3300053078 Bacteria 1501
536 Ga0500635_0001213 3300053080 Bacteria 6165
537 Ga0495595_0000026 3300053084 Bacteria 99949
538 Ga0495619_0000019 3300053085 Bacteria 209518
539 Ga0495619_0000743 3300053085 Bacteria 21213
540 Ga0495619_0038918 3300053085 Bacteria 3103
541 Ga0500566_0001828 3300053094 Bacteria 12511
542 Ga0500566_0172451 3300053094 Bacteria 1117
543 Ga0500641_0016917 3300053096 Bacteria 2719
544 Ga0500648_036088 3300053097 Bacteria 2798
545 Ga0500562_036998 3300053108 Bacteria 1295
546 Ga0500597_121197 3300053120 Bacteria 1133
547 Ga0500559_0031655 3300053136 Bacteria 2269
548 Ga0500573_0025465 3300053140 Bacteria 3401
549 Ga0500603_000400 3300053150 Bacteria 11359
550 Ga0500604_0026077 3300053151 Bacteria 1683
551 Ga0500616_0015009 3300053153 Bacteria 4439
552 Ga0500616_0046623 3300053153 Bacteria 2303
553 Ga0500636_0066452 3300053177 Bacteria 2096
554 Ga0500637_0001951 3300053178 Bacteria 8975
555 Ga0501084_0012713 3300054114 Bacteria 6973
556 Ga0501084_0013592 3300054114 Bacteria 6737
557 Ga0501084_0067860 3300054114 Bacteria 2985
558 Ga0501082_0015541 3300060353 Bacteria 6554
559 Ga0501082_0138331 3300060353 Bacteria 2113
560 Ga0501082_0230013 3300060353 Bacteria 1614
561 Ga0530510_0239553 3300061734 Bacteria 1350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006042 Ga0075368_10014502 Ga0075368_100145022 254
2 3300050495 nmdc:mga04h51_21686_c1 nmdc:mga04h51_21686_c1_304_1212 254
3 3300005563 Ga0068855_100093688 Ga0068855_1000936883 256
4 3300025949 Ga0207667_10200742 Ga0207667_102007422 256
5 3300049580 Ga0501046_0000011 Ga0501046_0000011_164216_165124 260
6 3300049822 Ga0501035_0081878 Ga0501035_0081878_1982_2836 262
7 3300050492 nmdc:mga0yw44_215220_c1 nmdc:mga0yw44_215220_c1_276_1184 262
8 3300053153 Ga0500616_0046623 Ga0500616_0046623_957_1886 262
9 3300005546 Ga0070696_100129063 Ga0070696_1001290631 263
10 3300049744 Ga0501083_0049616 Ga0501083_0049616_1425_2330 265
11 3300049571 Ga0501034_0009154 Ga0501034_0009154_1706_2593 266
12 3300049572 Ga0501036_0053292 Ga0501036_0053292_1781_2668 266
13 3300049574 Ga0501038_0055484 Ga0501038_0055484_618_1505 266
14 3300049581 Ga0501047_0060428 Ga0501047_0060428_1966_2853 266
15 3300049586 Ga0501070_0381089 Ga0501070_0381089_88_975 266
16 3300049588 Ga0501072_0045316 Ga0501072_0045316_403_1308 266
17 3300049744 Ga0501083_0197461 Ga0501083_0197461_260_1165 266
18 3300049823 Ga0501044_0049022 Ga0501044_0049022_2335_3222 266
19 3300054114 Ga0501084_0067860 Ga0501084_0067860_1161_2066 266
20 3300009545 Ga0105237_10029563 Ga0105237_100295634 267
21 3300025914 Ga0207671_10040116 Ga0207671_100401164 267
22 3300048924 Ga0496121_0000881 Ga0496121_0000881_10943_11830 267
23 3300049579 Ga0501043_0026568 Ga0501043_0026568_2360_3232 267
24 3300006173 Ga0070716_100034233 Ga0070716_1000342332 268
25 3300025939 Ga0207665_10038971 Ga0207665_100389712 268
26 3300046690 Ga0495624_0008567 Ga0495624_0008567_638_1504 268
27 3300048918 Ga0496115_0136450 Ga0496115_0136450_242_1129 268
28 3300005467 Ga0070706_100144696 Ga0070706_1001446963 269
29 3300006871 Ga0075434_100076481 Ga0075434_1000764813 269
30 3300025910 Ga0207684_10154662 Ga0207684_101546622 269
31 3300050512 nmdc:mga0n895_3613_c1 nmdc:mga0n895_3613_c1_1561_2448 269
32 3300007076 Ga0075435_100031407 Ga0075435_1000314074 270
33 3300009094 Ga0111539_10103829 Ga0111539_101038293 270
34 3300025261 Ga0209233_1000933 Ga0209233_100093310 270
35 3300025924 Ga0207694_10012428 Ga0207694_100124284 270
36 3300050513 nmdc:mga0rr50_38037_c1 nmdc:mga0rr50_38037_c1_494_1372 270
37 3300028573 Ga0265334_10015714 Ga0265334_100157142 271
38 3300028666 Ga0265336_10002175 Ga0265336_100021759 271
39 3300028800 Ga0265338_10000116 Ga0265338_10000116111 271
40 3300029957 Ga0265324_10004388 Ga0265324_100043884 271
41 3300031616 Ga0307508_10000008 Ga0307508_10000008105 271
42 3300009093 Ga0105240_10302561 Ga0105240_103025612 272
43 3300010375 Ga0105239_10632444 Ga0105239_106324442 272
44 3300031730 Ga0307516_10066581 Ga0307516_100665812 272
45 3300044684 Ga0466966_0260931 Ga0466966_0260931_40_927 272
46 3300045049 Ga0466959_0027870 Ga0466959_0027870_1039_1926 272
47 3300046462 Ga0495651_0034560 Ga0495651_0034560_567_1466 272
48 3300046516 Ga0495628_0304198 Ga0495628_0304198_212_1099 272
49 3300046663 Ga0495635_0004998 Ga0495635_0004998_5881_6780 272
50 3300046675 Ga0495657_0034655 Ga0495657_0034655_2560_3459 272
51 3300046689 Ga0495613_0014301 Ga0495613_0014301_4143_5042 272
52 3300046690 Ga0495624_0056351 Ga0495624_0056351_79_978 272
53 3300047317 Ga0495604_0051100 Ga0495604_0051100_1570_2469 272
54 3300048088 Ga0495602_0042945 Ga0495602_0042945_3064_3963 272
55 3300048907 Ga0496104_0091129 Ga0496104_0091129_1863_2762 272
56 3300048908 Ga0496105_0013076 Ga0496105_0013076_3210_4109 272
57 3300048922 Ga0496119_0038526 Ga0496119_0038526_2137_3024 272
58 3300048923 Ga0496120_0007337 Ga0496120_0007337_1538_2437 272
59 3300048929 Ga0496126_0080901 Ga0496126_0080901_1844_2743 272
60 3300010375 Ga0105239_10062423 Ga0105239_100624232 273
61 3300031249 Ga0265339_10024640 Ga0265339_100246404 273
62 3300033179 Ga0307507_10204366 Ga0307507_102043661 273
63 3300035170 Ga0373943_0020836 Ga0373943_0020836_632_1519 273
64 3300035692 Ga0373935_0366764 Ga0373935_0366764_15_902 273
65 3300035692 Ga0373935_0371763 Ga0373935_0371763_84_971 273
66 3300035695 Ga0373927_0039237 Ga0373927_0039237_1931_2818 273
67 3300035725 Ga0373947_0126027 Ga0373947_0126027_362_1249 273
68 3300044694 Ga0466963_0121054 Ga0466963_0121054_129_1016 273
69 3300046455 Ga0495603_0016023 Ga0495603_0016023_374_1261 273
70 3300046475 Ga0495639_0047220 Ga0495639_0047220_831_1718 273
71 3300046559 Ga0495667_0061363 Ga0495667_0061363_17_904 273
72 3300046674 Ga0495588_0170737 Ga0495588_0170737_171_1058 273
73 3300046689 Ga0495613_0102094 Ga0495613_0102094_625_1512 273
74 3300046690 Ga0495624_0068661 Ga0495624_0068661_1192_2079 273
75 3300048909 Ga0496106_0003207 Ga0496106_0003207_2862_3749 273
76 3300048921 Ga0496118_0008409 Ga0496118_0008409_2840_3727 273
77 3300048924 Ga0496121_0001293 Ga0496121_0001293_2837_3724 273
78 3300048927 Ga0496124_0002671 Ga0496124_0002671_128_1015 273
79 3300048928 Ga0496125_0019036 Ga0496125_0019036_556_1443 273
80 3300048929 Ga0496126_0233642 Ga0496126_0233642_492_1379 273
81 3300053094 Ga0500566_0172451 Ga0500566_0172451_152_1039 273
82 3300053097 Ga0500648_036088 Ga0500648_036088_1279_2166 273
83 3300053120 Ga0500597_121197 Ga0500597_121197_219_1106 273
84 3300053136 Ga0500559_0031655 Ga0500559_0031655_69_956 273
85 3300053140 Ga0500573_0025465 Ga0500573_0025465_1295_2182 273
86 3300053177 Ga0500636_0066452 Ga0500636_0066452_411_1298 273
87 3300005327 Ga0070658_10362565 Ga0070658_103625652 274
88 3300005339 Ga0070660_100056216 Ga0070660_1000562163 274
89 3300005366 Ga0070659_100032517 Ga0070659_1000325175 274
90 3300005614 Ga0068856_100000477 Ga0068856_10000047713 274
91 3300009551 Ga0105238_10031279 Ga0105238_100312796 274
92 3300025909 Ga0207705_10012022 Ga0207705_100120224 274
93 3300025919 Ga0207657_10002856 Ga0207657_1000285613 274
94 3300025924 Ga0207694_10017237 Ga0207694_100172372 274
95 3300025949 Ga0207667_10022560 Ga0207667_100225606 274
96 3300026067 Ga0207678_10091745 Ga0207678_100917452 274
97 3300026078 Ga0207702_10000744 Ga0207702_100007449 274
98 3300031238 Ga0265332_10037816 Ga0265332_100378163 274
99 3300031239 Ga0265328_10020747 Ga0265328_100207474 274
100 3300031241 Ga0265325_10173613 Ga0265325_101736132 274
101 3300049571 Ga0501034_0029876 Ga0501034_0029876_2146_3060 274
102 3300049579 Ga0501043_0383847 Ga0501043_0383847_46_960 274
103 iso_pu_bacteria 2894772417 2894777563 274
104 3300013296 Ga0157374_10014870 Ga0157374_100148705 275
105 3300025928 Ga0207700_10205510 Ga0207700_102055102 275
106 3300035083 Ga0373926_0077522 Ga0373926_0077522_236_1123 275
107 3300035113 Ga0373936_0000741 Ga0373936_0000741_8113_9000 275
108 3300035116 Ga0373945_0004474 Ga0373945_0004474_1292_2179 275
109 3300035117 Ga0373953_0002125 Ga0373953_0002125_739_1626 275
110 3300035118 Ga0373954_0002341 Ga0373954_0002341_6861_7748 275
111 3300035170 Ga0373943_0007879 Ga0373943_0007879_3785_4672 275
112 3300035171 Ga0373946_0001413 Ga0373946_0001413_6563_7450 275
113 3300035172 Ga0373955_0000504 Ga0373955_0000504_4204_5091 275
114 3300035410 Ga0373924_0000932 Ga0373924_0000932_6734_7621 275
115 3300035692 Ga0373935_0000038 Ga0373935_0000038_48992_49879 275
116 3300035695 Ga0373927_0031221 Ga0373927_0031221_15_902 275
117 3300035725 Ga0373947_0000229 Ga0373947_0000229_7047_7934 275
118 3300036401 Ga0373937_0000004 Ga0373937_0000004_64825_65712 275
119 3300037418 Ga0395900_0107503 Ga0395900_0107503_1141_2028 275
120 3300046459 Ga0495629_0001232 Ga0495629_0001232_9345_10232 275
121 3300046462 Ga0495651_0000799 Ga0495651_0000799_14494_15381 275
122 3300046463 Ga0495653_0000012 Ga0495653_0000012_202609_203496 275
123 3300046476 Ga0495662_0020452 Ga0495662_0020452_2304_3191 275
124 3300046477 Ga0495664_0000004 Ga0495664_0000004_178821_179708 275
125 3300046511 Ga0495608_0000017 Ga0495608_0000017_178808_179695 275
126 3300046514 Ga0495618_0000006 Ga0495618_0000006_137914_138801 275
127 3300046516 Ga0495628_0000001 Ga0495628_0000001_178810_179697 275
128 3300046517 Ga0495630_0005871 Ga0495630_0005871_3277_4164 275
129 3300046529 Ga0495652_0000002 Ga0495652_0000002_393344_394231 275
130 3300046533 Ga0495640_0000001 Ga0495640_0000001_487348_488235 275
131 3300046536 Ga0495587_0000008 Ga0495587_0000008_179028_179915 275
132 3300046543 Ga0495645_0000002 Ga0495645_0000002_178823_179710 275
133 3300046559 Ga0495667_0000124 Ga0495667_0000124_27244_28131 275
134 3300046642 Ga0495634_0000003 Ga0495634_0000003_178068_178955 275
135 3300046663 Ga0495635_0000002 Ga0495635_0000002_307227_308114 275
136 3300046675 Ga0495657_0000054 Ga0495657_0000054_25242_26129 275
137 3300046678 Ga0495599_0000005 Ga0495599_0000005_7045_7932 275
138 3300046679 Ga0495623_0000148 Ga0495623_0000148_13195_14082 275
139 3300046680 Ga0495646_0000002 Ga0495646_0000002_292179_293066 275
140 3300046689 Ga0495613_0015932 Ga0495613_0015932_2075_2962 275
141 3300046809 Ga0495600_0000012 Ga0495600_0000012_29953_30840 275
142 3300047315 Ga0495581_0026555 Ga0495581_0026555_231_1118 275
143 3300047317 Ga0495604_0000009 Ga0495604_0000009_146595_147482 275
144 3300047319 Ga0495674_0000002 Ga0495674_0000002_178811_179698 275
145 3300047322 Ga0495680_0001385 Ga0495680_0001385_12049_12936 275
146 3300047444 Ga0495675_0000028 Ga0495675_0000028_58244_59131 275
147 3300047471 Ga0495684_0000006 Ga0495684_0000006_178770_179657 275
148 3300047673 Ga0495593_0000140 Ga0495593_0000140_32737_33624 275
149 3300048088 Ga0495602_0000005 Ga0495602_0000005_165976_166863 275
150 3300049569 Ga0501032_0098879 Ga0501032_0098879_40_933 275
151 3300049579 Ga0501043_0130559 Ga0501043_0130559_817_1710 275
152 3300049586 Ga0501070_0195930 Ga0501070_0195930_82_975 275
153 3300049822 Ga0501035_0016398 Ga0501035_0016398_2260_3153 275
154 3300049823 Ga0501044_0012345 Ga0501044_0012345_6163_7056 275
155 3300053077 Ga0495601_0000002 Ga0495601_0000002_131764_132651 275
156 3300053078 Ga0495612_0000010 Ga0495612_0000010_67652_68539 275
157 3300053084 Ga0495595_0000026 Ga0495595_0000026_4918_5805 275
158 3300053085 Ga0495619_0000019 Ga0495619_0000019_91100_91987 275
159 3300049571 Ga0501034_0049799 Ga0501034_0049799_988_1866 276
160 3300049822 Ga0501035_0157443 Ga0501035_0157443_24_902 276
161 3300005563 Ga0068855_100120346 Ga0068855_1001203462 277
162 3300006028 Ga0070717_10066017 Ga0070717_100660172 277
163 3300006038 Ga0075365_10203565 Ga0075365_102035652 277
164 3300006847 Ga0075431_100015573 Ga0075431_1000155734 277
165 3300025949 Ga0207667_10543958 Ga0207667_105439581 277
166 3300049741 Ga0501079_0319383 Ga0501079_0319383_293_1186 277
167 3300050510 nmdc:mga06r32_719_c1 nmdc:mga06r32_719_c1_21152_22051 277
168 iso_pu_bacteria 2513237087 2513591496 277
169 iso_pu_bacteria 2879099564 2879103309 277
170 3300005937 Ga0081455_10003729 Ga0081455_1000372913 278
171 3300006178 Ga0075367_10077723 Ga0075367_100777232 278
172 3300038443 Ga0395901_0315186 Ga0395901_0315186_385_1332 278
173 3300039450 Ga0436363_0335225 Ga0436363_0335225_336_1220 278
174 3300041486 Ga0451807_1983576 Ga0451807_1983576_153_1028 278
175 3300046529 Ga0495652_0333000 Ga0495652_0333000_84_1058 278
176 3300049742 Ga0501080_0001149 Ga0501080_0001149_16517_17389 278
177 3300053108 Ga0500562_036998 Ga0500562_036998_71_946 278
178 iso_pu_bacteria 2508501128 2509148800 278
179 iso_pu_bacteria 2904690495 2904698741 278
180 iso_pu_bacteria 2908756301 2908759255 278
181 iso_pu_bacteria 643348564 643604169 278
182 iso_pu_bacteria 8056689827 8056690331 278
183 3300005436 Ga0070713_100247239 Ga0070713_1002472391 279
184 3300005937 Ga0081455_10011253 Ga0081455_100112535 279
185 3300005937 Ga0081455_10140953 Ga0081455_101409531 279
186 3300009094 Ga0111539_10011548 Ga0111539_100115487 279
187 3300025297 Ga0209758_1050096 Ga0209758_10500962 279
188 3300027907 Ga0207428_10054962 Ga0207428_100549622 279
189 3300035692 Ga0373935_0061409 Ga0373935_0061409_450_1343 279
190 3300046683 Ga0495658_0002178 Ga0495658_0002178_6129_7022 279
191 3300048089 Ga0495614_0084288 Ga0495614_0084288_54_947 279
192 3300049572 Ga0501036_0069688 Ga0501036_0069688_910_1809 279
193 3300049574 Ga0501038_0134334 Ga0501038_0134334_249_1148 279
194 3300049581 Ga0501047_0052499 Ga0501047_0052499_2183_3082 279
195 3300049589 Ga0501073_0007067 Ga0501073_0007067_6048_6956 279
196 3300049589 Ga0501073_0019544 Ga0501073_0019544_3515_4480 279
197 3300049822 Ga0501035_0044722 Ga0501035_0044722_2182_3081 279
198 3300050507 nmdc:mga05p37_533808_c1 nmdc:mga05p37_533808_c1_405_1298 279
199 3300050511 nmdc:mga08y16_7940_c1 nmdc:mga08y16_7940_c1_5975_6868 279
200 3300060353 Ga0501082_0230013 Ga0501082_0230013_589_1491 279
201 iso_pu_bacteria 2582581283 2585166009 279
202 iso_pu_bacteria 2667528175 2671122074 279
203 iso_pu_bacteria 2837651117 2837654628 279
204 iso_pu_bacteria 2908739725 2908740996 279
205 3300001989 JGI24739J22299_10000994 JGI24739J22299_1000099412 280
206 3300001990 JGI24737J22298_10002808 JGI24737J22298_100028087 280
207 3300003215 JGI25153J46596_10008989 JGI25153J46596_100089893 280
208 3300005329 Ga0070683_100160309 Ga0070683_1001603092 280
209 3300005331 Ga0070670_100007802 Ga0070670_1000078023 280
210 3300005434 Ga0070709_10002579 Ga0070709_100025798 280
211 3300005434 Ga0070709_10005804 Ga0070709_100058047 280
212 3300005435 Ga0070714_100008494 Ga0070714_1000084947 280
213 3300005435 Ga0070714_100058980 Ga0070714_1000589803 280
214 3300005435 Ga0070714_100071409 Ga0070714_1000714095 280
215 3300005436 Ga0070713_100017576 Ga0070713_1000175768 280
216 3300005436 Ga0070713_100023787 Ga0070713_1000237874 280
217 3300005437 Ga0070710_10000243 Ga0070710_1000024323 280
218 3300005439 Ga0070711_100005828 Ga0070711_1000058287 280
219 3300005439 Ga0070711_100039692 Ga0070711_1000396923 280
220 3300005439 Ga0070711_100138558 Ga0070711_1001385582 280
221 3300005440 Ga0070705_100039351 Ga0070705_1000393513 280
222 3300005457 Ga0070662_100246732 Ga0070662_1002467322 280
223 3300005458 Ga0070681_10039210 Ga0070681_100392106 280
224 3300005518 Ga0070699_100010972 Ga0070699_1000109727 280
225 3300005518 Ga0070699_100203202 Ga0070699_1002032022 280
226 3300005535 Ga0070684_100010118 Ga0070684_1000101183 280
227 3300005535 Ga0070684_100593075 Ga0070684_1005930751 280
228 3300005539 Ga0068853_100280940 Ga0068853_1002809402 280
229 3300005545 Ga0070695_100223666 Ga0070695_1002236661 280
230 3300005546 Ga0070696_100016750 Ga0070696_1000167501 280
231 3300005546 Ga0070696_100042295 Ga0070696_1000422952 280
232 3300005549 Ga0070704_100007997 Ga0070704_1000079977 280
233 3300005563 Ga0068855_100020255 Ga0068855_1000202555 280
234 3300005577 Ga0068857_100010911 Ga0068857_10001091110 280
235 3300005614 Ga0068856_100013826 Ga0068856_1000138264 280
236 3300005614 Ga0068856_100112772 Ga0068856_1001127723 280
237 3300005614 Ga0068856_100283985 Ga0068856_1002839852 280
238 3300005616 Ga0068852_100124265 Ga0068852_1001242653 280
239 3300005842 Ga0068858_100178235 Ga0068858_1001782352 280
240 3300005937 Ga0081455_10001871 Ga0081455_1000187119 280
241 3300005937 Ga0081455_10016554 Ga0081455_100165549 280
242 3300005937 Ga0081455_10034433 Ga0081455_100344331 280
243 3300005937 Ga0081455_10049916 Ga0081455_100499166 280
244 3300005937 Ga0081455_10053665 Ga0081455_100536653 280
245 3300005937 Ga0081455_10058158 Ga0081455_100581585 280
246 3300005983 Ga0081540_1003265 Ga0081540_100326511 280
247 3300005983 Ga0081540_1003527 Ga0081540_100352712 280
248 3300005985 Ga0081539_10021209 Ga0081539_100212096 280
249 3300006028 Ga0070717_10000485 Ga0070717_1000048514 280
250 3300006028 Ga0070717_10019455 Ga0070717_100194555 280
251 3300006038 Ga0075365_10019686 Ga0075365_100196864 280
252 3300006163 Ga0070715_10001137 Ga0070715_100011376 280
253 3300006163 Ga0070715_10034945 Ga0070715_100349452 280
254 3300006173 Ga0070716_100016960 Ga0070716_1000169606 280
255 3300006175 Ga0070712_100197660 Ga0070712_1001976602 280
256 3300006844 Ga0075428_100015591 Ga0075428_1000155916 280
257 3300006844 Ga0075428_100805365 Ga0075428_1008053651 280
258 3300006847 Ga0075431_100464292 Ga0075431_1004642921 280
259 3300006871 Ga0075434_100031153 Ga0075434_1000311531 280
260 3300006871 Ga0075434_100035379 Ga0075434_1000353796 280
261 3300006871 Ga0075434_100221889 Ga0075434_1002218893 280
262 3300007076 Ga0075435_100014832 Ga0075435_1000148325 280
263 3300007265 Ga0099794_10078031 Ga0099794_100780312 280
264 3300009093 Ga0105240_10031140 Ga0105240_100311403 280
265 3300009093 Ga0105240_10056305 Ga0105240_100563053 280
266 3300009093 Ga0105240_10238864 Ga0105240_102388641 280
267 3300009094 Ga0111539_10089968 Ga0111539_100899684 280
268 3300009094 Ga0111539_10621501 Ga0111539_106215011 280
269 3300009101 Ga0105247_10046504 Ga0105247_100465042 280
270 3300009101 Ga0105247_10247070 Ga0105247_102470701 280
271 3300009147 Ga0114129_10024067 Ga0114129_1002406710 280
272 3300009147 Ga0114129_10026177 Ga0114129_100261779 280
273 3300009147 Ga0114129_10539122 Ga0114129_105391221 280
274 3300009177 Ga0105248_10086403 Ga0105248_100864032 280
275 3300009545 Ga0105237_10061989 Ga0105237_100619894 280
276 3300009551 Ga0105238_10017548 Ga0105238_100175484 280
277 3300009551 Ga0105238_10314565 Ga0105238_103145651 280
278 3300009553 Ga0105249_10001791 Ga0105249_1000179114 280
279 3300010375 Ga0105239_10027064 Ga0105239_1002706410 280
280 3300010375 Ga0105239_10034795 Ga0105239_100347956 280
281 3300011119 Ga0105246_10185311 Ga0105246_101853111 280
282 3300013102 Ga0157371_10067033 Ga0157371_100670333 280
283 3300013105 Ga0157369_10007048 Ga0157369_100070482 280
284 3300013307 Ga0157372_10047014 Ga0157372_100470145 280
285 3300013307 Ga0157372_10134443 Ga0157372_101344434 280
286 3300013308 Ga0157375_10467960 Ga0157375_104679602 280
287 3300013308 Ga0157375_10827417 Ga0157375_108274172 280
288 3300014325 Ga0163163_10011174 Ga0163163_100111743 280
289 3300014968 Ga0157379_10091639 Ga0157379_100916393 280
290 3300021384 Ga0213876_10007688 Ga0213876_100076885 280
291 3300025885 Ga0207653_10108344 Ga0207653_101083441 280
292 3300025898 Ga0207692_10000282 Ga0207692_100002828 280
293 3300025898 Ga0207692_10003656 Ga0207692_100036565 280
294 3300025898 Ga0207692_10005126 Ga0207692_100051264 280
295 3300025905 Ga0207685_10006711 Ga0207685_100067111 280
296 3300025905 Ga0207685_10017678 Ga0207685_100176782 280
297 3300025906 Ga0207699_10000577 Ga0207699_100005777 280
298 3300025913 Ga0207695_10040729 Ga0207695_100407293 280
299 3300025913 Ga0207695_10247058 Ga0207695_102470581 280
300 3300025914 Ga0207671_10090609 Ga0207671_100906091 280
301 3300025914 Ga0207671_10177214 Ga0207671_101772141 280
302 3300025915 Ga0207693_10021249 Ga0207693_100212495 280
303 3300025916 Ga0207663_10001206 Ga0207663_100012067 280
304 3300025916 Ga0207663_10008914 Ga0207663_100089146 280
305 3300025921 Ga0207652_10063657 Ga0207652_100636572 280
306 3300025924 Ga0207694_10043771 Ga0207694_100437714 280
307 3300025925 Ga0207650_10060570 Ga0207650_100605703 280
308 3300025928 Ga0207700_10000848 Ga0207700_1000084819 280
309 3300025928 Ga0207700_10013608 Ga0207700_100136084 280
310 3300025928 Ga0207700_10061229 Ga0207700_100612292 280
311 3300025928 Ga0207700_10248908 Ga0207700_102489082 280
312 3300025929 Ga0207664_10006915 Ga0207664_100069156 280
313 3300025929 Ga0207664_10012974 Ga0207664_100129747 280
314 3300025929 Ga0207664_10112013 Ga0207664_101120133 280
315 3300025939 Ga0207665_10004132 Ga0207665_100041328 280
316 3300025939 Ga0207665_10013741 Ga0207665_100137412 280
317 3300025941 Ga0207711_10033638 Ga0207711_100336386 280
318 3300025944 Ga0207661_10001720 Ga0207661_100017206 280
319 3300025944 Ga0207661_10278370 Ga0207661_102783701 280
320 3300025949 Ga0207667_10061306 Ga0207667_100613066 280
321 3300025961 Ga0207712_10009741 Ga0207712_100097418 280
322 3300026035 Ga0207703_10122438 Ga0207703_101224382 280
323 3300026067 Ga0207678_10234204 Ga0207678_102342043 280
324 3300026078 Ga0207702_10046859 Ga0207702_100468593 280
325 3300026078 Ga0207702_10106923 Ga0207702_101069233 280
326 3300026078 Ga0207702_10189788 Ga0207702_101897882 280
327 3300026116 Ga0207674_10017516 Ga0207674_1001751610 280
328 3300026142 Ga0207698_10207371 Ga0207698_102073712 280
329 3300031235 Ga0265330_10017046 Ga0265330_100170464 280
330 3300031239 Ga0265328_10028367 Ga0265328_100283673 280
331 3300031241 Ga0265325_10033747 Ga0265325_100337472 280
332 3300031247 Ga0265340_10007199 Ga0265340_100071993 280
333 3300031247 Ga0265340_10044483 Ga0265340_100444832 280
334 3300031249 Ga0265339_10005164 Ga0265339_100051643 280
335 3300031344 Ga0265316_10005377 Ga0265316_100053777 280
336 3300031507 Ga0307509_10158340 Ga0307509_101583402 280
337 3300031595 Ga0265313_10009058 Ga0265313_100090583 280
338 3300031712 Ga0265342_10006821 Ga0265342_100068218 280
339 3300035111 Ga0373923_0087526 Ga0373923_0087526_169_1056 280
340 3300035118 Ga0373954_0000381 Ga0373954_0000381_9847_10743 280
341 3300035119 Ga0373956_0020178 Ga0373956_0020178_42_938 280
342 3300035119 Ga0373956_0028172 Ga0373956_0028172_325_1212 280
343 3300035120 Ga0373957_0007751 Ga0373957_0007751_887_1774 280
344 3300035170 Ga0373943_0147219 Ga0373943_0147219_325_1218 280
345 3300035171 Ga0373946_0111034 Ga0373946_0111034_290_1177 280
346 3300035172 Ga0373955_0210592 Ga0373955_0210592_53_940 280
347 3300035241 Ga0373961_0009070 Ga0373961_0009070_710_1597 280
348 3300035242 Ga0373962_0034220 Ga0373962_0034220_508_1395 280
349 3300035691 Ga0373931_0017094 Ga0373931_0017094_2563_3450 280
350 3300035692 Ga0373935_0180986 Ga0373935_0180986_471_1364 280
351 3300035692 Ga0373935_0228156 Ga0373935_0228156_205_1092 280
352 3300035695 Ga0373927_0046710 Ga0373927_0046710_580_1467 280
353 3300035695 Ga0373927_0200405 Ga0373927_0200405_230_1123 280
354 3300035724 Ga0373933_0007615 Ga0373933_0007615_3032_3928 280
355 3300035725 Ga0373947_0143869 Ga0373947_0143869_575_1468 280
356 3300036401 Ga0373937_0001725 Ga0373937_0001725_9548_10444 280
357 3300037068 Ga0373925_0290686 Ga0373925_0290686_247_1137 280
358 3300037418 Ga0395900_0122865 Ga0395900_0122865_38_925 280
359 3300037466 Ga0395898_0006221 Ga0395898_0006221_2499_3386 280
360 3300037853 Ga0436364_0817478 Ga0436364_0817478_2044_2940 280
361 3300038443 Ga0395901_0111508 Ga0395901_0111508_1771_2658 280
362 3300039437 Ga0436365_0271615 Ga0436365_0271615_208_1095 280
363 3300039437 Ga0436365_0788813 Ga0436365_0788813_3702_4589 280
364 3300041413 Ga0439465_0002288 Ga0439465_0002288_1002_1844 280
365 3300045049 Ga0466959_0133557 Ga0466959_0133557_131_1018 280
366 3300046455 Ga0495603_0002928 Ga0495603_0002928_5053_5940 280
367 3300046455 Ga0495603_0179929 Ga0495603_0179929_293_1186 280
368 3300046459 Ga0495629_0055936 Ga0495629_0055936_301_1197 280
369 3300046461 Ga0495641_0088667 Ga0495641_0088667_154_1047 280
370 3300046462 Ga0495651_0001901 Ga0495651_0001901_13128_14024 280
371 3300046462 Ga0495651_0115534 Ga0495651_0115534_1043_1930 280
372 3300046462 Ga0495651_0123862 Ga0495651_0123862_576_1463 280
373 3300046463 Ga0495653_0001172 Ga0495653_0001172_10649_11545 280
374 3300046463 Ga0495653_0018454 Ga0495653_0018454_4121_5008 280
375 3300046472 Ga0495580_0068755 Ga0495580_0068755_1261_2154 280
376 3300046473 Ga0495582_0031519 Ga0495582_0031519_1826_2719 280
377 3300046475 Ga0495639_0027847 Ga0495639_0027847_1317_2210 280
378 3300046476 Ga0495662_0032039 Ga0495662_0032039_335_1228 280
379 3300046477 Ga0495664_0119968 Ga0495664_0119968_687_1574 280
380 3300046492 Ga0495585_0092313 Ga0495585_0092313_520_1413 280
381 3300046511 Ga0495608_0000272 Ga0495608_0000272_21774_22670 280
382 3300046516 Ga0495628_0021841 Ga0495628_0021841_808_1704 280
383 3300046517 Ga0495630_0163928 Ga0495630_0163928_274_1167 280
384 3300046529 Ga0495652_0045854 Ga0495652_0045854_922_1818 280
385 3300046531 Ga0495665_0022181 Ga0495665_0022181_1181_2074 280
386 3300046536 Ga0495587_0007120 Ga0495587_0007120_2263_3159 280
387 3300046537 Ga0495598_0001843 Ga0495598_0001843_2428_3321 280
388 3300046543 Ga0495645_0135871 Ga0495645_0135871_532_1419 280
389 3300046558 Ga0495633_0077761 Ga0495633_0077761_230_1123 280
390 3300046559 Ga0495667_0011432 Ga0495667_0011432_2135_3031 280
391 3300046615 Ga0495656_0004314 Ga0495656_0004314_531_1424 280
392 3300046642 Ga0495634_0014482 Ga0495634_0014482_3029_3916 280
393 3300046663 Ga0495635_0000500 Ga0495635_0000500_18348_19244 280
394 3300046663 Ga0495635_0174731 Ga0495635_0174731_31_918 280
395 3300046675 Ga0495657_0014481 Ga0495657_0014481_1918_2814 280
396 3300046675 Ga0495657_0229789 Ga0495657_0229789_196_1083 280
397 3300046678 Ga0495599_0018645 Ga0495599_0018645_1165_2061 280
398 3300046679 Ga0495623_0005093 Ga0495623_0005093_7188_8084 280
399 3300046681 Ga0495647_0004214 Ga0495647_0004214_1877_2770 280
400 3300046683 Ga0495658_0006226 Ga0495658_0006226_1880_2773 280
401 3300046684 Ga0495669_0059400 Ga0495669_0059400_688_1581 280
402 3300046690 Ga0495624_0127588 Ga0495624_0127588_311_1204 280
403 3300046691 Ga0495670_0011251 Ga0495670_0011251_1968_2861 280
404 3300046794 Ga0495589_0122430 Ga0495589_0122430_236_1129 280
405 3300046809 Ga0495600_0001148 Ga0495600_0001148_9425_10321 280
406 3300047317 Ga0495604_0004436 Ga0495604_0004436_1807_2703 280
407 3300047322 Ga0495680_0001508 Ga0495680_0001508_9844_10740 280
408 3300047444 Ga0495675_0000362 Ga0495675_0000362_16395_17291 280
409 3300047471 Ga0495684_0028479 Ga0495684_0028479_3036_3932 280
410 3300047471 Ga0495684_0248044 Ga0495684_0248044_285_1178 280
411 3300047472 Ga0495686_0023990 Ga0495686_0023990_3054_3947 280
412 3300047673 Ga0495593_0050350 Ga0495593_0050350_745_1638 280
413 3300048088 Ga0495602_0005892 Ga0495602_0005892_2135_3031 280
414 3300048903 Ga0496100_0015421 Ga0496100_0015421_1739_2632 280
415 3300048903 Ga0496100_0029450 Ga0496100_0029450_145_1032 280
416 3300048903 Ga0496100_0171275 Ga0496100_0171275_293_1246 280
417 3300048904 Ga0496101_0002395 Ga0496101_0002395_51_944 280
418 3300048904 Ga0496101_0010276 Ga0496101_0010276_2176_3063 280
419 3300048905 Ga0496102_0002614 Ga0496102_0002614_4471_5364 280
420 3300048905 Ga0496102_0089830 Ga0496102_0089830_807_1694 280
421 3300048905 Ga0496102_0215790 Ga0496102_0215790_347_1240 280
422 3300048906 Ga0496103_0021349 Ga0496103_0021349_731_1618 280
423 3300048907 Ga0496104_0021951 Ga0496104_0021951_3067_3954 280
424 3300048907 Ga0496104_0066189 Ga0496104_0066189_1580_2473 280
425 3300048908 Ga0496105_0003019 Ga0496105_0003019_7579_8472 280
426 3300048908 Ga0496105_0007082 Ga0496105_0007082_4208_5101 280
427 3300048908 Ga0496105_0032830 Ga0496105_0032830_2283_3170 280
428 3300048909 Ga0496106_0001912 Ga0496106_0001912_13656_14549 280
429 3300048909 Ga0496106_0018657 Ga0496106_0018657_2202_3089 280
430 3300048909 Ga0496106_0061023 Ga0496106_0061023_1019_1912 280
431 3300048909 Ga0496106_0079659 Ga0496106_0079659_1456_2349 280
432 3300048910 Ga0496107_0000684 Ga0496107_0000684_10403_11296 280
433 3300048910 Ga0496107_0008466 Ga0496107_0008466_5593_6480 280
434 3300048911 Ga0496108_0000951 Ga0496108_0000951_3916_4809 280
435 3300048911 Ga0496108_0002201 Ga0496108_0002201_11230_12123 280
436 3300048912 Ga0496109_0036779 Ga0496109_0036779_2757_3644 280
437 3300048912 Ga0496109_0109183 Ga0496109_0109183_193_1086 280
438 3300048912 Ga0496109_0174491 Ga0496109_0174491_166_1059 280
439 3300048913 Ga0496110_0025021 Ga0496110_0025021_3702_4595 280
440 3300048913 Ga0496110_0049864 Ga0496110_0049864_1680_2567 280
441 3300048913 Ga0496110_0177180 Ga0496110_0177180_587_1480 280
442 3300048914 Ga0496111_0007619 Ga0496111_0007619_3476_4363 280
443 3300048914 Ga0496111_0088518 Ga0496111_0088518_289_1176 280
444 3300048915 Ga0496112_0006785 Ga0496112_0006785_3205_4092 280
445 3300048915 Ga0496112_0023680 Ga0496112_0023680_502_1395 280
446 3300048915 Ga0496112_0085546 Ga0496112_0085546_175_1068 280
447 3300048916 Ga0496113_0000043 Ga0496113_0000043_4575_5468 280
448 3300048916 Ga0496113_0003867 Ga0496113_0003867_1484_2377 280
449 3300048916 Ga0496113_0017042 Ga0496113_0017042_3115_4002 280
450 3300048917 Ga0496114_0029897 Ga0496114_0029897_3373_4260 280
451 3300048917 Ga0496114_0098816 Ga0496114_0098816_1530_2423 280
452 3300048918 Ga0496115_0017339 Ga0496115_0017339_1688_2575 280
453 3300048918 Ga0496115_0130197 Ga0496115_0130197_1090_1983 280
454 3300048924 Ga0496121_0000104 Ga0496121_0000104_21533_22387 280
455 3300048924 Ga0496121_0000365 Ga0496121_0000365_49922_50809 280
456 3300048924 Ga0496121_0221079 Ga0496121_0221079_347_1234 280
457 3300048925 Ga0496122_0019295 Ga0496122_0019295_1903_2790 280
458 3300048927 Ga0496124_0029811 Ga0496124_0029811_3120_4007 280
459 3300048929 Ga0496126_0009177 Ga0496126_0009177_9069_9956 280
460 3300048929 Ga0496126_0110937 Ga0496126_0110937_1262_2152 280
461 3300049568 Ga0501031_0002596 Ga0501031_0002596_6676_7572 280
462 3300049569 Ga0501032_0000366 Ga0501032_0000366_21146_22042 280
463 3300049570 Ga0501033_0000707 Ga0501033_0000707_28712_29608 280
464 3300049570 Ga0501033_0089241 Ga0501033_0089241_713_1600 280
465 3300049571 Ga0501034_0000332 Ga0501034_0000332_28286_29182 280
466 3300049571 Ga0501034_0051508 Ga0501034_0051508_2650_3537 280
467 3300049572 Ga0501036_0000220 Ga0501036_0000220_33805_34701 280
468 3300049573 Ga0501037_0000054 Ga0501037_0000054_101940_102836 280
469 3300049573 Ga0501037_0051222 Ga0501037_0051222_378_1289 280
470 3300049574 Ga0501038_0002737 Ga0501038_0002737_13787_14683 280
471 3300049574 Ga0501038_0063864 Ga0501038_0063864_217_1104 280
472 3300049574 Ga0501038_0137169 Ga0501038_0137169_340_1248 280
473 3300049574 Ga0501038_0451786 Ga0501038_0451786_10_909 280
474 3300049575 Ga0501039_0475807 Ga0501039_0475807_36_944 280
475 3300049579 Ga0501043_0000338 Ga0501043_0000338_25499_26395 280
476 3300049579 Ga0501043_0018792 Ga0501043_0018792_3882_4769 280
477 3300049579 Ga0501043_0037069 Ga0501043_0037069_755_1666 280
478 3300049580 Ga0501046_0000087 Ga0501046_0000087_65895_66791 280
479 3300049581 Ga0501047_0001092 Ga0501047_0001092_6936_7832 280
480 3300049581 Ga0501047_0026666 Ga0501047_0026666_2509_3420 280
481 3300049582 Ga0501048_0001217 Ga0501048_0001217_12742_13638 280
482 3300049583 Ga0501067_0001618 Ga0501067_0001618_7884_8780 280
483 3300049584 Ga0501068_0000069 Ga0501068_0000069_17060_17956 280
484 3300049585 Ga0501069_0007811 Ga0501069_0007811_2910_3806 280
485 3300049586 Ga0501070_0045569 Ga0501070_0045569_2540_3436 280
486 3300049586 Ga0501070_0047258 Ga0501070_0047258_759_1670 280
487 3300049586 Ga0501070_0417179 Ga0501070_0417179_88_975 280
488 3300049588 Ga0501072_0010024 Ga0501072_0010024_4163_5059 280
489 3300049589 Ga0501073_0000112 Ga0501073_0000112_12318_13214 280
490 3300049589 Ga0501073_0035773 Ga0501073_0035773_2540_3451 280
491 3300049589 Ga0501073_0133750 Ga0501073_0133750_455_1363 280
492 3300049590 Ga0501074_0015427 Ga0501074_0015427_3571_4467 280
493 3300049590 Ga0501074_0131798 Ga0501074_0131798_575_1486 280
494 3300049741 Ga0501079_0001029 Ga0501079_0001029_13373_14269 280
495 3300049742 Ga0501080_0003274 Ga0501080_0003274_1087_1983 280
496 3300049742 Ga0501080_0099160 Ga0501080_0099160_1369_2277 280
497 3300049742 Ga0501080_0144572 Ga0501080_0144572_645_1556 280
498 3300049744 Ga0501083_0008891 Ga0501083_0008891_2682_3578 280
499 3300049822 Ga0501035_0001855 Ga0501035_0001855_3886_4782 280
500 3300049823 Ga0501044_0000163 Ga0501044_0000163_16241_17137 280
501 3300049823 Ga0501044_0160361 Ga0501044_0160361_1205_2092 280
502 3300049824 Ga0501045_0003296 Ga0501045_0003296_65_961 280
503 3300050491 nmdc:mga00v17_21264_c1 nmdc:mga00v17_21264_c1_1373_2263 280
504 3300050492 nmdc:mga0yw44_1178_c1 nmdc:mga0yw44_1178_c1_3795_4685 280
505 3300050492 nmdc:mga0yw44_28448_c1 nmdc:mga0yw44_28448_c1_1165_2118 280
506 3300050494 nmdc:mga06z11_32863_c1 nmdc:mga06z11_32863_c1_569_1459 280
507 3300050507 nmdc:mga05p37_267187_c1 nmdc:mga05p37_267187_c1_222_1175 280
508 3300050510 nmdc:mga06r32_107119_c1 nmdc:mga06r32_107119_c1_846_1739 280
509 3300050512 nmdc:mga0n895_150524_c1 nmdc:mga0n895_150524_c1_1091_1984 280
510 3300050512 nmdc:mga0n895_234560_c1 nmdc:mga0n895_234560_c1_131_1024 280
511 3300050512 nmdc:mga0n895_80372_c1 nmdc:mga0n895_80372_c1_201_1094 280
512 3300050512 nmdc:mga0n895_94631_c1 nmdc:mga0n895_94631_c1_21_908 280
513 3300050513 nmdc:mga0rr50_249584_c1 nmdc:mga0rr50_249584_c1_181_1074 280
514 3300053077 Ga0495601_0001735 Ga0495601_0001735_3971_4864 280
515 3300053077 Ga0495601_0247737 Ga0495601_0247737_111_998 280
516 3300053078 Ga0495612_0066243 Ga0495612_0066243_184_1071 280
517 3300053080 Ga0500635_0001213 Ga0500635_0001213_2144_3031 280
518 3300053085 Ga0495619_0000743 Ga0495619_0000743_13350_14246 280
519 3300053085 Ga0495619_0038918 Ga0495619_0038918_2160_3053 280
520 3300053094 Ga0500566_0001828 Ga0500566_0001828_3977_4819 280
521 3300053150 Ga0500603_000400 Ga0500603_000400_1498_2385 280
522 3300053178 Ga0500637_0001951 Ga0500637_0001951_6877_7764 280
523 3300054114 Ga0501084_0012713 Ga0501084_0012713_5110_6006 280
524 3300060353 Ga0501082_0015541 Ga0501082_0015541_2540_3436 280
525 3300061734 Ga0530510_0239553 Ga0530510_0239553_97_1050 280
526 iso_pu_bacteria 2885409591 2885410118 280
527 3300003911 JGI25405J52794_10002353 JGI25405J52794_100023534 281
528 3300006186 Ga0075369_10028272 Ga0075369_100282722 281
529 3300006847 Ga0075431_100000105 Ga0075431_10000010529 281
530 3300006871 Ga0075434_100112512 Ga0075434_1001125123 281
531 3300006880 Ga0075429_100002470 Ga0075429_10000247016 281
532 3300009147 Ga0114129_10002163 Ga0114129_100021633 281
533 3300009174 Ga0105241_10422157 Ga0105241_104221572 281
534 3300009551 Ga0105238_10041663 Ga0105238_100416633 281
535 3300015265 Ga0182005_1004233 Ga0182005_10042331 281
536 3300027907 Ga0207428_10012894 Ga0207428_100128946 281
537 3300038443 Ga0395901_0074714 Ga0395901_0074714_1771_2673 281
538 3300039447 Ga0436361_0407903 Ga0436361_0407903_1593_2495 281
539 3300046460 Ga0495638_0027817 Ga0495638_0027817_545_1453 281
540 3300046616 Ga0495668_0160577 Ga0495668_0160577_309_1217 281
541 3300048088 Ga0495602_0122658 Ga0495602_0122658_862_1779 281
542 3300048903 Ga0496100_0041015 Ga0496100_0041015_676_1593 281
543 3300048917 Ga0496114_0072474 Ga0496114_0072474_1801_2718 281
544 3300048927 Ga0496124_0286484 Ga0496124_0286484_228_1115 281
545 3300049573 Ga0501037_0001926 Ga0501037_0001926_4523_5491 281
546 3300049574 Ga0501038_0062439 Ga0501038_0062439_1030_1941 281
547 3300049574 Ga0501038_0069285 Ga0501038_0069285_512_1480 281
548 3300049581 Ga0501047_0236321 Ga0501047_0236321_697_1623 281
549 3300049582 Ga0501048_0009539 Ga0501048_0009539_254_1222 281
550 3300049583 Ga0501067_0065573 Ga0501067_0065573_575_1543 281
551 3300049587 Ga0501071_0049661 Ga0501071_0049661_2042_3010 281
552 3300049589 Ga0501073_0027377 Ga0501073_0027377_981_1949 281
553 3300049590 Ga0501074_0003367 Ga0501074_0003367_4628_5596 281
554 3300049590 Ga0501074_0020775 Ga0501074_0020775_3358_4284 281
555 3300049741 Ga0501079_0180654 Ga0501079_0180654_178_1146 281
556 3300049742 Ga0501080_0060868 Ga0501080_0060868_1036_1947 281
557 3300049742 Ga0501080_0063417 Ga0501080_0063417_2132_3100 281
558 3300049742 Ga0501080_0118209 Ga0501080_0118209_572_1498 281
559 3300049744 Ga0501083_0009300 Ga0501083_0009300_3207_4115 281
560 3300049744 Ga0501083_0022562 Ga0501083_0022562_3061_4029 281
561 3300049822 Ga0501035_0014587 Ga0501035_0014587_2667_3635 281
562 3300049823 Ga0501044_0038026 Ga0501044_0038026_3182_4093 281
563 3300050507 nmdc:mga05p37_140_c1 nmdc:mga05p37_140_c1_8819_9799 281
564 3300050508 nmdc:mga09592_1649_c1 nmdc:mga09592_1649_c1_12098_13078 281
565 3300050511 nmdc:mga08y16_104_c1 nmdc:mga08y16_104_c1_41694_42674 281
566 3300050512 nmdc:mga0n895_296488_c1 nmdc:mga0n895_296488_c1_568_1497 281
567 3300050516 nmdc:mga0sz30_56585_c1 nmdc:mga0sz30_56585_c1_34_942 281
568 3300053096 Ga0500641_0016917 Ga0500641_0016917_917_1825 281
569 3300053151 Ga0500604_0026077 Ga0500604_0026077_35_943 281
570 3300053153 Ga0500616_0015009 Ga0500616_0015009_214_1218 281
571 3300054114 Ga0501084_0013592 Ga0501084_0013592_563_1531 281
572 3300060353 Ga0501082_0138331 Ga0501082_0138331_128_1096 281
573 iso_pu_bacteria 2671180139 2671692204 281
574 iso_pu_bacteria 2917554339 2917557318 281
575 3300026095 Ga0207676_10328372 Ga0207676_103283722 282
576 3300001915 JGI24741J21665_1011718 JGI24741J21665_10117182 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01218

Coprogen_oxidas

Coproporphyrinogen III oxidase

42

347

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eo6-assembly1.cif.gz_B coproporphyrinogen iii oxidase (hemf) from acinetobacter baumannii 0.9473 13 284
3e8j-assembly1.cif.gz_B coproporphyrinogen iii oxidase from leishmania naiffi 0.9425 13 284
3dwr-assembly1.cif.gz_B leishmania major coproporphyrinogen iii oxidase with bound ligand 0.9412 11 284
3e8j-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania naiffi 0.9329 13 284
2qt8-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania major 0.9242 10 284
ID Description Score Start End Superfamily
3dwsA00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9121 13 284 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9002 3 284 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.897 4 284 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.891 3 284 3.40.1500.10
af_Q7XPL2_53_398_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8898 1 284 3.40.1500.10
ID Description Score Start End GO Terms
AF-A0A1R1YWK0-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9965 8 284 GO:0004109
GO:0005737
GO:0006782
AF-A0A520DFF3-F1-model_v4 deleted 0.9939 8 221
AF-A0A3M1G5I1-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9915 68 284 GO:0004109
GO:0005737
GO:0006782
AF-A0A2A5BLV3-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9901 104 284 GO:0004109
GO:0005737
GO:0006782
AF-A0A3D2P2U3-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.988 70 176 GO:0004109
GO:0005737
GO:0006782

Feature Viewer

pLDDT pTM Quality
93.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map