F465305

General Info

Members Datasets Scaffolds Average Seq Length
574 361 525 260

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10049392|Ga0105239_100493922
Length 299
Sequence VPPGQRLPAARGLSAPGADATAEEDLDPAVVRQVLTAGELTITGRLTNASNATLYGTVALDGVSLNCVHKPVAGERPLWDFPNGTLAAREVAAYELSQATGWRIVPPTVMREGPWGPGMCQLWIDTPDEDDHDLLALLPEDFDEDPADEAAAQWRPVLSVELGDGRPAVLAHKADERLRRIAAFDAVVNNADRKGGHLLVGIAEPDHVYGIDHGLTFNVDDKLRTLLWGFSADPLGAEVREVLQRLDRDIESGELGERLAGLLDAEEIAATRERVRELLETDRIPGPEGRRRPVPWPPF

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
4 2582580736 Prauserella sp. Am3 Isolate Unclassified
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
8 2643221561 Nocardioides sp. Root151 Isolate Unclassified
9 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
10 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
11 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
14 2643221696 Nocardioides sp. Root140 Isolate Unclassified
15 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
16 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
17 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
18 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
19 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
20 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
21 2739367898 Nocardioides sp. CF479 Isolate Unclassified
22 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
23 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
24 2773857922 Frankia sp. CcI49 Isolate Nodule
25 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
26 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
27 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
28 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
29 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
30 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
31 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
32 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
33 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
34 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
35 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
36 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
37 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
38 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
39 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
40 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
41 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
42 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
43 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
44 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
206 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
211 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
212 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
213 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 8002775197 Frankia nepalensis CN7 Isolate Nodule
358 8002784119 Frankia sp. AgB1.9 Isolate Nodule
359 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
360 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
361 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.94
Metatranscriptomes 0.52
Isolates 8.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 1.39
Rhizoplane 5.4
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005917 3300003203 Bacteria 5660
2 rootH1_10006612 3300003316 Bacteria 5066
3 Ga0070658_10032723 3300005327 Bacteria 4181
4 Ga0070683_100004618 3300005329 Bacteria 11380
5 Ga0070683_100496978 3300005329 Bacteria 1165
6 Ga0068869_100021696 3300005334 Bacteria 4419
7 Ga0070666_10033090 3300005335 Bacteria 3419
8 Ga0070680_100118095 3300005336 Bacteria 2212
9 Ga0070682_100197636 3300005337 Bacteria 1416
10 Ga0068868_100003029 3300005338 Bacteria 11690
11 Ga0070660_100028983 3300005339 Bacteria 4146
12 Ga0070660_100271887 3300005339 Bacteria 1385
13 Ga0070689_100111460 3300005340 Bacteria 2176
14 Ga0070691_10039916 3300005341 Bacteria 2218
15 Ga0070692_10140399 3300005345 Bacteria 1367
16 Ga0070668_100012087 3300005347 Bacteria 6431
17 Ga0070668_100017099 3300005347 Bacteria 5428
18 Ga0070674_100492111 3300005356 Bacteria 1020
19 Ga0070673_100282377 3300005364 Bacteria 1456
20 Ga0070659_100019627 3300005366 Bacteria 5126
21 Ga0070667_100235887 3300005367 Bacteria 1632
22 Ga0070714_100000002 3300005435 Bacteria 386673
23 Ga0070714_100015013 3300005435 Bacteria 6225
24 Ga0070714_100128363 3300005435 Bacteria 2263
25 Ga0070714_100795226 3300005435 Bacteria 916
26 Ga0070714_100893217 3300005435 Bacteria 862
27 Ga0070701_10119028 3300005438 Bacteria 1485
28 Ga0070711_100078684 3300005439 Bacteria 2343
29 Ga0070705_100003977 3300005440 Bacteria 7222
30 Ga0070700_100000124 3300005441 Bacteria 47077
31 Ga0070663_100000995 3300005455 Bacteria 15441
32 Ga0070663_100014932 3300005455 Bacteria 4995
33 Ga0070663_100094687 3300005455 Bacteria 2218
34 Ga0070662_100034241 3300005457 Bacteria 3581
35 Ga0068867_100123477 3300005459 Bacteria 2004
36 Ga0070685_10019530 3300005466 Bacteria 3657
37 Ga0070685_10204967 3300005466 Bacteria 1284
38 Ga0070698_100459427 3300005471 Bacteria 1209
39 Ga0068853_100205064 3300005539 Bacteria 1795
40 Ga0070672_100440880 3300005543 Bacteria 1121
41 Ga0070686_100081792 3300005544 Bacteria 2140
42 Ga0070695_100011401 3300005545 Bacteria 5316
43 Ga0070696_100023865 3300005546 Bacteria 4156
44 Ga0070693_100005276 3300005547 Bacteria 6191
45 Ga0070665_100000522 3300005548 Bacteria 54684
46 Ga0070665_100044237 3300005548 Bacteria 4472
47 Ga0070665_100059353 3300005548 Bacteria 3835
48 Ga0070665_100105328 3300005548 Bacteria 2822
49 Ga0070665_100180815 3300005548 Bacteria 2110
50 Ga0070704_100008699 3300005549 Bacteria 6105
51 Ga0068855_100019090 3300005563 Bacteria 8239
52 Ga0068855_100032936 3300005563 Bacteria 6186
53 Ga0068855_100068191 3300005563 Bacteria 4141
54 Ga0070664_100104217 3300005564 Bacteria 2470
55 Ga0070664_100170478 3300005564 Bacteria 1931
56 Ga0068857_100239242 3300005577 Bacteria 1662
57 Ga0068857_100629391 3300005577 Bacteria 1016
58 Ga0068856_100102462 3300005614 Bacteria 2856
59 Ga0068856_100124853 3300005614 Bacteria 2577
60 Ga0068852_100111327 3300005616 Bacteria 2490
61 Ga0068852_100133164 3300005616 Bacteria 2291
62 Ga0068852_100218384 3300005616 Bacteria 1812
63 Ga0068859_100000325 3300005617 Bacteria 47431
64 Ga0068859_100768511 3300005617 Bacteria 1052
65 Ga0068861_100006531 3300005719 Bacteria 7955
66 Ga0068861_100214282 3300005719 Bacteria 1624
67 Ga0068863_100005701 3300005841 Bacteria 12225
68 Ga0068863_100038829 3300005841 Bacteria 4529
69 Ga0068858_100006048 3300005842 Bacteria 11793
70 Ga0068858_100050207 3300005842 Bacteria 3861
71 Ga0068860_100058208 3300005843 Bacteria 3673
72 Ga0068862_100000106 3300005844 Bacteria 99778
73 Ga0081540_1001870 3300005983 Bacteria 17629
74 Ga0081539_10001535 3300005985 Bacteria 38621
75 Ga0070717_10027752 3300006028 Bacteria 4526
76 Ga0075365_10006894 3300006038 Bacteria 6304
77 Ga0075365_10081507 3300006038 Bacteria 2192
78 Ga0075365_10103351 3300006038 Bacteria 1952
79 Ga0075364_10420583 3300006051 Bacteria 912
80 Ga0070715_10014550 3300006163 Bacteria 2916
81 Ga0070712_100199821 3300006175 Bacteria 1570
82 Ga0075367_10051361 3300006178 Bacteria 2437
83 Ga0097621_100048951 3300006237 Bacteria 3432
84 Ga0068871_100087272 3300006358 Bacteria 2593
85 Ga0075428_100015686 3300006844 Bacteria 8394
86 Ga0075428_100331421 3300006844 Bacteria 1635
87 Ga0075430_100003236 3300006846 Bacteria 13648
88 Ga0075434_100313019 3300006871 Bacteria 1590
89 Ga0075429_100005937 3300006880 Bacteria 10539
90 Ga0068865_100260815 3300006881 Bacteria 1372
91 Ga0075436_100025263 3300006914 Bacteria 4087
92 Ga0097620_100000325 3300006931 Bacteria 47431
93 Ga0097620_100015740 3300006931 Bacteria 7600
94 Ga0097620_100768515 3300006931 Bacteria 1052
95 Ga0075435_100002135 3300007076 Bacteria 13027
96 Ga0105240_10030309 3300009093 Bacteria 7030
97 Ga0105240_10088912 3300009093 Bacteria 3779
98 Ga0105240_10404449 3300009093 Bacteria 1537
99 Ga0111539_10148269 3300009094 Bacteria 2746
100 Ga0111539_10247192 3300009094 Bacteria 2077
101 Ga0105245_10004893 3300009098 Bacteria 11783
102 Ga0105245_10012793 3300009098 Bacteria 7310
103 Ga0105245_10064804 3300009098 Bacteria 3303
104 Ga0105245_10194155 3300009098 Bacteria 1946
105 Ga0114129_10041067 3300009147 Bacteria 6520
106 Ga0105243_10007019 3300009148 Bacteria 8666
107 Ga0105243_10056175 3300009148 Bacteria 3129
108 Ga0105243_10167657 3300009148 Bacteria 1899
109 Ga0105241_10002482 3300009174 Bacteria 13857
110 Ga0105248_10014436 3300009177 Bacteria 8694
111 Ga0105237_10011916 3300009545 Bacteria 9192
112 Ga0105237_10067649 3300009545 Bacteria 3566
113 Ga0105238_10038741 3300009551 Bacteria 4839
114 Ga0105238_10071058 3300009551 Bacteria 3478
115 Ga0105249_10003464 3300009553 Bacteria 13664
116 Ga0105249_10108295 3300009553 Bacteria 2623
117 Ga0105249_10755409 3300009553 Bacteria 1035
118 Ga0105239_10021135 3300010375 Bacteria 7179
119 Ga0105239_10049392 3300010375 Bacteria 4614
120 Ga0105239_10412696 3300010375 Bacteria 1529
121 Ga0105239_11102387 3300010375 Bacteria 914
122 Ga0105239_11190248 3300010375 Bacteria 878
123 Ga0105246_10001248 3300011119 Bacteria 14931
124 Ga0105246_10017682 3300011119 Bacteria 4535
125 Ga0105246_10079336 3300011119 Bacteria 2334
126 Ga0157371_10014394 3300013102 Bacteria 5971
127 Ga0157370_10012239 3300013104 Bacteria 8910
128 Ga0157370_10034564 3300013104 Bacteria 4919
129 Ga0157370_10258805 3300013104 Bacteria 1608
130 Ga0157369_10026043 3300013105 Bacteria 6489
131 Ga0157369_10073728 3300013105 Bacteria 3662
132 Ga0157369_10154126 3300013105 Bacteria 2428
133 Ga0157374_10079604 3300013296 Bacteria 3106
134 Ga0157374_10110396 3300013296 Bacteria 2645
135 Ga0157374_10432536 3300013296 Bacteria 1316
136 Ga0157378_10053686 3300013297 Bacteria 3588
137 Ga0157378_10299689 3300013297 Bacteria 1555
138 Ga0163162_10005797 3300013306 Bacteria 11952
139 Ga0163162_10144500 3300013306 Bacteria 2494
140 Ga0157372_10002366 3300013307 Bacteria 20407
141 Ga0157372_10061089 3300013307 Bacteria 4218
142 Ga0157372_10458253 3300013307 Bacteria 1486
143 Ga0157375_10001577 3300013308 Bacteria 19613
144 Ga0157375_10085499 3300013308 Bacteria 3204
145 Ga0163163_10002431 3300014325 Bacteria 15754
146 Ga0163163_10038252 3300014325 Bacteria 4675
147 Ga0163163_10161292 3300014325 Bacteria 2288
148 Ga0157380_10013493 3300014326 Bacteria 5959
149 Ga0182008_10000152 3300014497 Bacteria 54242
150 Ga0157379_10000203 3300014968 Bacteria 46082
151 Ga0157379_10006815 3300014968 Bacteria 9873
152 Ga0157376_10030129 3300014969 Bacteria 4329
153 Ga0182007_10010546 3300015262 Bacteria 3643
154 Ga0163161_10120575 3300017792 Bacteria 1970
155 Ga0206353_10069541 3300020082 Bacteria 3643
156 Ga0206353_10341763 3300020082 Bacteria 3689
157 Ga0206353_10926598 3300020082 Bacteria 4732
158 Ga0213876_10024982 3300021384 Bacteria 3154
159 Ga0207710_10000110 3300025900 Bacteria 104170
160 Ga0207688_10000570 3300025901 Bacteria 18094
161 Ga0207647_10035719 3300025904 Bacteria 3165
162 Ga0207647_10040557 3300025904 Bacteria 2931
163 Ga0207654_10014853 3300025911 Bacteria 4031
164 Ga0207654_10026989 3300025911 Bacteria 3117
165 Ga0207654_10147578 3300025911 Bacteria 1506
166 Ga0207695_10004382 3300025913 Bacteria 19305
167 Ga0207695_10078690 3300025913 Bacteria 3344
168 Ga0207671_10004661 3300025914 Bacteria 12974
169 Ga0207693_10002123 3300025915 Bacteria 17306
170 Ga0207663_10200760 3300025916 Bacteria 1438
171 Ga0207657_10114372 3300025919 Bacteria 2225
172 Ga0207681_10290731 3300025923 Bacteria 1290
173 Ga0207694_10021185 3300025924 Bacteria 4923
174 Ga0207694_10047577 3300025924 Bacteria 3318
175 Ga0207694_10286459 3300025924 Bacteria 1354
176 Ga0207687_10005838 3300025927 Bacteria 8144
177 Ga0207664_10000038 3300025929 Bacteria 166264
178 Ga0207664_10046668 3300025929 Bacteria 3401
179 Ga0207664_10489042 3300025929 Bacteria 1101
180 Ga0207644_10217404 3300025931 Bacteria 1513
181 Ga0207706_10007205 3300025933 Bacteria 10282
182 Ga0207686_10256852 3300025934 Bacteria 1279
183 Ga0207709_10329133 3300025935 Bacteria 1146
184 Ga0207709_10423002 3300025935 Bacteria 1024
185 Ga0207665_10002367 3300025939 Bacteria 12738
186 Ga0207691_10075098 3300025940 Bacteria 3048
187 Ga0207711_10123759 3300025941 Bacteria 2311
188 Ga0207689_10008478 3300025942 Bacteria 8956
189 Ga0207661_10388478 3300025944 Bacteria 1264
190 Ga0207679_10374671 3300025945 Bacteria 1246
191 Ga0207667_10007161 3300025949 Bacteria 13464
192 Ga0207667_10052680 3300025949 Bacteria 4284
193 Ga0207667_10453008 3300025949 Bacteria 1304
194 Ga0207712_10054601 3300025961 Bacteria 2806
195 Ga0207668_10010928 3300025972 Bacteria 5504
196 Ga0207668_10124815 3300025972 Bacteria 1955
197 Ga0207658_10406102 3300025986 Bacteria 1198
198 Ga0207703_10000005 3300026035 Bacteria 506356
199 Ga0207703_10018451 3300026035 Bacteria 5448
200 Ga0207703_10357920 3300026035 Bacteria 1345
201 Ga0207678_10000091 3300026067 Bacteria 75052
202 Ga0207678_10103458 3300026067 Bacteria 2431
203 Ga0207678_10255975 3300026067 Bacteria 1500
204 Ga0207708_10000023 3300026075 Bacteria 176615
205 Ga0207708_10317819 3300026075 Bacteria 1270
206 Ga0207702_10055062 3300026078 Bacteria 3373
207 Ga0207702_10666001 3300026078 Bacteria 1024
208 Ga0207641_10023439 3300026088 Bacteria 5085
209 Ga0207641_10040208 3300026088 Bacteria 3914
210 Ga0207641_10727337 3300026088 Bacteria 979
211 Ga0207648_10040754 3300026089 Bacteria 4080
212 Ga0207674_10009187 3300026116 Bacteria 11335
213 Ga0207675_100005797 3300026118 Bacteria 11808
214 Ga0207683_10049319 3300026121 Bacteria 3686
215 Ga0207698_10011853 3300026142 Bacteria 5676
216 Ga0268266_10056973 3300028379 Bacteria 3362
217 Ga0268266_10133937 3300028379 Bacteria 2218
218 Ga0268266_10442788 3300028379 Bacteria 1234
219 Ga0268265_10000008 3300028380 Bacteria 417328
220 Ga0268264_10299507 3300028381 Bacteria 1513
221 Ga0307515_10098721 3300028794 Bacteria 3553
222 Ga0307515_10141441 3300028794 Bacteria 2578
223 Ga0307512_10001989 3300030522 Bacteria 27215
224 Ga0307512_10077296 3300030522 Bacteria 2420
225 Ga0265340_10004882 3300031247 Bacteria 7463
226 Ga0307513_10002561 3300031456 Bacteria 25114
227 Ga0307513_10183477 3300031456 Bacteria 1952
228 Ga0307509_10083179 3300031507 Bacteria 3300
229 Ga0307509_10325748 3300031507 Bacteria 1270
230 Ga0307508_10043952 3300031616 Bacteria 3999
231 Ga0307508_10188288 3300031616 Bacteria 1665
232 Ga0307508_10298521 3300031616 Bacteria 1204
233 Ga0307514_10279601 3300031649 Bacteria 956
234 Ga0307518_10000093 3300031838 Bacteria 61707
235 Ga0307416_100315022 3300032002 Bacteria 1563
236 Ga0307507_10000081 3300033179 Bacteria 148079
237 Ga0307507_10043437 3300033179 Bacteria 4460
238 Ga0307507_10064883 3300033179 Bacteria 3364
239 Ga0307507_10230459 3300033179 Bacteria 1229
240 Ga0307510_10077869 3300033180 Bacteria 3248
241 Ga0307510_10092527 3300033180 Bacteria 2859
242 Ga0373938_0003459 3300034957 Bacteria 2588
243 Ga0373929_0034644 3300035085 Bacteria 1096
244 Ga0373949_0015760 3300035090 Bacteria 1690
245 Ga0373952_0036334 3300035092 Bacteria 1119
246 Ga0373939_0000981 3300035114 Bacteria 7086
247 Ga0373961_0008233 3300035241 Bacteria 2534
248 Ga0373962_0015841 3300035242 Bacteria 1938
249 Ga0373931_0009228 3300035691 Bacteria 4710
250 Ga0373927_0205498 3300035695 Bacteria 1293
251 Ga0373925_0290757 3300037068 Bacteria 1318
252 Ga0395900_0144945 3300037418 Bacteria 2429
253 Ga0395898_0008145 3300037466 Bacteria 11099
254 Ga0436364_0744111 3300037853 Bacteria 5473
255 Ga0395901_0025615 3300038443 Bacteria 6055
256 Ga0395901_0032214 3300038443 Bacteria 5409
257 Ga0436365_1829699 3300039437 Bacteria 12539
258 Ga0451837_0295870 3300041494 Bacteria 2439
259 Ga0451837_0806448 3300041494 Bacteria 1289
260 Ga0451841_1321351 3300041498 Bacteria 2321
261 Ga0451853_0147823 3300041512 Bacteria 7756
262 Ga0451853_1270289 3300041512 Bacteria 4360
263 Ga0439442_000840 3300042002 Bacteria 6310
264 Ga0439449_0016559 3300042007 Bacteria 2770
265 Ga0439449_0125362 3300042007 Bacteria 954
266 Ga0439457_000116 3300042014 Bacteria 19257
267 Ga0450920_000547 3300042122 Bacteria 5960
268 Ga0450894_015372 3300042131 Bacteria 1013
269 Ga0450907_001018 3300042146 Bacteria 6568
270 Ga0439434_0000331 3300042435 Bacteria 13407
271 Ga0450918_000569 3300042531 Bacteria 7855
272 Ga0466969_0058806 3300044656 Bacteria 1870
273 Ga0466972_0004125 3300044658 Bacteria 7251
274 Ga0466972_0076701 3300044658 Bacteria 1592
275 Ga0466966_0023637 3300044684 Bacteria 4023
276 Ga0466966_0059787 3300044684 Bacteria 2406
277 Ga0466966_0180441 3300044684 Bacteria 1281
278 Ga0466966_0244437 3300044684 Bacteria 1081
279 Ga0466961_0001162 3300044693 Bacteria 16194
280 Ga0466961_0012003 3300044693 Bacteria 5537
281 Ga0466961_0032747 3300044693 Bacteria 3340
282 Ga0466961_0037060 3300044693 Bacteria 3130
283 Ga0466961_0046284 3300044693 Bacteria 2783
284 Ga0466961_0053518 3300044693 Bacteria 2575
285 Ga0466961_0069088 3300044693 Bacteria 2243
286 Ga0466961_0135324 3300044693 Bacteria 1544
287 Ga0466961_0221133 3300044693 Bacteria 1167
288 Ga0466963_0000452 3300044694 Bacteria 19018
289 Ga0466963_0033462 3300044694 Bacteria 3337
290 Ga0466963_0096595 3300044694 Bacteria 2018
291 Ga0466963_0103827 3300044694 Bacteria 1947
292 Ga0466963_0104793 3300044694 Bacteria 1938
293 Ga0466963_0113585 3300044694 Bacteria 1860
294 Ga0466964_0048353 3300044706 Bacteria 1739
295 Ga0466964_0073772 3300044706 Bacteria 1449
296 Ga0466971_0029450 3300044719 Bacteria 2456
297 Ga0466970_0031492 3300044765 Bacteria 2801
298 Ga0466970_0092279 3300044765 Bacteria 1644
299 Ga0466970_0140934 3300044765 Bacteria 1328
300 Ga0466970_0158568 3300044765 Bacteria 1251
301 Ga0466970_0166521 3300044765 Bacteria 1220
302 Ga0466957_0023515 3300044842 Bacteria 3643
303 Ga0466957_0049256 3300044842 Bacteria 2561
304 Ga0466959_0148815 3300045049 Bacteria 1651
305 Ga0466959_0308768 3300045049 Bacteria 1082
306 Ga0466958_0030781 3300045836 Bacteria 3189
307 Ga0466958_0044349 3300045836 Bacteria 2680
308 Ga0466958_0185881 3300045836 Bacteria 1319
309 Ga0466967_0003089 3300045976 Bacteria 10706
310 Ga0466967_0017575 3300045976 Bacteria 5684
311 Ga0466967_0247697 3300045976 Bacteria 1701
312 Ga0466967_0466259 3300045976 Bacteria 1236
313 Ga0466967_0938999 3300045976 Bacteria 861
314 Ga0495617_023825 3300046452 Bacteria 2066
315 Ga0495592_0001572 3300046454 Bacteria 15956
316 Ga0495592_0008609 3300046454 Bacteria 7657
317 Ga0495603_0021089 3300046455 Bacteria 3945
318 Ga0495603_0064031 3300046455 Bacteria 2168
319 Ga0495603_0125526 3300046455 Bacteria 1496
320 Ga0495590_0041099 3300046457 Bacteria 1612
321 Ga0495629_0038922 3300046459 Bacteria 3348
322 Ga0495629_0058976 3300046459 Bacteria 2683
323 Ga0495641_0082234 3300046461 Bacteria 1442
324 Ga0495651_0159257 3300046462 Bacteria 1619
325 Ga0495605_0003368 3300046474 Bacteria 9550
326 Ga0495662_0002086 3300046476 Bacteria 10023
327 Ga0495662_0004744 3300046476 Bacteria 6811
328 Ga0495662_0132714 3300046476 Bacteria 1224
329 Ga0495664_0002181 3300046477 Bacteria 10485
330 Ga0495594_0009594 3300046499 Bacteria 5003
331 Ga0495596_0044270 3300046500 Bacteria 1752
332 Ga0495583_0049301 3300046506 Bacteria 1929
333 Ga0495583_0091496 3300046506 Bacteria 1309
334 Ga0495606_0005627 3300046507 Bacteria 11895
335 Ga0495610_0012317 3300046512 Bacteria 5158
336 Ga0495618_0176920 3300046514 Bacteria 1356
337 Ga0495620_0005492 3300046515 Bacteria 7066
338 Ga0495620_0006957 3300046515 Bacteria 6173
339 Ga0495628_0069662 3300046516 Bacteria 2743
340 Ga0495628_0144296 3300046516 Bacteria 1815
341 Ga0495630_0167516 3300046517 Bacteria 1673
342 Ga0495630_0235697 3300046517 Bacteria 1398
343 Ga0495631_0001500 3300046518 Bacteria 14075
344 Ga0495643_0010717 3300046522 Bacteria 5632
345 Ga0495648_0071666 3300046524 Bacteria 2007
346 Ga0495648_0147896 3300046524 Bacteria 1228
347 Ga0495666_0029566 3300046526 Bacteria 2695
348 Ga0495642_0073716 3300046528 Bacteria 1430
349 Ga0495652_0011673 3300046529 Bacteria 7939
350 Ga0495652_0012235 3300046529 Bacteria 7749
351 Ga0495654_0038740 3300046530 Bacteria 2382
352 Ga0495665_0094032 3300046531 Bacteria 1575
353 Ga0495640_0008471 3300046533 Bacteria 8063
354 Ga0495640_0015588 3300046533 Bacteria 5713
355 Ga0495586_0047208 3300046535 Bacteria 2324
356 Ga0495587_0004992 3300046536 Bacteria 8687
357 Ga0495597_0006381 3300046542 Bacteria 6102
358 Ga0495597_0166353 3300046542 Bacteria 897
359 Ga0495645_0065464 3300046543 Bacteria 2629
360 Ga0495622_0004737 3300046557 Bacteria 6296
361 Ga0495622_0038473 3300046557 Bacteria 2227
362 Ga0495622_0089547 3300046557 Bacteria 1414
363 Ga0495633_0018655 3300046558 Bacteria 3520
364 Ga0495667_0259497 3300046559 Bacteria 1105
365 Ga0495656_0150035 3300046615 Bacteria 1125
366 Ga0495668_0003067 3300046616 Bacteria 12940
367 Ga0495668_0030042 3300046616 Bacteria 3069
368 Ga0495634_0008020 3300046642 Bacteria 7881
369 Ga0495634_0011690 3300046642 Bacteria 6384
370 Ga0495625_0041044 3300046660 Bacteria 3369
371 Ga0495625_0074275 3300046660 Bacteria 2382
372 Ga0495625_0108659 3300046660 Bacteria 1898
373 Ga0495635_0047449 3300046663 Bacteria 2962
374 Ga0495635_0050691 3300046663 Bacteria 2861
375 Ga0495661_0023252 3300046665 Bacteria 4023
376 Ga0495657_0000784 3300046675 Bacteria 28288
377 Ga0495599_0144608 3300046678 Bacteria 1474
378 Ga0495623_0073306 3300046679 Bacteria 2128
379 Ga0495623_0152613 3300046679 Bacteria 1364
380 Ga0495646_0000744 3300046680 Bacteria 18130
381 Ga0495613_0003321 3300046689 Bacteria 12050
382 Ga0495613_0007950 3300046689 Bacteria 7893
383 Ga0495613_0023187 3300046689 Bacteria 4624
384 Ga0495613_0149817 3300046689 Bacteria 1664
385 Ga0495613_0182545 3300046689 Bacteria 1485
386 Ga0495613_0434318 3300046689 Bacteria 891
387 Ga0495624_0022452 3300046690 Bacteria 4171
388 Ga0495624_0023542 3300046690 Bacteria 4061
389 Ga0495670_0094886 3300046691 Bacteria 1530
390 Ga0495649_0021665 3300046694 Bacteria 3600
391 Ga0495649_0111253 3300046694 Bacteria 1452
392 Ga0495589_0004663 3300046794 Bacteria 7281
393 Ga0495589_0078740 3300046794 Bacteria 1604
394 Ga0495581_0001059 3300047315 Bacteria 14916
395 Ga0495581_0028789 3300047315 Bacteria 3221
396 Ga0495581_0040042 3300047315 Bacteria 2713
397 Ga0495604_0000368 3300047317 Bacteria 40631
398 Ga0495604_0004274 3300047317 Bacteria 11310
399 Ga0495604_0053164 3300047317 Bacteria 3132
400 Ga0495604_0136580 3300047317 Bacteria 1756
401 Ga0495604_0311938 3300047317 Bacteria 1053
402 Ga0495636_0079242 3300047318 Bacteria 1412
403 Ga0495674_0250266 3300047319 Bacteria 1458
404 Ga0495672_0131369 3300047320 Bacteria 1317
405 Ga0495676_0022629 3300047321 Bacteria 5465
406 Ga0495676_0023590 3300047321 Bacteria 5336
407 Ga0495676_0029396 3300047321 Bacteria 4679
408 Ga0495676_0091550 3300047321 Bacteria 2273
409 Ga0495676_0134892 3300047321 Bacteria 1776
410 Ga0495680_0013488 3300047322 Bacteria 7128
411 Ga0495687_039239 3300047443 Bacteria 2096
412 Ga0495687_039705 3300047443 Bacteria 2080
413 Ga0495675_0019726 3300047444 Bacteria 4284
414 Ga0495675_0131653 3300047444 Bacteria 1554
415 Ga0495677_0063740 3300047445 Bacteria 1369
416 Ga0495593_0005411 3300047673 Bacteria 7542
417 Ga0495602_0118594 3300048088 Bacteria 2134
418 Ga0495614_0112230 3300048089 Bacteria 1197
419 Ga0495626_0005502 3300048091 Bacteria 7377
420 Ga0496100_0039188 3300048903 Bacteria 3008
421 Ga0496102_0020127 3300048905 Bacteria 5891
422 Ga0496102_0023197 3300048905 Bacteria 5508
423 Ga0496103_0036404 3300048906 Bacteria 3014
424 Ga0496103_0068217 3300048906 Bacteria 2222
425 Ga0496103_0105462 3300048906 Bacteria 1787
426 Ga0496104_0035579 3300048907 Bacteria 4649
427 Ga0496104_0194891 3300048907 Bacteria 1938
428 Ga0496105_0060964 3300048908 Bacteria 3113
429 Ga0496106_0032469 3300048909 Bacteria 3892
430 Ga0496106_0158309 3300048909 Bacteria 1790
431 Ga0496107_0043844 3300048910 Bacteria 3214
432 Ga0496108_0011996 3300048911 Bacteria 7050
433 Ga0496108_0031072 3300048911 Bacteria 4428
434 Ga0496108_0426134 3300048911 Bacteria 1159
435 Ga0496109_0006176 3300048912 Bacteria 10068
436 Ga0496109_0121420 3300048912 Bacteria 2434
437 Ga0496109_0205738 3300048912 Bacteria 1850
438 Ga0496109_0331338 3300048912 Bacteria 1437
439 Ga0496110_0004671 3300048913 Bacteria 10648
440 Ga0496110_0166262 3300048913 Bacteria 2000
441 Ga0496110_0506908 3300048913 Bacteria 1098
442 Ga0496111_0021434 3300048914 Bacteria 4512
443 Ga0496111_0024608 3300048914 Bacteria 4242
444 Ga0496112_0050113 3300048915 Bacteria 4093
445 Ga0496112_0116963 3300048915 Bacteria 2636
446 Ga0496112_0457857 3300048915 Bacteria 1213
447 Ga0496113_0005476 3300048916 Bacteria 7920
448 Ga0496113_0476603 3300048916 Bacteria 1002
449 Ga0496114_0019850 3300048917 Bacteria 5449
450 Ga0496115_0010456 3300048918 Bacteria 6935
451 Ga0496116_0000474 3300048919 Bacteria 55522
452 Ga0496117_0000367 3300048920 Bacteria 78467
453 Ga0496117_0020254 3300048920 Bacteria 5428
454 Ga0496118_0002773 3300048921 Bacteria 22948
455 Ga0496119_0015302 3300048922 Bacteria 5919
456 Ga0496119_0104192 3300048922 Bacteria 1587
457 Ga0496121_0006012 3300048924 Bacteria 15316
458 Ga0496121_0034330 3300048924 Bacteria 4567
459 Ga0496121_0052415 3300048924 Bacteria 3427
460 Ga0496126_0000006 3300048929 Bacteria 798804
461 Ga0496126_0179904 3300048929 Bacteria 1797
462 Ga0496126_0611550 3300048929 Bacteria 857
463 Ga0501031_0275360 3300049568 Bacteria 1092
464 Ga0501032_0016571 3300049569 Bacteria 5182
465 Ga0501032_0115882 3300049569 Bacteria 1772
466 Ga0501033_0001412 3300049570 Bacteria 21332
467 Ga0501034_0021532 3300049571 Bacteria 6569
468 Ga0501034_0080870 3300049571 Bacteria 3253
469 Ga0501037_0067019 3300049573 Bacteria 2614
470 Ga0501037_0232326 3300049573 Bacteria 1294
471 Ga0501038_0006143 3300049574 Bacteria 11120
472 Ga0501038_0393710 3300049574 Bacteria 1073
473 Ga0501043_0030259 3300049579 Bacteria 4254
474 Ga0501047_0094195 3300049581 Bacteria 2874
475 Ga0501047_0210797 3300049581 Bacteria 1801
476 Ga0501067_0000869 3300049583 Bacteria 16242
477 Ga0501068_0003970 3300049584 Bacteria 8046
478 Ga0501068_0135328 3300049584 Bacteria 1543
479 Ga0501069_0100901 3300049585 Bacteria 1638
480 Ga0501070_0004060 3300049586 Bacteria 12580
481 Ga0501070_0006109 3300049586 Bacteria 10267
482 Ga0501070_0006661 3300049586 Bacteria 9835
483 Ga0501071_0036344 3300049587 Bacteria 3513
484 Ga0501072_0061761 3300049588 Bacteria 2955
485 Ga0501073_0124551 3300049589 Bacteria 1786
486 Ga0501073_0154471 3300049589 Bacteria 1590
487 Ga0501074_0001389 3300049590 Bacteria 16077
488 Ga0501074_0079542 3300049590 Bacteria 2352
489 Ga0501077_0003114 3300049593 Bacteria 9974
490 Ga0501080_0000233 3300049742 Bacteria 41803
491 Ga0501080_0041769 3300049742 Bacteria 4271
492 Ga0501080_0066185 3300049742 Bacteria 3360
493 Ga0501083_0015685 3300049744 Bacteria 5303
494 Ga0501035_0016340 3300049822 Bacteria 6847
495 Ga0501035_0040895 3300049822 Bacteria 4187
496 Ga0501044_0043041 3300049823 Bacteria 4692
497 Ga0501044_0146049 3300049823 Bacteria 2350
498 nmdc:mga00v17_69232_c1 3300050491 Bacteria 2183
499 nmdc:mga0yw44_272473_c1 3300050492 Bacteria 1130
500 nmdc:mga05p37_16740_c2 3300050507 Bacteria 8124
501 nmdc:mga09592_6944_c1 3300050508 Bacteria 9206
502 nmdc:mga0qj67_11960_c1 3300050509 Bacteria 6522
503 nmdc:mga06r32_9471_c1 3300050510 Bacteria 8792
504 nmdc:mga08y16_423723_c1 3300050511 Bacteria 1360
505 nmdc:mga0n895_87287_c1 3300050512 Bacteria 3117
506 nmdc:mga08x19_120596_c1 3300050514 Bacteria 1758
507 nmdc:mga0a205_5209_c1 3300050515 Bacteria 11701
508 Ga0495601_0068803 3300053077 Bacteria 2257
509 Ga0495612_0002846 3300053078 Bacteria 7158
510 Ga0495612_0027464 3300053078 Bacteria 2289
511 Ga0495619_0134340 3300053085 Bacteria 1701
512 Ga0500644_0072743 3300053088 Bacteria 1243
513 Ga0500583_0230068 3300053092 Bacteria 918
514 Ga0500559_0000589 3300053136 Bacteria 24757
515 Ga0500616_0000424 3300053153 Bacteria 56336
516 Ga0500624_002469 3300053157 Bacteria 2503
517 Ga0500636_0256624 3300053177 Bacteria 888
518 Ga0501084_0018158 3300054114 Bacteria 5857
519 Ga0501082_0073241 3300060353 Bacteria 2950
520 Ga0501082_0233291 3300060353 Bacteria 1601
521 Ga0466962_0002933 3300061719 Bacteria 8130
522 Ga0466962_0023538 3300061719 Bacteria 2960
523 Ga0466962_0075984 3300061719 Bacteria 1605
524 Ga0466962_0194737 3300061719 Bacteria 989
525 Ga0530510_0016341 3300061734 Bacteria 5251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0003114 Ga0501077_0003114_1841_2488 204
2 3300005438 Ga0070701_10119028 Ga0070701_101190282 207
3 3300026075 Ga0207708_10317819 Ga0207708_103178192 207
4 3300044765 Ga0466970_0140934 Ga0466970_0140934_40_765 211
5 3300035242 Ga0373962_0015841 Ga0373962_0015841_1269_1922 213
6 3300050514 nmdc:mga08x19_120596_c1 nmdc:mga08x19_120596_c1_25_678 213
7 3300042131 Ga0450894_015372 Ga0450894_015372_26_694 218
8 3300049585 Ga0501069_0100901 Ga0501069_0100901_503_1234 219
9 3300049586 Ga0501070_0006661 Ga0501070_0006661_3396_4127 219
10 3300049589 Ga0501073_0154471 Ga0501073_0154471_421_1152 219
11 3300049742 Ga0501080_0000233 Ga0501080_0000233_37805_38536 219
12 iso_pu_bacteria 3006393351 3006398524 219
13 3300005435 Ga0070714_100015013 Ga0070714_1000150134 225
14 3300025929 Ga0207664_10046668 Ga0207664_100466682 225
15 3300048929 Ga0496126_0000006 Ga0496126_0000006_91621_92421 228
16 3300044684 Ga0466966_0059787 Ga0466966_0059787_635_1405 230
17 3300037853 Ga0436364_0744111 Ga0436364_0744111_4184_4921 231
18 3300044693 Ga0466961_0001162 Ga0466961_0001162_9433_10221 231
19 3300044694 Ga0466963_0103827 Ga0466963_0103827_1102_1890 231
20 3300061719 Ga0466962_0023538 Ga0466962_0023538_11_799 231
21 3300044694 Ga0466963_0096595 Ga0466963_0096595_98_811 232
22 3300049568 Ga0501031_0275360 Ga0501031_0275360_31_744 232
23 3300005367 Ga0070667_100235887 Ga0070667_1002358872 233
24 3300005563 Ga0068855_100068191 Ga0068855_1000681914 233
25 3300009093 Ga0105240_10088912 Ga0105240_100889122 233
26 3300009098 Ga0105245_10194155 Ga0105245_101941553 233
27 3300013297 Ga0157378_10299689 Ga0157378_102996892 233
28 3300025986 Ga0207658_10406102 Ga0207658_104061022 233
29 3300026067 Ga0207678_10255975 Ga0207678_102559752 233
30 iso_pu_bacteria 2919446982 2919450406 233
31 3300020082 Ga0206353_10069541 Ga0206353_100695413 234
32 3300025945 Ga0207679_10374671 Ga0207679_103746712 234
33 3300044658 Ga0466972_0076701 Ga0466972_0076701_613_1383 234
34 3300044693 Ga0466961_0012003 Ga0466961_0012003_2276_3076 234
35 3300044719 Ga0466971_0029450 Ga0466971_0029450_1637_2437 234
36 3300045049 Ga0466959_0308768 Ga0466959_0308768_147_947 234
37 3300046531 Ga0495665_0094032 Ga0495665_0094032_52_831 234
38 3300061719 Ga0466962_0002933 Ga0466962_0002933_632_1432 234
39 3300005844 Ga0068862_100000106 Ga0068862_10000010645 235
40 3300028380 Ga0268265_10000008 Ga0268265_1000000837 235
41 3300044694 Ga0466963_0104793 Ga0466963_0104793_410_1195 235
42 3300049569 Ga0501032_0016571 Ga0501032_0016571_813_1544 235
43 3300049584 Ga0501068_0135328 Ga0501068_0135328_484_1215 235
44 3300049586 Ga0501070_0006109 Ga0501070_0006109_3174_3905 235
45 3300061734 Ga0530510_0016341 Ga0530510_0016341_3047_3820 236
46 3300005617 Ga0068859_100000325 Ga0068859_10000032515 237
47 3300006931 Ga0097620_100000325 Ga0097620_10000032527 237
48 3300009553 Ga0105249_10108295 Ga0105249_101082953 237
49 3300014325 Ga0163163_10002431 Ga0163163_100024314 237
50 3300025961 Ga0207712_10054601 Ga0207712_100546012 237
51 3300037418 Ga0395900_0144945 Ga0395900_0144945_431_1180 237
52 3300038443 Ga0395901_0032214 Ga0395901_0032214_3504_4253 237
53 3300042007 Ga0439449_0125362 Ga0439449_0125362_114_866 238
54 iso_pu_bacteria 2643221697 2644538146 238
55 iso_pu_bacteria 2684623035 2686537094 238
56 iso_pu_bacteria 2895880812 2895890061 238
57 3300005435 Ga0070714_100000002 Ga0070714_100000002319 239
58 3300005441 Ga0070700_100000124 Ga0070700_10000012410 239
59 3300005564 Ga0070664_100170478 Ga0070664_1001704782 239
60 3300006844 Ga0075428_100015686 Ga0075428_1000156867 239
61 3300006846 Ga0075430_100003236 Ga0075430_10000323610 239
62 3300006880 Ga0075429_100005937 Ga0075429_1000059374 239
63 3300009147 Ga0114129_10041067 Ga0114129_100410674 239
64 3300013307 Ga0157372_10002366 Ga0157372_1000236611 239
65 3300025924 Ga0207694_10047577 Ga0207694_100475773 239
66 3300025929 Ga0207664_10000038 Ga0207664_10000038113 239
67 3300026075 Ga0207708_10000023 Ga0207708_10000023140 239
68 3300037466 Ga0395898_0008145 Ga0395898_0008145_9406_10161 239
69 3300038443 Ga0395901_0025615 Ga0395901_0025615_1075_1830 239
70 3300048912 Ga0496109_0331338 Ga0496109_0331338_270_1046 239
71 3300048915 Ga0496112_0457857 Ga0496112_0457857_95_868 239
72 3300048916 Ga0496113_0005476 Ga0496113_0005476_3586_4359 239
73 3300050507 nmdc:mga05p37_16740_c2 nmdc:mga05p37_16740_c2_4977_5762 239
74 3300050508 nmdc:mga09592_6944_c1 nmdc:mga09592_6944_c1_6010_6795 239
75 3300050509 nmdc:mga0qj67_11960_c1 nmdc:mga0qj67_11960_c1_3403_4188 239
76 3300050510 nmdc:mga06r32_9471_c1 nmdc:mga06r32_9471_c1_1998_2783 239
77 iso_pu_bacteria 2643221601 2644019408 239
78 iso_pu_bacteria 2643221631 2644177732 239
79 3300021384 Ga0213876_10024982 Ga0213876_100249823 240
80 3300039437 Ga0436365_1829699 Ga0436365_1829699_4400_5149 240
81 3300041512 Ga0451853_0147823 Ga0451853_0147823_5901_6734 240
82 3300048929 Ga0496126_0611550 Ga0496126_0611550_43_792 240
83 iso_pu_bacteria 2643221694 2644526161 240
84 iso_pu_bacteria 2643221722 2644670838 240
85 3300005334 Ga0068869_100021696 Ga0068869_1000216962 241
86 3300005335 Ga0070666_10033090 Ga0070666_100330902 241
87 3300005336 Ga0070680_100118095 Ga0070680_1001180953 241
88 3300005337 Ga0070682_100197636 Ga0070682_1001976361 241
89 3300005338 Ga0068868_100003029 Ga0068868_10000302911 241
90 3300005339 Ga0070660_100028983 Ga0070660_1000289832 241
91 3300005340 Ga0070689_100111460 Ga0070689_1001114602 241
92 3300005341 Ga0070691_10039916 Ga0070691_100399162 241
93 3300005345 Ga0070692_10140399 Ga0070692_101403991 241
94 3300005347 Ga0070668_100012087 Ga0070668_1000120873 241
95 3300005356 Ga0070674_100492111 Ga0070674_1004921111 241
96 3300005364 Ga0070673_100282377 Ga0070673_1002823771 241
97 3300005366 Ga0070659_100019627 Ga0070659_1000196274 241
98 3300005435 Ga0070714_100795226 Ga0070714_1007952261 241
99 3300005439 Ga0070711_100078684 Ga0070711_1000786843 241
100 3300005440 Ga0070705_100003977 Ga0070705_1000039772 241
101 3300005455 Ga0070663_100014932 Ga0070663_1000149323 241
102 3300005457 Ga0070662_100034241 Ga0070662_1000342413 241
103 3300005459 Ga0068867_100123477 Ga0068867_1001234772 241
104 3300005466 Ga0070685_10019530 Ga0070685_100195302 241
105 3300005471 Ga0070698_100459427 Ga0070698_1004594272 241
106 3300005539 Ga0068853_100205064 Ga0068853_1002050641 241
107 3300005543 Ga0070672_100440880 Ga0070672_1004408802 241
108 3300005544 Ga0070686_100081792 Ga0070686_1000817923 241
109 3300005545 Ga0070695_100011401 Ga0070695_1000114013 241
110 3300005546 Ga0070696_100023865 Ga0070696_1000238654 241
111 3300005547 Ga0070693_100005276 Ga0070693_1000052761 241
112 3300005548 Ga0070665_100059353 Ga0070665_1000593531 241
113 3300005549 Ga0070704_100008699 Ga0070704_1000086995 241
114 3300005563 Ga0068855_100032936 Ga0068855_1000329362 241
115 3300005564 Ga0070664_100104217 Ga0070664_1001042173 241
116 3300005577 Ga0068857_100629391 Ga0068857_1006293911 241
117 3300005616 Ga0068852_100133164 Ga0068852_1001331642 241
118 3300005719 Ga0068861_100006531 Ga0068861_1000065315 241
119 3300005841 Ga0068863_100038829 Ga0068863_1000388295 241
120 3300005842 Ga0068858_100050207 Ga0068858_1000502074 241
121 3300005843 Ga0068860_100058208 Ga0068860_1000582081 241
122 3300005983 Ga0081540_1001870 Ga0081540_10018707 241
123 3300006028 Ga0070717_10027752 Ga0070717_100277523 241
124 3300006163 Ga0070715_10014550 Ga0070715_100145503 241
125 3300006175 Ga0070712_100199821 Ga0070712_1001998212 241
126 3300006237 Ga0097621_100048951 Ga0097621_1000489514 241
127 3300006358 Ga0068871_100087272 Ga0068871_1000872722 241
128 3300006871 Ga0075434_100313019 Ga0075434_1003130191 241
129 3300006881 Ga0068865_100260815 Ga0068865_1002608152 241
130 3300006914 Ga0075436_100025263 Ga0075436_1000252633 241
131 3300007076 Ga0075435_100002135 Ga0075435_1000021353 241
132 3300009094 Ga0111539_10148269 Ga0111539_101482691 241
133 3300009098 Ga0105245_10004893 Ga0105245_100048935 241
134 3300009098 Ga0105245_10012793 Ga0105245_100127935 241
135 3300009148 Ga0105243_10056175 Ga0105243_100561753 241
136 3300009177 Ga0105248_10014436 Ga0105248_100144365 241
137 3300009545 Ga0105237_10067649 Ga0105237_100676493 241
138 3300009551 Ga0105238_10071058 Ga0105238_100710582 241
139 3300009553 Ga0105249_10003464 Ga0105249_1000346412 241
140 3300010375 Ga0105239_10412696 Ga0105239_104126962 241
141 3300010375 Ga0105239_11102387 Ga0105239_111023871 241
142 3300011119 Ga0105246_10017682 Ga0105246_100176823 241
143 3300013102 Ga0157371_10014394 Ga0157371_100143945 241
144 3300013104 Ga0157370_10012239 Ga0157370_100122394 241
145 3300013105 Ga0157369_10026043 Ga0157369_100260436 241
146 3300013296 Ga0157374_10110396 Ga0157374_101103963 241
147 3300013297 Ga0157378_10053686 Ga0157378_100536863 241
148 3300013306 Ga0163162_10005797 Ga0163162_100057972 241
149 3300013307 Ga0157372_10061089 Ga0157372_100610893 241
150 3300013308 Ga0157375_10085499 Ga0157375_100854993 241
151 3300014325 Ga0163163_10038252 Ga0163163_100382522 241
152 3300014326 Ga0157380_10013493 Ga0157380_100134936 241
153 3300014968 Ga0157379_10006815 Ga0157379_100068154 241
154 3300014969 Ga0157376_10030129 Ga0157376_100301294 241
155 3300017792 Ga0163161_10120575 Ga0163161_101205752 241
156 3300025901 Ga0207688_10000570 Ga0207688_100005708 241
157 3300025911 Ga0207654_10026989 Ga0207654_100269893 241
158 3300025911 Ga0207654_10147578 Ga0207654_101475781 241
159 3300025915 Ga0207693_10002123 Ga0207693_100021239 241
160 3300025916 Ga0207663_10200760 Ga0207663_102007601 241
161 3300025923 Ga0207681_10290731 Ga0207681_102907312 241
162 3300025924 Ga0207694_10286459 Ga0207694_102864591 241
163 3300025927 Ga0207687_10005838 Ga0207687_100058384 241
164 3300025931 Ga0207644_10217404 Ga0207644_102174042 241
165 3300025933 Ga0207706_10007205 Ga0207706_100072052 241
166 3300025934 Ga0207686_10256852 Ga0207686_102568522 241
167 3300025935 Ga0207709_10423002 Ga0207709_104230021 241
168 3300025939 Ga0207665_10002367 Ga0207665_100023676 241
169 3300025940 Ga0207691_10075098 Ga0207691_100750982 241
170 3300025941 Ga0207711_10123759 Ga0207711_101237591 241
171 3300025942 Ga0207689_10008478 Ga0207689_100084786 241
172 3300025949 Ga0207667_10007161 Ga0207667_100071615 241
173 3300025972 Ga0207668_10010928 Ga0207668_100109282 241
174 3300026035 Ga0207703_10357920 Ga0207703_103579201 241
175 3300026078 Ga0207702_10666001 Ga0207702_106660011 241
176 3300026088 Ga0207641_10040208 Ga0207641_100402083 241
177 3300026089 Ga0207648_10040754 Ga0207648_100407543 241
178 3300026118 Ga0207675_100005797 Ga0207675_1000057975 241
179 3300026121 Ga0207683_10049319 Ga0207683_100493192 241
180 3300028379 Ga0268266_10442788 Ga0268266_104427881 241
181 3300028381 Ga0268264_10299507 Ga0268264_102995072 241
182 3300033180 Ga0307510_10077869 Ga0307510_100778691 241
183 3300034957 Ga0373938_0003459 Ga0373938_0003459_1082_1837 241
184 3300035085 Ga0373929_0034644 Ga0373929_0034644_150_905 241
185 3300035090 Ga0373949_0015760 Ga0373949_0015760_859_1614 241
186 3300035092 Ga0373952_0036334 Ga0373952_0036334_40_795 241
187 3300035114 Ga0373939_0000981 Ga0373939_0000981_779_1534 241
188 3300035241 Ga0373961_0008233 Ga0373961_0008233_871_1626 241
189 3300035691 Ga0373931_0009228 Ga0373931_0009228_2484_3239 241
190 3300035695 Ga0373927_0205498 Ga0373927_0205498_47_793 241
191 3300037068 Ga0373925_0290757 Ga0373925_0290757_35_790 241
192 3300044684 Ga0466966_0023637 Ga0466966_0023637_2119_2889 241
193 3300044684 Ga0466966_0180441 Ga0466966_0180441_493_1239 241
194 3300044684 Ga0466966_0244437 Ga0466966_0244437_266_1012 241
195 3300044693 Ga0466961_0032747 Ga0466961_0032747_1230_2000 241
196 3300044693 Ga0466961_0037060 Ga0466961_0037060_1998_2744 241
197 3300044693 Ga0466961_0053518 Ga0466961_0053518_437_1207 241
198 3300044693 Ga0466961_0069088 Ga0466961_0069088_259_1005 241
199 3300044693 Ga0466961_0135324 Ga0466961_0135324_81_827 241
200 3300044693 Ga0466961_0221133 Ga0466961_0221133_109_855 241
201 3300044694 Ga0466963_0000452 Ga0466963_0000452_11851_12597 241
202 3300044694 Ga0466963_0113585 Ga0466963_0113585_1026_1772 241
203 3300044765 Ga0466970_0031492 Ga0466970_0031492_361_1131 241
204 3300044765 Ga0466970_0092279 Ga0466970_0092279_196_966 241
205 3300044842 Ga0466957_0023515 Ga0466957_0023515_1306_2076 241
206 3300044842 Ga0466957_0049256 Ga0466957_0049256_1313_2059 241
207 3300045049 Ga0466959_0148815 Ga0466959_0148815_809_1579 241
208 3300045836 Ga0466958_0030781 Ga0466958_0030781_1369_2139 241
209 3300045836 Ga0466958_0044349 Ga0466958_0044349_762_1508 241
210 3300045836 Ga0466958_0185881 Ga0466958_0185881_483_1253 241
211 3300045976 Ga0466967_0003089 Ga0466967_0003089_4104_4850 241
212 3300045976 Ga0466967_0466259 Ga0466967_0466259_199_945 241
213 3300045976 Ga0466967_0938999 Ga0466967_0938999_38_784 241
214 3300048903 Ga0496100_0039188 Ga0496100_0039188_1776_2531 241
215 3300048905 Ga0496102_0020127 Ga0496102_0020127_1867_2622 241
216 3300048905 Ga0496102_0023197 Ga0496102_0023197_4573_5319 241
217 3300048906 Ga0496103_0036404 Ga0496103_0036404_1324_2079 241
218 3300048906 Ga0496103_0105462 Ga0496103_0105462_596_1342 241
219 3300048907 Ga0496104_0035579 Ga0496104_0035579_2509_3264 241
220 3300048909 Ga0496106_0032469 Ga0496106_0032469_405_1160 241
221 3300048910 Ga0496107_0043844 Ga0496107_0043844_450_1205 241
222 3300048911 Ga0496108_0011996 Ga0496108_0011996_4472_5227 241
223 3300048912 Ga0496109_0121420 Ga0496109_0121420_1534_2289 241
224 3300048913 Ga0496110_0166262 Ga0496110_0166262_140_895 241
225 3300048914 Ga0496111_0024608 Ga0496111_0024608_2790_3545 241
226 3300048915 Ga0496112_0050113 Ga0496112_0050113_1829_2584 241
227 3300048916 Ga0496113_0476603 Ga0496113_0476603_107_862 241
228 3300048918 Ga0496115_0010456 Ga0496115_0010456_6153_6908 241
229 3300048924 Ga0496121_0006012 Ga0496121_0006012_8212_8958 241
230 3300048929 Ga0496126_0179904 Ga0496126_0179904_577_1326 241
231 3300049574 Ga0501038_0393710 Ga0501038_0393710_318_1058 241
232 3300050511 nmdc:mga08y16_423723_c1 nmdc:mga08y16_423723_c1_544_1299 241
233 3300050512 nmdc:mga0n895_87287_c1 nmdc:mga0n895_87287_c1_1324_2079 241
234 3300050515 nmdc:mga0a205_5209_c1 nmdc:mga0a205_5209_c1_2009_2764 241
235 3300053177 Ga0500636_0256624 Ga0500636_0256624_100_852 241
236 3300061719 Ga0466962_0075984 Ga0466962_0075984_626_1372 241
237 3300061719 Ga0466962_0194737 Ga0466962_0194737_12_782 241
238 iso_pu_bacteria 2773857922 2774855223 241
239 3300005435 Ga0070714_100893217 Ga0070714_1008932171 242
240 3300005614 Ga0068856_100102462 Ga0068856_1001024624 242
241 3300009093 Ga0105240_10404449 Ga0105240_104044493 242
242 3300010375 Ga0105239_10021135 Ga0105239_100211353 242
243 3300025913 Ga0207695_10078690 Ga0207695_100786903 242
244 3300026078 Ga0207702_10055062 Ga0207702_100550624 242
245 3300044694 Ga0466963_0033462 Ga0466963_0033462_1090_1863 242
246 3300048922 Ga0496119_0104192 Ga0496119_0104192_235_1008 242
247 3300048924 Ga0496121_0034330 Ga0496121_0034330_809_1582 242
248 3300049569 Ga0501032_0115882 Ga0501032_0115882_402_1361 242
249 3300049571 Ga0501034_0080870 Ga0501034_0080870_538_1398 242
250 3300049823 Ga0501044_0146049 Ga0501044_0146049_625_1584 242
251 3300006038 Ga0075365_10081507 Ga0075365_100815072 243
252 3300013104 Ga0157370_10034564 Ga0157370_100345645 243
253 3300005841 Ga0068863_100005701 Ga0068863_1000057014 244
254 3300014968 Ga0157379_10000203 Ga0157379_1000020321 244
255 3300025900 Ga0207710_10000110 Ga0207710_1000011030 244
256 3300026035 Ga0207703_10000005 Ga0207703_10000005258 244
257 3300026088 Ga0207641_10023439 Ga0207641_100234392 244
258 3300044656 Ga0466969_0058806 Ga0466969_0058806_629_1492 244
259 3300044765 Ga0466970_0166521 Ga0466970_0166521_91_954 244
260 3300048920 Ga0496117_0000367 Ga0496117_0000367_60348_61145 244
261 3300053153 Ga0500616_0000424 Ga0500616_0000424_44343_45110 244
262 iso_pu_bacteria 2643221690 2644506141 244
263 3300005842 Ga0068858_100006048 Ga0068858_1000060482 245
264 3300006931 Ga0097620_100015740 Ga0097620_1000157406 245
265 3300026035 Ga0207703_10018451 Ga0207703_100184512 245
266 3300031649 Ga0307514_10279601 Ga0307514_102796011 245
267 3300045976 Ga0466967_0017575 Ga0466967_0017575_4311_5144 245
268 3300048906 Ga0496103_0068217 Ga0496103_0068217_913_1761 245
269 3300048919 Ga0496116_0000474 Ga0496116_0000474_49105_49953 245
270 3300048920 Ga0496117_0020254 Ga0496117_0020254_330_1178 245
271 3300048921 Ga0496118_0002773 Ga0496118_0002773_5530_6378 245
272 3300048922 Ga0496119_0015302 Ga0496119_0015302_4458_5306 245
273 3300048924 Ga0496121_0052415 Ga0496121_0052415_1846_2700 245
274 iso_pu_bacteria 2508501039 2508674165 245
275 iso_pu_bacteria 2517572101 2517764539 245
276 iso_pu_bacteria 2554235227 2555228692 245
277 iso_pu_bacteria 2654587600 2655033138 245
278 iso_pu_bacteria 2675902999 2676198763 245
279 iso_pu_bacteria 2773857921 2774843341 245
280 iso_pu_bacteria 2919538618 2919540579 245
281 iso_pu_bacteria 8002775197 8002776895 245
282 iso_pu_bacteria 8002784119 8002785263 245
283 3300005329 Ga0070683_100496978 Ga0070683_1004969781 246
284 3300020082 Ga0206353_10926598 Ga0206353_109265982 246
285 3300025944 Ga0207661_10388478 Ga0207661_103884782 246
286 iso_pu_bacteria 2643221681 2644456278 246
287 iso_pu_bacteria 2808606439 2809196734 246
288 iso_pu_bacteria 2811994878 2812351137 246
289 3300005466 Ga0070685_10204967 Ga0070685_102049671 247
290 3300009148 Ga0105243_10007019 Ga0105243_100070196 247
291 3300010375 Ga0105239_11190248 Ga0105239_111902481 247
292 3300049590 Ga0501074_0079542 Ga0501074_0079542_1341_2099 247
293 iso_pu_bacteria 2643221561 2643826160 247
294 iso_pu_bacteria 2643221696 2644532135 247
295 iso_pu_bacteria 2964326757 2964329588 247
296 3300005617 Ga0068859_100768511 Ga0068859_1007685111 248
297 3300006038 Ga0075365_10103351 Ga0075365_101033512 248
298 3300006931 Ga0097620_100768515 Ga0097620_1007685151 248
299 3300009094 Ga0111539_10247192 Ga0111539_102471922 248
300 3300011119 Ga0105246_10001248 Ga0105246_100012482 248
301 3300031247 Ga0265340_10004882 Ga0265340_100048829 248
302 iso_pu_bacteria 2739367898 2740168954 248
303 3300005329 Ga0070683_100004618 Ga0070683_10000461812 249
304 3300005548 Ga0070665_100000522 Ga0070665_10000052252 249
305 3300005548 Ga0070665_100180815 Ga0070665_1001808152 249
306 3300006051 Ga0075364_10420583 Ga0075364_104205831 249
307 3300030522 Ga0307512_10001989 Ga0307512_1000198917 249
308 3300031616 Ga0307508_10043952 Ga0307508_100439521 249
309 3300032002 Ga0307416_100315022 Ga0307416_1003150222 249
310 3300042002 Ga0439442_000840 Ga0439442_000840_3930_4697 249
311 3300042007 Ga0439449_0016559 Ga0439449_0016559_1770_2537 249
312 3300042122 Ga0450920_000547 Ga0450920_000547_4688_5455 249
313 3300042146 Ga0450907_001018 Ga0450907_001018_5296_6063 249
314 3300042435 Ga0439434_0000331 Ga0439434_0000331_5685_6452 249
315 3300042531 Ga0450918_000569 Ga0450918_000569_2590_3357 249
316 3300044706 Ga0466964_0073772 Ga0466964_0073772_82_846 249
317 iso_pu_bacteria 8054609563 8054611218 249
318 3300005327 Ga0070658_10032723 Ga0070658_100327231 250
319 3300005719 Ga0068861_100214282 Ga0068861_1002142822 250
320 3300006178 Ga0075367_10051361 Ga0075367_100513612 250
321 3300013105 Ga0157369_10073728 Ga0157369_100737283 250
322 3300049571 Ga0501034_0021532 Ga0501034_0021532_4863_5630 250
323 3300049573 Ga0501037_0232326 Ga0501037_0232326_197_964 250
324 3300049581 Ga0501047_0094195 Ga0501047_0094195_895_1662 250
325 3300049583 Ga0501067_0000869 Ga0501067_0000869_7507_8274 250
326 3300049584 Ga0501068_0003970 Ga0501068_0003970_6924_7691 250
327 3300049586 Ga0501070_0004060 Ga0501070_0004060_11002_11769 250
328 3300049587 Ga0501071_0036344 Ga0501071_0036344_1245_2012 250
329 3300049588 Ga0501072_0061761 Ga0501072_0061761_1484_2251 250
330 3300049589 Ga0501073_0124551 Ga0501073_0124551_356_1123 250
331 3300049590 Ga0501074_0001389 Ga0501074_0001389_10728_11495 250
332 3300049742 Ga0501080_0041769 Ga0501080_0041769_44_811 250
333 3300049744 Ga0501083_0015685 Ga0501083_0015685_302_1069 250
334 3300050491 nmdc:mga00v17_69232_c1 nmdc:mga00v17_69232_c1_1047_1814 250
335 3300054114 Ga0501084_0018158 Ga0501084_0018158_2044_2811 250
336 3300060353 Ga0501082_0073241 Ga0501082_0073241_608_1375 250
337 3300060353 Ga0501082_0233291 Ga0501082_0233291_790_1560 250
338 iso_pu_bacteria 2773857762 2774392909 250
339 iso_pu_bacteria 2855386786 2855387211 250
340 3300050492 nmdc:mga0yw44_272473_c1 nmdc:mga0yw44_272473_c1_49_834 251
341 3300053136 Ga0500559_0000589 Ga0500559_0000589_20616_21389 251
342 3300005455 Ga0070663_100094687 Ga0070663_1000946872 252
343 3300005548 Ga0070665_100105328 Ga0070665_1001053283 252
344 3300005563 Ga0068855_100019090 Ga0068855_1000190902 252
345 3300005616 Ga0068852_100111327 Ga0068852_1001113272 252
346 3300009093 Ga0105240_10030309 Ga0105240_100303093 252
347 3300009174 Ga0105241_10002482 Ga0105241_100024826 252
348 3300009545 Ga0105237_10011916 Ga0105237_100119167 252
349 3300009551 Ga0105238_10038741 Ga0105238_100387412 252
350 3300013296 Ga0157374_10079604 Ga0157374_100796043 252
351 3300025904 Ga0207647_10040557 Ga0207647_100405572 252
352 3300025911 Ga0207654_10014853 Ga0207654_100148533 252
353 3300025913 Ga0207695_10004382 Ga0207695_100043829 252
354 3300025914 Ga0207671_10004661 Ga0207671_100046618 252
355 3300025924 Ga0207694_10021185 Ga0207694_100211852 252
356 3300025949 Ga0207667_10052680 Ga0207667_100526801 252
357 3300026067 Ga0207678_10103458 Ga0207678_101034582 252
358 3300026142 Ga0207698_10011853 Ga0207698_100118534 252
359 3300028379 Ga0268266_10133937 Ga0268266_101339372 252
360 3300047320 Ga0495672_0131369 Ga0495672_0131369_96_881 252
361 iso_pu_bacteria 2585427649 2586061261 252
362 iso_pu_bacteria 2808606522 2809589652 252
363 iso_pu_bacteria 2915768154 2915769724 252
364 3300006038 Ga0075365_10006894 Ga0075365_100068944 253
365 3300048089 Ga0495614_0112230 Ga0495614_0112230_302_1087 253
366 3300005339 Ga0070660_100271887 Ga0070660_1002718872 254
367 3300005577 Ga0068857_100239242 Ga0068857_1002392422 254
368 3300013104 Ga0157370_10258805 Ga0157370_102588052 254
369 3300020082 Ga0206353_10341763 Ga0206353_103417631 254
370 3300025919 Ga0207657_10114372 Ga0207657_101143722 254
371 3300026116 Ga0207674_10009187 Ga0207674_1000918710 254
372 iso_pu_bacteria 2862993130 2862996173 254
373 iso_pu_bacteria 2795385470 2795786924 255
374 3300031838 Ga0307518_10000093 Ga0307518_1000009348 256
375 3300033179 Ga0307507_10000081 Ga0307507_1000008175 256
376 3300041494 Ga0451837_0806448 Ga0451837_0806448_467_1255 256
377 3300046660 Ga0495625_0074275 Ga0495625_0074275_893_1675 256
378 iso_pu_bacteria 2866612099 2866614948 256
379 3300046454 Ga0495592_0001572 Ga0495592_0001572_7902_8687 257
380 3300046476 Ga0495662_0002086 Ga0495662_0002086_7906_8691 257
381 3300046477 Ga0495664_0002181 Ga0495664_0002181_8627_9412 257
382 3300046517 Ga0495630_0235697 Ga0495630_0235697_279_1064 257
383 3300046529 Ga0495652_0011673 Ga0495652_0011673_3473_4258 257
384 3300046535 Ga0495586_0047208 Ga0495586_0047208_1150_1935 257
385 3300046536 Ga0495587_0004992 Ga0495587_0004992_3520_4305 257
386 3300046543 Ga0495645_0065464 Ga0495645_0065464_582_1367 257
387 3300046642 Ga0495634_0011690 Ga0495634_0011690_716_1501 257
388 3300046675 Ga0495657_0000784 Ga0495657_0000784_19557_20342 257
389 3300046678 Ga0495599_0144608 Ga0495599_0144608_180_965 257
390 3300046679 Ga0495623_0152613 Ga0495623_0152613_226_1011 257
391 3300046680 Ga0495646_0000744 Ga0495646_0000744_4006_4791 257
392 3300046689 Ga0495613_0003321 Ga0495613_0003321_885_1670 257
393 3300047315 Ga0495581_0001059 Ga0495581_0001059_1974_2759 257
394 3300047317 Ga0495604_0000368 Ga0495604_0000368_20050_20835 257
395 3300047319 Ga0495674_0250266 Ga0495674_0250266_285_1070 257
396 3300047321 Ga0495676_0029396 Ga0495676_0029396_3656_4441 257
397 3300047673 Ga0495593_0005411 Ga0495593_0005411_4114_4899 257
398 3300048088 Ga0495602_0118594 Ga0495602_0118594_1095_1880 257
399 3300053078 Ga0495612_0027464 Ga0495612_0027464_756_1541 257
400 3300053085 Ga0495619_0134340 Ga0495619_0134340_717_1502 257
401 3300053157 Ga0500624_002469 Ga0500624_002469_645_1430 257
402 iso_pu_bacteria 8003314358 8003320006 257
403 3300041494 Ga0451837_0295870 Ga0451837_0295870_1029_1880 258
404 3300042014 Ga0439457_000116 Ga0439457_000116_7787_8590 258
405 3300026088 Ga0207641_10727337 Ga0207641_107273372 259
406 3300033179 Ga0307507_10230459 Ga0307507_102304591 259
407 3300049570 Ga0501033_0001412 Ga0501033_0001412_18913_19719 259
408 3300049822 Ga0501035_0040895 Ga0501035_0040895_939_1745 259
409 iso_pu_bacteria 2799112218 2799186340 259
410 3300011119 Ga0105246_10079336 Ga0105246_100793362 260
411 3300013105 Ga0157369_10154126 Ga0157369_101541263 260
412 3300013307 Ga0157372_10458253 Ga0157372_104582532 260
413 3300031616 Ga0307508_10298521 Ga0307508_102985211 260
414 3300041498 Ga0451841_1321351 Ga0451841_1321351_618_1487 260
415 3300046457 Ga0495590_0041099 Ga0495590_0041099_634_1428 260
416 3300046459 Ga0495629_0038922 Ga0495629_0038922_164_958 260
417 3300046459 Ga0495629_0058976 Ga0495629_0058976_1436_2230 260
418 3300046461 Ga0495641_0082234 Ga0495641_0082234_98_892 260
419 3300046474 Ga0495605_0003368 Ga0495605_0003368_4157_4951 260
420 3300046476 Ga0495662_0132714 Ga0495662_0132714_234_1028 260
421 3300046499 Ga0495594_0009594 Ga0495594_0009594_2782_3576 260
422 3300046500 Ga0495596_0044270 Ga0495596_0044270_430_1224 260
423 3300046506 Ga0495583_0091496 Ga0495583_0091496_170_964 260
424 3300046507 Ga0495606_0005627 Ga0495606_0005627_4759_5553 260
425 3300046512 Ga0495610_0012317 Ga0495610_0012317_1418_2212 260
426 3300046515 Ga0495620_0005492 Ga0495620_0005492_4605_5399 260
427 3300046515 Ga0495620_0006957 Ga0495620_0006957_4381_5175 260
428 3300046516 Ga0495628_0069662 Ga0495628_0069662_1748_2542 260
429 3300046517 Ga0495630_0167516 Ga0495630_0167516_213_1007 260
430 3300046518 Ga0495631_0001500 Ga0495631_0001500_11333_12127 260
431 3300046522 Ga0495643_0010717 Ga0495643_0010717_1195_1989 260
432 3300046524 Ga0495648_0071666 Ga0495648_0071666_207_1001 260
433 3300046524 Ga0495648_0147896 Ga0495648_0147896_54_848 260
434 3300046526 Ga0495666_0029566 Ga0495666_0029566_345_1139 260
435 3300046528 Ga0495642_0073716 Ga0495642_0073716_341_1135 260
436 3300046530 Ga0495654_0038740 Ga0495654_0038740_1436_2230 260
437 3300046533 Ga0495640_0008471 Ga0495640_0008471_4297_5091 260
438 3300046542 Ga0495597_0006381 Ga0495597_0006381_2635_3429 260
439 3300046557 Ga0495622_0004737 Ga0495622_0004737_686_1480 260
440 3300046558 Ga0495633_0018655 Ga0495633_0018655_2684_3478 260
441 3300046616 Ga0495668_0003067 Ga0495668_0003067_10071_10865 260
442 3300046616 Ga0495668_0030042 Ga0495668_0030042_854_1648 260
443 3300046660 Ga0495625_0041044 Ga0495625_0041044_478_1272 260
444 3300046663 Ga0495635_0047449 Ga0495635_0047449_454_1248 260
445 3300046663 Ga0495635_0050691 Ga0495635_0050691_1937_2731 260
446 3300046665 Ga0495661_0023252 Ga0495661_0023252_1826_2620 260
447 3300046679 Ga0495623_0073306 Ga0495623_0073306_145_939 260
448 3300046689 Ga0495613_0007950 Ga0495613_0007950_2762_3556 260
449 3300046689 Ga0495613_0149817 Ga0495613_0149817_706_1500 260
450 3300046689 Ga0495613_0182545 Ga0495613_0182545_666_1460 260
451 3300046690 Ga0495624_0023542 Ga0495624_0023542_1095_1889 260
452 3300046691 Ga0495670_0094886 Ga0495670_0094886_346_1140 260
453 3300046694 Ga0495649_0021665 Ga0495649_0021665_610_1404 260
454 3300046694 Ga0495649_0111253 Ga0495649_0111253_610_1404 260
455 3300046794 Ga0495589_0004663 Ga0495589_0004663_1945_2739 260
456 3300046794 Ga0495589_0078740 Ga0495589_0078740_293_1087 260
457 3300047315 Ga0495581_0028789 Ga0495581_0028789_1141_1935 260
458 3300047317 Ga0495604_0136580 Ga0495604_0136580_650_1444 260
459 3300047317 Ga0495604_0311938 Ga0495604_0311938_11_805 260
460 3300047318 Ga0495636_0079242 Ga0495636_0079242_529_1323 260
461 3300047321 Ga0495676_0023590 Ga0495676_0023590_572_1366 260
462 3300047321 Ga0495676_0134892 Ga0495676_0134892_572_1366 260
463 3300047322 Ga0495680_0013488 Ga0495680_0013488_772_1566 260
464 3300047443 Ga0495687_039239 Ga0495687_039239_85_879 260
465 3300048091 Ga0495626_0005502 Ga0495626_0005502_5309_6103 260
466 3300048912 Ga0496109_0006176 Ga0496109_0006176_5219_6013 260
467 3300049573 Ga0501037_0067019 Ga0501037_0067019_115_909 260
468 3300049574 Ga0501038_0006143 Ga0501038_0006143_9989_10783 260
469 3300049579 Ga0501043_0030259 Ga0501043_0030259_2739_3533 260
470 3300049581 Ga0501047_0210797 Ga0501047_0210797_729_1523 260
471 3300049742 Ga0501080_0066185 Ga0501080_0066185_1586_2380 260
472 3300049823 Ga0501044_0043041 Ga0501044_0043041_1386_2180 260
473 3300005435 Ga0070714_100128363 Ga0070714_1001283633 261
474 3300005455 Ga0070663_100000995 Ga0070663_10000099516 261
475 3300005616 Ga0068852_100218384 Ga0068852_1002183842 261
476 3300009098 Ga0105245_10064804 Ga0105245_100648043 261
477 3300009148 Ga0105243_10167657 Ga0105243_101676572 261
478 3300009553 Ga0105249_10755409 Ga0105249_107554091 261
479 3300013296 Ga0157374_10432536 Ga0157374_104325361 261
480 3300013306 Ga0163162_10144500 Ga0163162_101445002 261
481 3300013308 Ga0157375_10001577 Ga0157375_1000157711 261
482 3300014325 Ga0163163_10161292 Ga0163163_101612923 261
483 3300025929 Ga0207664_10489042 Ga0207664_104890422 261
484 3300025935 Ga0207709_10329133 Ga0207709_103291331 261
485 3300026067 Ga0207678_10000091 Ga0207678_1000009114 261
486 3300033179 Ga0307507_10043437 Ga0307507_100434372 261
487 3300033180 Ga0307510_10092527 Ga0307510_100925272 261
488 3300044706 Ga0466964_0048353 Ga0466964_0048353_549_1352 261
489 3300044765 Ga0466970_0158568 Ga0466970_0158568_326_1123 261
490 3300045976 Ga0466967_0247697 Ga0466967_0247697_294_1097 261
491 3300046455 Ga0495603_0125526 Ga0495603_0125526_370_1173 261
492 3300048907 Ga0496104_0194891 Ga0496104_0194891_724_1527 261
493 3300048908 Ga0496105_0060964 Ga0496105_0060964_2137_2940 261
494 3300048909 Ga0496106_0158309 Ga0496106_0158309_659_1462 261
495 3300048911 Ga0496108_0031072 Ga0496108_0031072_2371_3174 261
496 3300048912 Ga0496109_0205738 Ga0496109_0205738_965_1768 261
497 3300048913 Ga0496110_0004671 Ga0496110_0004671_3872_4675 261
498 3300048914 Ga0496111_0021434 Ga0496111_0021434_542_1345 261
499 3300048915 Ga0496112_0116963 Ga0496112_0116963_995_1798 261
500 3300048917 Ga0496114_0019850 Ga0496114_0019850_2132_2935 261
501 iso_pu_bacteria 2582581314 2585315551 261
502 iso_pu_bacteria 2808606375 2808918596 261
503 3300006844 Ga0075428_100331421 Ga0075428_1003314212 262
504 3300010375 Ga0105239_10049392 Ga0105239_100493922 262
505 3300046462 Ga0495651_0159257 Ga0495651_0159257_579_1448 262
506 3300053077 Ga0495601_0068803 Ga0495601_0068803_393_1262 262
507 3300053078 Ga0495612_0002846 Ga0495612_0002846_1994_2863 262
508 iso_pu_bacteria 2784746763 2785345536 262
509 iso_pu_bacteria 2912723979 2912725931 262
510 iso_pu_bacteria 2990059506 2990062730 262
511 iso_pu_bacteria 8048406513 8048412135 262
512 3300014497 Ga0182008_10000152 Ga0182008_1000015245 263
513 3300015262 Ga0182007_10010546 Ga0182007_100105462 263
514 3300028794 Ga0307515_10141441 Ga0307515_101414411 263
515 3300031456 Ga0307513_10183477 Ga0307513_101834772 263
516 iso_pu_bacteria 2582580736 2583149961 263
517 3300003316 rootH1_10006612 rootH1_100066124 264
518 3300005347 Ga0070668_100017099 Ga0070668_1000170994 264
519 3300025972 Ga0207668_10124815 Ga0207668_101248153 264
520 3300028794 Ga0307515_10098721 Ga0307515_100987212 264
521 3300030522 Ga0307512_10077296 Ga0307512_100772962 264
522 3300031507 Ga0307509_10325748 Ga0307509_103257482 264
523 3300031616 Ga0307508_10188288 Ga0307508_101882882 264
524 3300033179 Ga0307507_10064883 Ga0307507_100648832 264
525 3300044658 Ga0466972_0004125 Ga0466972_0004125_1465_2280 264
526 3300046516 Ga0495628_0144296 Ga0495628_0144296_131_949 264
527 3300046533 Ga0495640_0015588 Ga0495640_0015588_686_1504 264
528 3300046557 Ga0495622_0038473 Ga0495622_0038473_50_868 264
529 3300047317 Ga0495604_0004274 Ga0495604_0004274_7933_8751 264
530 3300047321 Ga0495676_0091550 Ga0495676_0091550_641_1459 264
531 3300047444 Ga0495675_0131653 Ga0495675_0131653_693_1511 264
532 3300053088 Ga0500644_0072743 Ga0500644_0072743_371_1186 264
533 3300053092 Ga0500583_0230068 Ga0500583_0230068_75_893 264
534 iso_pu_bacteria 2616644814 2616695838 264
535 iso_pu_bacteria 2852677369 2852679669 264
536 3300041512 Ga0451853_1270289 Ga0451853_1270289_3353_4171 265
537 iso_pu_bacteria 2863404153 2863406791 265
538 3300046529 Ga0495652_0012235 Ga0495652_0012235_6158_7024 266
539 3300005548 Ga0070665_100044237 Ga0070665_1000442372 267
540 3300005614 Ga0068856_100124853 Ga0068856_1001248532 267
541 3300025904 Ga0207647_10035719 Ga0207647_100357192 267
542 3300025949 Ga0207667_10453008 Ga0207667_104530082 267
543 3300028379 Ga0268266_10056973 Ga0268266_100569732 267
544 3300031507 Ga0307509_10083179 Ga0307509_100831793 267
545 3300046452 Ga0495617_023825 Ga0495617_023825_159_986 267
546 3300046454 Ga0495592_0008609 Ga0495592_0008609_4760_5644 267
547 3300046455 Ga0495603_0021089 Ga0495603_0021089_1305_2171 267
548 3300046455 Ga0495603_0064031 Ga0495603_0064031_1261_2088 267
549 3300046476 Ga0495662_0004744 Ga0495662_0004744_3699_4526 267
550 3300046506 Ga0495583_0049301 Ga0495583_0049301_999_1826 267
551 3300046514 Ga0495618_0176920 Ga0495618_0176920_66_893 267
552 3300046542 Ga0495597_0166353 Ga0495597_0166353_42_869 267
553 3300046557 Ga0495622_0089547 Ga0495622_0089547_65_892 267
554 3300046559 Ga0495667_0259497 Ga0495667_0259497_111_977 267
555 3300046615 Ga0495656_0150035 Ga0495656_0150035_95_922 267
556 3300046642 Ga0495634_0008020 Ga0495634_0008020_2022_2906 267
557 3300046660 Ga0495625_0108659 Ga0495625_0108659_921_1748 267
558 3300046689 Ga0495613_0023187 Ga0495613_0023187_1785_2651 267
559 3300046689 Ga0495613_0434318 Ga0495613_0434318_22_849 267
560 3300046690 Ga0495624_0022452 Ga0495624_0022452_799_1665 267
561 3300047315 Ga0495581_0040042 Ga0495581_0040042_1150_2016 267
562 3300047317 Ga0495604_0053164 Ga0495604_0053164_10_894 267
563 3300047321 Ga0495676_0022629 Ga0495676_0022629_1970_2836 267
564 3300047443 Ga0495687_039705 Ga0495687_039705_54_881 267
565 3300047444 Ga0495675_0019726 Ga0495675_0019726_1464_2348 267
566 3300047445 Ga0495677_0063740 Ga0495677_0063740_420_1247 267
567 3300048911 Ga0496108_0426134 Ga0496108_0426134_315_1142 267
568 3300048913 Ga0496110_0506908 Ga0496110_0506908_141_968 267
569 3300044693 Ga0466961_0046284 Ga0466961_0046284_1113_2042 268
570 iso_pu_bacteria 2728369276 2729905068 268
571 3300049822 Ga0501035_0016340 Ga0501035_0016340_1416_2345 269
572 3300031456 Ga0307513_10002561 Ga0307513_1000256115 285
573 3300003203 JGI25406J46586_10005917 JGI25406J46586_100059175 289
574 3300005985 Ga0081539_10001535 Ga0081539_100015353 289

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p44-assembly1.cif.gz_B crystal structure of ketosteroid isomerase d38n mutant from mycobacterium hassiacum (mhksi) bound to 3,4-dinitrophenol 0.6581 24 57
5m8g-assembly1.cif.gz_A tubulin-mtd265 complex 0.6506 227 271
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.5876 16 64
7oai-assembly1.cif.gz_A crystal structure of pseudokinase cask in complex with pfe-pkis12 0.5779 28 205
5trv-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.5591 17 57
ID Description Score Start End Superfamily
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9407 30 278 3.10.450.50
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9295 30 278 3.10.450.50
af_A0A0G2L6J0_559_755_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.6453 170 265 1.10.1070.11
af_Q4CL54_10_218_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6217 24 205 1.10.510.10
af_Q9VM90_94_421_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6106 27 205 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A6G2UU79-F1-model_v4 SCO1664 family protein 0.9822 164 289
AF-X8CTJ2-F1-model_v4 Phosphatidylinositol 3-and 4-kinase family protein 0.9709 163 289 GO:0016301
AF-A0A7Y3P6A8-F1-model_v4 Phosphatidylinositol kinase 0.9707 14 99 GO:0016301
AF-A0A6B3HDN5-F1-model_v4 SCO1664 family protein 0.9685 141 289
AF-A0A7W9JGX3-F1-model_v4 Putative repeat protein (TIGR03843 family) 0.9674 165 289

Feature Viewer

pLDDT pTM Quality
92.96 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map