F465305
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 361 | 525 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10049392|Ga0105239_100493922 |
| Length | 299 |
| Sequence | VPPGQRLPAARGLSAPGADATAEEDLDPAVVRQVLTAGELTITGRLTNASNATLYGTVALDGVSLNCVHKPVAGERPLWDFPNGTLAAREVAAYELSQATGWRIVPPTVMREGPWGPGMCQLWIDTPDEDDHDLLALLPEDFDEDPADEAAAQWRPVLSVELGDGRPAVLAHKADERLRRIAAFDAVVNNADRKGGHLLVGIAEPDHVYGIDHGLTFNVDDKLRTLLWGFSADPLGAEVREVLQRLDRDIESGELGERLAGLLDAEEIAATRERVRELLETDRIPGPEGRRRPVPWPPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 3 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 4 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 5 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 6 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 7 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 8 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 9 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 10 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 11 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 12 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 13 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 14 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 15 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 16 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 17 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 18 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 19 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 20 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 21 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 22 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 23 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 24 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 25 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 26 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 27 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 28 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 29 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 30 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 31 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 32 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 33 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 34 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 35 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 36 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 37 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 38 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 39 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 40 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 41 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 42 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 43 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 44 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 186 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 189 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 206 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 209 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 210 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 211 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 212 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 213 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 352 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 357 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 358 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 359 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 360 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 361 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.94 |
| Metatranscriptomes | 0.52 |
| Isolates | 8.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.26 |
| Nodule | 1.39 |
| Rhizoplane | 5.4 |
| Rhizosphere | 78.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005917 | 3300003203 | Bacteria | 5660 |
| 2 | rootH1_10006612 | 3300003316 | Bacteria | 5066 |
| 3 | Ga0070658_10032723 | 3300005327 | Bacteria | 4181 |
| 4 | Ga0070683_100004618 | 3300005329 | Bacteria | 11380 |
| 5 | Ga0070683_100496978 | 3300005329 | Bacteria | 1165 |
| 6 | Ga0068869_100021696 | 3300005334 | Bacteria | 4419 |
| 7 | Ga0070666_10033090 | 3300005335 | Bacteria | 3419 |
| 8 | Ga0070680_100118095 | 3300005336 | Bacteria | 2212 |
| 9 | Ga0070682_100197636 | 3300005337 | Bacteria | 1416 |
| 10 | Ga0068868_100003029 | 3300005338 | Bacteria | 11690 |
| 11 | Ga0070660_100028983 | 3300005339 | Bacteria | 4146 |
| 12 | Ga0070660_100271887 | 3300005339 | Bacteria | 1385 |
| 13 | Ga0070689_100111460 | 3300005340 | Bacteria | 2176 |
| 14 | Ga0070691_10039916 | 3300005341 | Bacteria | 2218 |
| 15 | Ga0070692_10140399 | 3300005345 | Bacteria | 1367 |
| 16 | Ga0070668_100012087 | 3300005347 | Bacteria | 6431 |
| 17 | Ga0070668_100017099 | 3300005347 | Bacteria | 5428 |
| 18 | Ga0070674_100492111 | 3300005356 | Bacteria | 1020 |
| 19 | Ga0070673_100282377 | 3300005364 | Bacteria | 1456 |
| 20 | Ga0070659_100019627 | 3300005366 | Bacteria | 5126 |
| 21 | Ga0070667_100235887 | 3300005367 | Bacteria | 1632 |
| 22 | Ga0070714_100000002 | 3300005435 | Bacteria | 386673 |
| 23 | Ga0070714_100015013 | 3300005435 | Bacteria | 6225 |
| 24 | Ga0070714_100128363 | 3300005435 | Bacteria | 2263 |
| 25 | Ga0070714_100795226 | 3300005435 | Bacteria | 916 |
| 26 | Ga0070714_100893217 | 3300005435 | Bacteria | 862 |
| 27 | Ga0070701_10119028 | 3300005438 | Bacteria | 1485 |
| 28 | Ga0070711_100078684 | 3300005439 | Bacteria | 2343 |
| 29 | Ga0070705_100003977 | 3300005440 | Bacteria | 7222 |
| 30 | Ga0070700_100000124 | 3300005441 | Bacteria | 47077 |
| 31 | Ga0070663_100000995 | 3300005455 | Bacteria | 15441 |
| 32 | Ga0070663_100014932 | 3300005455 | Bacteria | 4995 |
| 33 | Ga0070663_100094687 | 3300005455 | Bacteria | 2218 |
| 34 | Ga0070662_100034241 | 3300005457 | Bacteria | 3581 |
| 35 | Ga0068867_100123477 | 3300005459 | Bacteria | 2004 |
| 36 | Ga0070685_10019530 | 3300005466 | Bacteria | 3657 |
| 37 | Ga0070685_10204967 | 3300005466 | Bacteria | 1284 |
| 38 | Ga0070698_100459427 | 3300005471 | Bacteria | 1209 |
| 39 | Ga0068853_100205064 | 3300005539 | Bacteria | 1795 |
| 40 | Ga0070672_100440880 | 3300005543 | Bacteria | 1121 |
| 41 | Ga0070686_100081792 | 3300005544 | Bacteria | 2140 |
| 42 | Ga0070695_100011401 | 3300005545 | Bacteria | 5316 |
| 43 | Ga0070696_100023865 | 3300005546 | Bacteria | 4156 |
| 44 | Ga0070693_100005276 | 3300005547 | Bacteria | 6191 |
| 45 | Ga0070665_100000522 | 3300005548 | Bacteria | 54684 |
| 46 | Ga0070665_100044237 | 3300005548 | Bacteria | 4472 |
| 47 | Ga0070665_100059353 | 3300005548 | Bacteria | 3835 |
| 48 | Ga0070665_100105328 | 3300005548 | Bacteria | 2822 |
| 49 | Ga0070665_100180815 | 3300005548 | Bacteria | 2110 |
| 50 | Ga0070704_100008699 | 3300005549 | Bacteria | 6105 |
| 51 | Ga0068855_100019090 | 3300005563 | Bacteria | 8239 |
| 52 | Ga0068855_100032936 | 3300005563 | Bacteria | 6186 |
| 53 | Ga0068855_100068191 | 3300005563 | Bacteria | 4141 |
| 54 | Ga0070664_100104217 | 3300005564 | Bacteria | 2470 |
| 55 | Ga0070664_100170478 | 3300005564 | Bacteria | 1931 |
| 56 | Ga0068857_100239242 | 3300005577 | Bacteria | 1662 |
| 57 | Ga0068857_100629391 | 3300005577 | Bacteria | 1016 |
| 58 | Ga0068856_100102462 | 3300005614 | Bacteria | 2856 |
| 59 | Ga0068856_100124853 | 3300005614 | Bacteria | 2577 |
| 60 | Ga0068852_100111327 | 3300005616 | Bacteria | 2490 |
| 61 | Ga0068852_100133164 | 3300005616 | Bacteria | 2291 |
| 62 | Ga0068852_100218384 | 3300005616 | Bacteria | 1812 |
| 63 | Ga0068859_100000325 | 3300005617 | Bacteria | 47431 |
| 64 | Ga0068859_100768511 | 3300005617 | Bacteria | 1052 |
| 65 | Ga0068861_100006531 | 3300005719 | Bacteria | 7955 |
| 66 | Ga0068861_100214282 | 3300005719 | Bacteria | 1624 |
| 67 | Ga0068863_100005701 | 3300005841 | Bacteria | 12225 |
| 68 | Ga0068863_100038829 | 3300005841 | Bacteria | 4529 |
| 69 | Ga0068858_100006048 | 3300005842 | Bacteria | 11793 |
| 70 | Ga0068858_100050207 | 3300005842 | Bacteria | 3861 |
| 71 | Ga0068860_100058208 | 3300005843 | Bacteria | 3673 |
| 72 | Ga0068862_100000106 | 3300005844 | Bacteria | 99778 |
| 73 | Ga0081540_1001870 | 3300005983 | Bacteria | 17629 |
| 74 | Ga0081539_10001535 | 3300005985 | Bacteria | 38621 |
| 75 | Ga0070717_10027752 | 3300006028 | Bacteria | 4526 |
| 76 | Ga0075365_10006894 | 3300006038 | Bacteria | 6304 |
| 77 | Ga0075365_10081507 | 3300006038 | Bacteria | 2192 |
| 78 | Ga0075365_10103351 | 3300006038 | Bacteria | 1952 |
| 79 | Ga0075364_10420583 | 3300006051 | Bacteria | 912 |
| 80 | Ga0070715_10014550 | 3300006163 | Bacteria | 2916 |
| 81 | Ga0070712_100199821 | 3300006175 | Bacteria | 1570 |
| 82 | Ga0075367_10051361 | 3300006178 | Bacteria | 2437 |
| 83 | Ga0097621_100048951 | 3300006237 | Bacteria | 3432 |
| 84 | Ga0068871_100087272 | 3300006358 | Bacteria | 2593 |
| 85 | Ga0075428_100015686 | 3300006844 | Bacteria | 8394 |
| 86 | Ga0075428_100331421 | 3300006844 | Bacteria | 1635 |
| 87 | Ga0075430_100003236 | 3300006846 | Bacteria | 13648 |
| 88 | Ga0075434_100313019 | 3300006871 | Bacteria | 1590 |
| 89 | Ga0075429_100005937 | 3300006880 | Bacteria | 10539 |
| 90 | Ga0068865_100260815 | 3300006881 | Bacteria | 1372 |
| 91 | Ga0075436_100025263 | 3300006914 | Bacteria | 4087 |
| 92 | Ga0097620_100000325 | 3300006931 | Bacteria | 47431 |
| 93 | Ga0097620_100015740 | 3300006931 | Bacteria | 7600 |
| 94 | Ga0097620_100768515 | 3300006931 | Bacteria | 1052 |
| 95 | Ga0075435_100002135 | 3300007076 | Bacteria | 13027 |
| 96 | Ga0105240_10030309 | 3300009093 | Bacteria | 7030 |
| 97 | Ga0105240_10088912 | 3300009093 | Bacteria | 3779 |
| 98 | Ga0105240_10404449 | 3300009093 | Bacteria | 1537 |
| 99 | Ga0111539_10148269 | 3300009094 | Bacteria | 2746 |
| 100 | Ga0111539_10247192 | 3300009094 | Bacteria | 2077 |
| 101 | Ga0105245_10004893 | 3300009098 | Bacteria | 11783 |
| 102 | Ga0105245_10012793 | 3300009098 | Bacteria | 7310 |
| 103 | Ga0105245_10064804 | 3300009098 | Bacteria | 3303 |
| 104 | Ga0105245_10194155 | 3300009098 | Bacteria | 1946 |
| 105 | Ga0114129_10041067 | 3300009147 | Bacteria | 6520 |
| 106 | Ga0105243_10007019 | 3300009148 | Bacteria | 8666 |
| 107 | Ga0105243_10056175 | 3300009148 | Bacteria | 3129 |
| 108 | Ga0105243_10167657 | 3300009148 | Bacteria | 1899 |
| 109 | Ga0105241_10002482 | 3300009174 | Bacteria | 13857 |
| 110 | Ga0105248_10014436 | 3300009177 | Bacteria | 8694 |
| 111 | Ga0105237_10011916 | 3300009545 | Bacteria | 9192 |
| 112 | Ga0105237_10067649 | 3300009545 | Bacteria | 3566 |
| 113 | Ga0105238_10038741 | 3300009551 | Bacteria | 4839 |
| 114 | Ga0105238_10071058 | 3300009551 | Bacteria | 3478 |
| 115 | Ga0105249_10003464 | 3300009553 | Bacteria | 13664 |
| 116 | Ga0105249_10108295 | 3300009553 | Bacteria | 2623 |
| 117 | Ga0105249_10755409 | 3300009553 | Bacteria | 1035 |
| 118 | Ga0105239_10021135 | 3300010375 | Bacteria | 7179 |
| 119 | Ga0105239_10049392 | 3300010375 | Bacteria | 4614 |
| 120 | Ga0105239_10412696 | 3300010375 | Bacteria | 1529 |
| 121 | Ga0105239_11102387 | 3300010375 | Bacteria | 914 |
| 122 | Ga0105239_11190248 | 3300010375 | Bacteria | 878 |
| 123 | Ga0105246_10001248 | 3300011119 | Bacteria | 14931 |
| 124 | Ga0105246_10017682 | 3300011119 | Bacteria | 4535 |
| 125 | Ga0105246_10079336 | 3300011119 | Bacteria | 2334 |
| 126 | Ga0157371_10014394 | 3300013102 | Bacteria | 5971 |
| 127 | Ga0157370_10012239 | 3300013104 | Bacteria | 8910 |
| 128 | Ga0157370_10034564 | 3300013104 | Bacteria | 4919 |
| 129 | Ga0157370_10258805 | 3300013104 | Bacteria | 1608 |
| 130 | Ga0157369_10026043 | 3300013105 | Bacteria | 6489 |
| 131 | Ga0157369_10073728 | 3300013105 | Bacteria | 3662 |
| 132 | Ga0157369_10154126 | 3300013105 | Bacteria | 2428 |
| 133 | Ga0157374_10079604 | 3300013296 | Bacteria | 3106 |
| 134 | Ga0157374_10110396 | 3300013296 | Bacteria | 2645 |
| 135 | Ga0157374_10432536 | 3300013296 | Bacteria | 1316 |
| 136 | Ga0157378_10053686 | 3300013297 | Bacteria | 3588 |
| 137 | Ga0157378_10299689 | 3300013297 | Bacteria | 1555 |
| 138 | Ga0163162_10005797 | 3300013306 | Bacteria | 11952 |
| 139 | Ga0163162_10144500 | 3300013306 | Bacteria | 2494 |
| 140 | Ga0157372_10002366 | 3300013307 | Bacteria | 20407 |
| 141 | Ga0157372_10061089 | 3300013307 | Bacteria | 4218 |
| 142 | Ga0157372_10458253 | 3300013307 | Bacteria | 1486 |
| 143 | Ga0157375_10001577 | 3300013308 | Bacteria | 19613 |
| 144 | Ga0157375_10085499 | 3300013308 | Bacteria | 3204 |
| 145 | Ga0163163_10002431 | 3300014325 | Bacteria | 15754 |
| 146 | Ga0163163_10038252 | 3300014325 | Bacteria | 4675 |
| 147 | Ga0163163_10161292 | 3300014325 | Bacteria | 2288 |
| 148 | Ga0157380_10013493 | 3300014326 | Bacteria | 5959 |
| 149 | Ga0182008_10000152 | 3300014497 | Bacteria | 54242 |
| 150 | Ga0157379_10000203 | 3300014968 | Bacteria | 46082 |
| 151 | Ga0157379_10006815 | 3300014968 | Bacteria | 9873 |
| 152 | Ga0157376_10030129 | 3300014969 | Bacteria | 4329 |
| 153 | Ga0182007_10010546 | 3300015262 | Bacteria | 3643 |
| 154 | Ga0163161_10120575 | 3300017792 | Bacteria | 1970 |
| 155 | Ga0206353_10069541 | 3300020082 | Bacteria | 3643 |
| 156 | Ga0206353_10341763 | 3300020082 | Bacteria | 3689 |
| 157 | Ga0206353_10926598 | 3300020082 | Bacteria | 4732 |
| 158 | Ga0213876_10024982 | 3300021384 | Bacteria | 3154 |
| 159 | Ga0207710_10000110 | 3300025900 | Bacteria | 104170 |
| 160 | Ga0207688_10000570 | 3300025901 | Bacteria | 18094 |
| 161 | Ga0207647_10035719 | 3300025904 | Bacteria | 3165 |
| 162 | Ga0207647_10040557 | 3300025904 | Bacteria | 2931 |
| 163 | Ga0207654_10014853 | 3300025911 | Bacteria | 4031 |
| 164 | Ga0207654_10026989 | 3300025911 | Bacteria | 3117 |
| 165 | Ga0207654_10147578 | 3300025911 | Bacteria | 1506 |
| 166 | Ga0207695_10004382 | 3300025913 | Bacteria | 19305 |
| 167 | Ga0207695_10078690 | 3300025913 | Bacteria | 3344 |
| 168 | Ga0207671_10004661 | 3300025914 | Bacteria | 12974 |
| 169 | Ga0207693_10002123 | 3300025915 | Bacteria | 17306 |
| 170 | Ga0207663_10200760 | 3300025916 | Bacteria | 1438 |
| 171 | Ga0207657_10114372 | 3300025919 | Bacteria | 2225 |
| 172 | Ga0207681_10290731 | 3300025923 | Bacteria | 1290 |
| 173 | Ga0207694_10021185 | 3300025924 | Bacteria | 4923 |
| 174 | Ga0207694_10047577 | 3300025924 | Bacteria | 3318 |
| 175 | Ga0207694_10286459 | 3300025924 | Bacteria | 1354 |
| 176 | Ga0207687_10005838 | 3300025927 | Bacteria | 8144 |
| 177 | Ga0207664_10000038 | 3300025929 | Bacteria | 166264 |
| 178 | Ga0207664_10046668 | 3300025929 | Bacteria | 3401 |
| 179 | Ga0207664_10489042 | 3300025929 | Bacteria | 1101 |
| 180 | Ga0207644_10217404 | 3300025931 | Bacteria | 1513 |
| 181 | Ga0207706_10007205 | 3300025933 | Bacteria | 10282 |
| 182 | Ga0207686_10256852 | 3300025934 | Bacteria | 1279 |
| 183 | Ga0207709_10329133 | 3300025935 | Bacteria | 1146 |
| 184 | Ga0207709_10423002 | 3300025935 | Bacteria | 1024 |
| 185 | Ga0207665_10002367 | 3300025939 | Bacteria | 12738 |
| 186 | Ga0207691_10075098 | 3300025940 | Bacteria | 3048 |
| 187 | Ga0207711_10123759 | 3300025941 | Bacteria | 2311 |
| 188 | Ga0207689_10008478 | 3300025942 | Bacteria | 8956 |
| 189 | Ga0207661_10388478 | 3300025944 | Bacteria | 1264 |
| 190 | Ga0207679_10374671 | 3300025945 | Bacteria | 1246 |
| 191 | Ga0207667_10007161 | 3300025949 | Bacteria | 13464 |
| 192 | Ga0207667_10052680 | 3300025949 | Bacteria | 4284 |
| 193 | Ga0207667_10453008 | 3300025949 | Bacteria | 1304 |
| 194 | Ga0207712_10054601 | 3300025961 | Bacteria | 2806 |
| 195 | Ga0207668_10010928 | 3300025972 | Bacteria | 5504 |
| 196 | Ga0207668_10124815 | 3300025972 | Bacteria | 1955 |
| 197 | Ga0207658_10406102 | 3300025986 | Bacteria | 1198 |
| 198 | Ga0207703_10000005 | 3300026035 | Bacteria | 506356 |
| 199 | Ga0207703_10018451 | 3300026035 | Bacteria | 5448 |
| 200 | Ga0207703_10357920 | 3300026035 | Bacteria | 1345 |
| 201 | Ga0207678_10000091 | 3300026067 | Bacteria | 75052 |
| 202 | Ga0207678_10103458 | 3300026067 | Bacteria | 2431 |
| 203 | Ga0207678_10255975 | 3300026067 | Bacteria | 1500 |
| 204 | Ga0207708_10000023 | 3300026075 | Bacteria | 176615 |
| 205 | Ga0207708_10317819 | 3300026075 | Bacteria | 1270 |
| 206 | Ga0207702_10055062 | 3300026078 | Bacteria | 3373 |
| 207 | Ga0207702_10666001 | 3300026078 | Bacteria | 1024 |
| 208 | Ga0207641_10023439 | 3300026088 | Bacteria | 5085 |
| 209 | Ga0207641_10040208 | 3300026088 | Bacteria | 3914 |
| 210 | Ga0207641_10727337 | 3300026088 | Bacteria | 979 |
| 211 | Ga0207648_10040754 | 3300026089 | Bacteria | 4080 |
| 212 | Ga0207674_10009187 | 3300026116 | Bacteria | 11335 |
| 213 | Ga0207675_100005797 | 3300026118 | Bacteria | 11808 |
| 214 | Ga0207683_10049319 | 3300026121 | Bacteria | 3686 |
| 215 | Ga0207698_10011853 | 3300026142 | Bacteria | 5676 |
| 216 | Ga0268266_10056973 | 3300028379 | Bacteria | 3362 |
| 217 | Ga0268266_10133937 | 3300028379 | Bacteria | 2218 |
| 218 | Ga0268266_10442788 | 3300028379 | Bacteria | 1234 |
| 219 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 220 | Ga0268264_10299507 | 3300028381 | Bacteria | 1513 |
| 221 | Ga0307515_10098721 | 3300028794 | Bacteria | 3553 |
| 222 | Ga0307515_10141441 | 3300028794 | Bacteria | 2578 |
| 223 | Ga0307512_10001989 | 3300030522 | Bacteria | 27215 |
| 224 | Ga0307512_10077296 | 3300030522 | Bacteria | 2420 |
| 225 | Ga0265340_10004882 | 3300031247 | Bacteria | 7463 |
| 226 | Ga0307513_10002561 | 3300031456 | Bacteria | 25114 |
| 227 | Ga0307513_10183477 | 3300031456 | Bacteria | 1952 |
| 228 | Ga0307509_10083179 | 3300031507 | Bacteria | 3300 |
| 229 | Ga0307509_10325748 | 3300031507 | Bacteria | 1270 |
| 230 | Ga0307508_10043952 | 3300031616 | Bacteria | 3999 |
| 231 | Ga0307508_10188288 | 3300031616 | Bacteria | 1665 |
| 232 | Ga0307508_10298521 | 3300031616 | Bacteria | 1204 |
| 233 | Ga0307514_10279601 | 3300031649 | Bacteria | 956 |
| 234 | Ga0307518_10000093 | 3300031838 | Bacteria | 61707 |
| 235 | Ga0307416_100315022 | 3300032002 | Bacteria | 1563 |
| 236 | Ga0307507_10000081 | 3300033179 | Bacteria | 148079 |
| 237 | Ga0307507_10043437 | 3300033179 | Bacteria | 4460 |
| 238 | Ga0307507_10064883 | 3300033179 | Bacteria | 3364 |
| 239 | Ga0307507_10230459 | 3300033179 | Bacteria | 1229 |
| 240 | Ga0307510_10077869 | 3300033180 | Bacteria | 3248 |
| 241 | Ga0307510_10092527 | 3300033180 | Bacteria | 2859 |
| 242 | Ga0373938_0003459 | 3300034957 | Bacteria | 2588 |
| 243 | Ga0373929_0034644 | 3300035085 | Bacteria | 1096 |
| 244 | Ga0373949_0015760 | 3300035090 | Bacteria | 1690 |
| 245 | Ga0373952_0036334 | 3300035092 | Bacteria | 1119 |
| 246 | Ga0373939_0000981 | 3300035114 | Bacteria | 7086 |
| 247 | Ga0373961_0008233 | 3300035241 | Bacteria | 2534 |
| 248 | Ga0373962_0015841 | 3300035242 | Bacteria | 1938 |
| 249 | Ga0373931_0009228 | 3300035691 | Bacteria | 4710 |
| 250 | Ga0373927_0205498 | 3300035695 | Bacteria | 1293 |
| 251 | Ga0373925_0290757 | 3300037068 | Bacteria | 1318 |
| 252 | Ga0395900_0144945 | 3300037418 | Bacteria | 2429 |
| 253 | Ga0395898_0008145 | 3300037466 | Bacteria | 11099 |
| 254 | Ga0436364_0744111 | 3300037853 | Bacteria | 5473 |
| 255 | Ga0395901_0025615 | 3300038443 | Bacteria | 6055 |
| 256 | Ga0395901_0032214 | 3300038443 | Bacteria | 5409 |
| 257 | Ga0436365_1829699 | 3300039437 | Bacteria | 12539 |
| 258 | Ga0451837_0295870 | 3300041494 | Bacteria | 2439 |
| 259 | Ga0451837_0806448 | 3300041494 | Bacteria | 1289 |
| 260 | Ga0451841_1321351 | 3300041498 | Bacteria | 2321 |
| 261 | Ga0451853_0147823 | 3300041512 | Bacteria | 7756 |
| 262 | Ga0451853_1270289 | 3300041512 | Bacteria | 4360 |
| 263 | Ga0439442_000840 | 3300042002 | Bacteria | 6310 |
| 264 | Ga0439449_0016559 | 3300042007 | Bacteria | 2770 |
| 265 | Ga0439449_0125362 | 3300042007 | Bacteria | 954 |
| 266 | Ga0439457_000116 | 3300042014 | Bacteria | 19257 |
| 267 | Ga0450920_000547 | 3300042122 | Bacteria | 5960 |
| 268 | Ga0450894_015372 | 3300042131 | Bacteria | 1013 |
| 269 | Ga0450907_001018 | 3300042146 | Bacteria | 6568 |
| 270 | Ga0439434_0000331 | 3300042435 | Bacteria | 13407 |
| 271 | Ga0450918_000569 | 3300042531 | Bacteria | 7855 |
| 272 | Ga0466969_0058806 | 3300044656 | Bacteria | 1870 |
| 273 | Ga0466972_0004125 | 3300044658 | Bacteria | 7251 |
| 274 | Ga0466972_0076701 | 3300044658 | Bacteria | 1592 |
| 275 | Ga0466966_0023637 | 3300044684 | Bacteria | 4023 |
| 276 | Ga0466966_0059787 | 3300044684 | Bacteria | 2406 |
| 277 | Ga0466966_0180441 | 3300044684 | Bacteria | 1281 |
| 278 | Ga0466966_0244437 | 3300044684 | Bacteria | 1081 |
| 279 | Ga0466961_0001162 | 3300044693 | Bacteria | 16194 |
| 280 | Ga0466961_0012003 | 3300044693 | Bacteria | 5537 |
| 281 | Ga0466961_0032747 | 3300044693 | Bacteria | 3340 |
| 282 | Ga0466961_0037060 | 3300044693 | Bacteria | 3130 |
| 283 | Ga0466961_0046284 | 3300044693 | Bacteria | 2783 |
| 284 | Ga0466961_0053518 | 3300044693 | Bacteria | 2575 |
| 285 | Ga0466961_0069088 | 3300044693 | Bacteria | 2243 |
| 286 | Ga0466961_0135324 | 3300044693 | Bacteria | 1544 |
| 287 | Ga0466961_0221133 | 3300044693 | Bacteria | 1167 |
| 288 | Ga0466963_0000452 | 3300044694 | Bacteria | 19018 |
| 289 | Ga0466963_0033462 | 3300044694 | Bacteria | 3337 |
| 290 | Ga0466963_0096595 | 3300044694 | Bacteria | 2018 |
| 291 | Ga0466963_0103827 | 3300044694 | Bacteria | 1947 |
| 292 | Ga0466963_0104793 | 3300044694 | Bacteria | 1938 |
| 293 | Ga0466963_0113585 | 3300044694 | Bacteria | 1860 |
| 294 | Ga0466964_0048353 | 3300044706 | Bacteria | 1739 |
| 295 | Ga0466964_0073772 | 3300044706 | Bacteria | 1449 |
| 296 | Ga0466971_0029450 | 3300044719 | Bacteria | 2456 |
| 297 | Ga0466970_0031492 | 3300044765 | Bacteria | 2801 |
| 298 | Ga0466970_0092279 | 3300044765 | Bacteria | 1644 |
| 299 | Ga0466970_0140934 | 3300044765 | Bacteria | 1328 |
| 300 | Ga0466970_0158568 | 3300044765 | Bacteria | 1251 |
| 301 | Ga0466970_0166521 | 3300044765 | Bacteria | 1220 |
| 302 | Ga0466957_0023515 | 3300044842 | Bacteria | 3643 |
| 303 | Ga0466957_0049256 | 3300044842 | Bacteria | 2561 |
| 304 | Ga0466959_0148815 | 3300045049 | Bacteria | 1651 |
| 305 | Ga0466959_0308768 | 3300045049 | Bacteria | 1082 |
| 306 | Ga0466958_0030781 | 3300045836 | Bacteria | 3189 |
| 307 | Ga0466958_0044349 | 3300045836 | Bacteria | 2680 |
| 308 | Ga0466958_0185881 | 3300045836 | Bacteria | 1319 |
| 309 | Ga0466967_0003089 | 3300045976 | Bacteria | 10706 |
| 310 | Ga0466967_0017575 | 3300045976 | Bacteria | 5684 |
| 311 | Ga0466967_0247697 | 3300045976 | Bacteria | 1701 |
| 312 | Ga0466967_0466259 | 3300045976 | Bacteria | 1236 |
| 313 | Ga0466967_0938999 | 3300045976 | Bacteria | 861 |
| 314 | Ga0495617_023825 | 3300046452 | Bacteria | 2066 |
| 315 | Ga0495592_0001572 | 3300046454 | Bacteria | 15956 |
| 316 | Ga0495592_0008609 | 3300046454 | Bacteria | 7657 |
| 317 | Ga0495603_0021089 | 3300046455 | Bacteria | 3945 |
| 318 | Ga0495603_0064031 | 3300046455 | Bacteria | 2168 |
| 319 | Ga0495603_0125526 | 3300046455 | Bacteria | 1496 |
| 320 | Ga0495590_0041099 | 3300046457 | Bacteria | 1612 |
| 321 | Ga0495629_0038922 | 3300046459 | Bacteria | 3348 |
| 322 | Ga0495629_0058976 | 3300046459 | Bacteria | 2683 |
| 323 | Ga0495641_0082234 | 3300046461 | Bacteria | 1442 |
| 324 | Ga0495651_0159257 | 3300046462 | Bacteria | 1619 |
| 325 | Ga0495605_0003368 | 3300046474 | Bacteria | 9550 |
| 326 | Ga0495662_0002086 | 3300046476 | Bacteria | 10023 |
| 327 | Ga0495662_0004744 | 3300046476 | Bacteria | 6811 |
| 328 | Ga0495662_0132714 | 3300046476 | Bacteria | 1224 |
| 329 | Ga0495664_0002181 | 3300046477 | Bacteria | 10485 |
| 330 | Ga0495594_0009594 | 3300046499 | Bacteria | 5003 |
| 331 | Ga0495596_0044270 | 3300046500 | Bacteria | 1752 |
| 332 | Ga0495583_0049301 | 3300046506 | Bacteria | 1929 |
| 333 | Ga0495583_0091496 | 3300046506 | Bacteria | 1309 |
| 334 | Ga0495606_0005627 | 3300046507 | Bacteria | 11895 |
| 335 | Ga0495610_0012317 | 3300046512 | Bacteria | 5158 |
| 336 | Ga0495618_0176920 | 3300046514 | Bacteria | 1356 |
| 337 | Ga0495620_0005492 | 3300046515 | Bacteria | 7066 |
| 338 | Ga0495620_0006957 | 3300046515 | Bacteria | 6173 |
| 339 | Ga0495628_0069662 | 3300046516 | Bacteria | 2743 |
| 340 | Ga0495628_0144296 | 3300046516 | Bacteria | 1815 |
| 341 | Ga0495630_0167516 | 3300046517 | Bacteria | 1673 |
| 342 | Ga0495630_0235697 | 3300046517 | Bacteria | 1398 |
| 343 | Ga0495631_0001500 | 3300046518 | Bacteria | 14075 |
| 344 | Ga0495643_0010717 | 3300046522 | Bacteria | 5632 |
| 345 | Ga0495648_0071666 | 3300046524 | Bacteria | 2007 |
| 346 | Ga0495648_0147896 | 3300046524 | Bacteria | 1228 |
| 347 | Ga0495666_0029566 | 3300046526 | Bacteria | 2695 |
| 348 | Ga0495642_0073716 | 3300046528 | Bacteria | 1430 |
| 349 | Ga0495652_0011673 | 3300046529 | Bacteria | 7939 |
| 350 | Ga0495652_0012235 | 3300046529 | Bacteria | 7749 |
| 351 | Ga0495654_0038740 | 3300046530 | Bacteria | 2382 |
| 352 | Ga0495665_0094032 | 3300046531 | Bacteria | 1575 |
| 353 | Ga0495640_0008471 | 3300046533 | Bacteria | 8063 |
| 354 | Ga0495640_0015588 | 3300046533 | Bacteria | 5713 |
| 355 | Ga0495586_0047208 | 3300046535 | Bacteria | 2324 |
| 356 | Ga0495587_0004992 | 3300046536 | Bacteria | 8687 |
| 357 | Ga0495597_0006381 | 3300046542 | Bacteria | 6102 |
| 358 | Ga0495597_0166353 | 3300046542 | Bacteria | 897 |
| 359 | Ga0495645_0065464 | 3300046543 | Bacteria | 2629 |
| 360 | Ga0495622_0004737 | 3300046557 | Bacteria | 6296 |
| 361 | Ga0495622_0038473 | 3300046557 | Bacteria | 2227 |
| 362 | Ga0495622_0089547 | 3300046557 | Bacteria | 1414 |
| 363 | Ga0495633_0018655 | 3300046558 | Bacteria | 3520 |
| 364 | Ga0495667_0259497 | 3300046559 | Bacteria | 1105 |
| 365 | Ga0495656_0150035 | 3300046615 | Bacteria | 1125 |
| 366 | Ga0495668_0003067 | 3300046616 | Bacteria | 12940 |
| 367 | Ga0495668_0030042 | 3300046616 | Bacteria | 3069 |
| 368 | Ga0495634_0008020 | 3300046642 | Bacteria | 7881 |
| 369 | Ga0495634_0011690 | 3300046642 | Bacteria | 6384 |
| 370 | Ga0495625_0041044 | 3300046660 | Bacteria | 3369 |
| 371 | Ga0495625_0074275 | 3300046660 | Bacteria | 2382 |
| 372 | Ga0495625_0108659 | 3300046660 | Bacteria | 1898 |
| 373 | Ga0495635_0047449 | 3300046663 | Bacteria | 2962 |
| 374 | Ga0495635_0050691 | 3300046663 | Bacteria | 2861 |
| 375 | Ga0495661_0023252 | 3300046665 | Bacteria | 4023 |
| 376 | Ga0495657_0000784 | 3300046675 | Bacteria | 28288 |
| 377 | Ga0495599_0144608 | 3300046678 | Bacteria | 1474 |
| 378 | Ga0495623_0073306 | 3300046679 | Bacteria | 2128 |
| 379 | Ga0495623_0152613 | 3300046679 | Bacteria | 1364 |
| 380 | Ga0495646_0000744 | 3300046680 | Bacteria | 18130 |
| 381 | Ga0495613_0003321 | 3300046689 | Bacteria | 12050 |
| 382 | Ga0495613_0007950 | 3300046689 | Bacteria | 7893 |
| 383 | Ga0495613_0023187 | 3300046689 | Bacteria | 4624 |
| 384 | Ga0495613_0149817 | 3300046689 | Bacteria | 1664 |
| 385 | Ga0495613_0182545 | 3300046689 | Bacteria | 1485 |
| 386 | Ga0495613_0434318 | 3300046689 | Bacteria | 891 |
| 387 | Ga0495624_0022452 | 3300046690 | Bacteria | 4171 |
| 388 | Ga0495624_0023542 | 3300046690 | Bacteria | 4061 |
| 389 | Ga0495670_0094886 | 3300046691 | Bacteria | 1530 |
| 390 | Ga0495649_0021665 | 3300046694 | Bacteria | 3600 |
| 391 | Ga0495649_0111253 | 3300046694 | Bacteria | 1452 |
| 392 | Ga0495589_0004663 | 3300046794 | Bacteria | 7281 |
| 393 | Ga0495589_0078740 | 3300046794 | Bacteria | 1604 |
| 394 | Ga0495581_0001059 | 3300047315 | Bacteria | 14916 |
| 395 | Ga0495581_0028789 | 3300047315 | Bacteria | 3221 |
| 396 | Ga0495581_0040042 | 3300047315 | Bacteria | 2713 |
| 397 | Ga0495604_0000368 | 3300047317 | Bacteria | 40631 |
| 398 | Ga0495604_0004274 | 3300047317 | Bacteria | 11310 |
| 399 | Ga0495604_0053164 | 3300047317 | Bacteria | 3132 |
| 400 | Ga0495604_0136580 | 3300047317 | Bacteria | 1756 |
| 401 | Ga0495604_0311938 | 3300047317 | Bacteria | 1053 |
| 402 | Ga0495636_0079242 | 3300047318 | Bacteria | 1412 |
| 403 | Ga0495674_0250266 | 3300047319 | Bacteria | 1458 |
| 404 | Ga0495672_0131369 | 3300047320 | Bacteria | 1317 |
| 405 | Ga0495676_0022629 | 3300047321 | Bacteria | 5465 |
| 406 | Ga0495676_0023590 | 3300047321 | Bacteria | 5336 |
| 407 | Ga0495676_0029396 | 3300047321 | Bacteria | 4679 |
| 408 | Ga0495676_0091550 | 3300047321 | Bacteria | 2273 |
| 409 | Ga0495676_0134892 | 3300047321 | Bacteria | 1776 |
| 410 | Ga0495680_0013488 | 3300047322 | Bacteria | 7128 |
| 411 | Ga0495687_039239 | 3300047443 | Bacteria | 2096 |
| 412 | Ga0495687_039705 | 3300047443 | Bacteria | 2080 |
| 413 | Ga0495675_0019726 | 3300047444 | Bacteria | 4284 |
| 414 | Ga0495675_0131653 | 3300047444 | Bacteria | 1554 |
| 415 | Ga0495677_0063740 | 3300047445 | Bacteria | 1369 |
| 416 | Ga0495593_0005411 | 3300047673 | Bacteria | 7542 |
| 417 | Ga0495602_0118594 | 3300048088 | Bacteria | 2134 |
| 418 | Ga0495614_0112230 | 3300048089 | Bacteria | 1197 |
| 419 | Ga0495626_0005502 | 3300048091 | Bacteria | 7377 |
| 420 | Ga0496100_0039188 | 3300048903 | Bacteria | 3008 |
| 421 | Ga0496102_0020127 | 3300048905 | Bacteria | 5891 |
| 422 | Ga0496102_0023197 | 3300048905 | Bacteria | 5508 |
| 423 | Ga0496103_0036404 | 3300048906 | Bacteria | 3014 |
| 424 | Ga0496103_0068217 | 3300048906 | Bacteria | 2222 |
| 425 | Ga0496103_0105462 | 3300048906 | Bacteria | 1787 |
| 426 | Ga0496104_0035579 | 3300048907 | Bacteria | 4649 |
| 427 | Ga0496104_0194891 | 3300048907 | Bacteria | 1938 |
| 428 | Ga0496105_0060964 | 3300048908 | Bacteria | 3113 |
| 429 | Ga0496106_0032469 | 3300048909 | Bacteria | 3892 |
| 430 | Ga0496106_0158309 | 3300048909 | Bacteria | 1790 |
| 431 | Ga0496107_0043844 | 3300048910 | Bacteria | 3214 |
| 432 | Ga0496108_0011996 | 3300048911 | Bacteria | 7050 |
| 433 | Ga0496108_0031072 | 3300048911 | Bacteria | 4428 |
| 434 | Ga0496108_0426134 | 3300048911 | Bacteria | 1159 |
| 435 | Ga0496109_0006176 | 3300048912 | Bacteria | 10068 |
| 436 | Ga0496109_0121420 | 3300048912 | Bacteria | 2434 |
| 437 | Ga0496109_0205738 | 3300048912 | Bacteria | 1850 |
| 438 | Ga0496109_0331338 | 3300048912 | Bacteria | 1437 |
| 439 | Ga0496110_0004671 | 3300048913 | Bacteria | 10648 |
| 440 | Ga0496110_0166262 | 3300048913 | Bacteria | 2000 |
| 441 | Ga0496110_0506908 | 3300048913 | Bacteria | 1098 |
| 442 | Ga0496111_0021434 | 3300048914 | Bacteria | 4512 |
| 443 | Ga0496111_0024608 | 3300048914 | Bacteria | 4242 |
| 444 | Ga0496112_0050113 | 3300048915 | Bacteria | 4093 |
| 445 | Ga0496112_0116963 | 3300048915 | Bacteria | 2636 |
| 446 | Ga0496112_0457857 | 3300048915 | Bacteria | 1213 |
| 447 | Ga0496113_0005476 | 3300048916 | Bacteria | 7920 |
| 448 | Ga0496113_0476603 | 3300048916 | Bacteria | 1002 |
| 449 | Ga0496114_0019850 | 3300048917 | Bacteria | 5449 |
| 450 | Ga0496115_0010456 | 3300048918 | Bacteria | 6935 |
| 451 | Ga0496116_0000474 | 3300048919 | Bacteria | 55522 |
| 452 | Ga0496117_0000367 | 3300048920 | Bacteria | 78467 |
| 453 | Ga0496117_0020254 | 3300048920 | Bacteria | 5428 |
| 454 | Ga0496118_0002773 | 3300048921 | Bacteria | 22948 |
| 455 | Ga0496119_0015302 | 3300048922 | Bacteria | 5919 |
| 456 | Ga0496119_0104192 | 3300048922 | Bacteria | 1587 |
| 457 | Ga0496121_0006012 | 3300048924 | Bacteria | 15316 |
| 458 | Ga0496121_0034330 | 3300048924 | Bacteria | 4567 |
| 459 | Ga0496121_0052415 | 3300048924 | Bacteria | 3427 |
| 460 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 461 | Ga0496126_0179904 | 3300048929 | Bacteria | 1797 |
| 462 | Ga0496126_0611550 | 3300048929 | Bacteria | 857 |
| 463 | Ga0501031_0275360 | 3300049568 | Bacteria | 1092 |
| 464 | Ga0501032_0016571 | 3300049569 | Bacteria | 5182 |
| 465 | Ga0501032_0115882 | 3300049569 | Bacteria | 1772 |
| 466 | Ga0501033_0001412 | 3300049570 | Bacteria | 21332 |
| 467 | Ga0501034_0021532 | 3300049571 | Bacteria | 6569 |
| 468 | Ga0501034_0080870 | 3300049571 | Bacteria | 3253 |
| 469 | Ga0501037_0067019 | 3300049573 | Bacteria | 2614 |
| 470 | Ga0501037_0232326 | 3300049573 | Bacteria | 1294 |
| 471 | Ga0501038_0006143 | 3300049574 | Bacteria | 11120 |
| 472 | Ga0501038_0393710 | 3300049574 | Bacteria | 1073 |
| 473 | Ga0501043_0030259 | 3300049579 | Bacteria | 4254 |
| 474 | Ga0501047_0094195 | 3300049581 | Bacteria | 2874 |
| 475 | Ga0501047_0210797 | 3300049581 | Bacteria | 1801 |
| 476 | Ga0501067_0000869 | 3300049583 | Bacteria | 16242 |
| 477 | Ga0501068_0003970 | 3300049584 | Bacteria | 8046 |
| 478 | Ga0501068_0135328 | 3300049584 | Bacteria | 1543 |
| 479 | Ga0501069_0100901 | 3300049585 | Bacteria | 1638 |
| 480 | Ga0501070_0004060 | 3300049586 | Bacteria | 12580 |
| 481 | Ga0501070_0006109 | 3300049586 | Bacteria | 10267 |
| 482 | Ga0501070_0006661 | 3300049586 | Bacteria | 9835 |
| 483 | Ga0501071_0036344 | 3300049587 | Bacteria | 3513 |
| 484 | Ga0501072_0061761 | 3300049588 | Bacteria | 2955 |
| 485 | Ga0501073_0124551 | 3300049589 | Bacteria | 1786 |
| 486 | Ga0501073_0154471 | 3300049589 | Bacteria | 1590 |
| 487 | Ga0501074_0001389 | 3300049590 | Bacteria | 16077 |
| 488 | Ga0501074_0079542 | 3300049590 | Bacteria | 2352 |
| 489 | Ga0501077_0003114 | 3300049593 | Bacteria | 9974 |
| 490 | Ga0501080_0000233 | 3300049742 | Bacteria | 41803 |
| 491 | Ga0501080_0041769 | 3300049742 | Bacteria | 4271 |
| 492 | Ga0501080_0066185 | 3300049742 | Bacteria | 3360 |
| 493 | Ga0501083_0015685 | 3300049744 | Bacteria | 5303 |
| 494 | Ga0501035_0016340 | 3300049822 | Bacteria | 6847 |
| 495 | Ga0501035_0040895 | 3300049822 | Bacteria | 4187 |
| 496 | Ga0501044_0043041 | 3300049823 | Bacteria | 4692 |
| 497 | Ga0501044_0146049 | 3300049823 | Bacteria | 2350 |
| 498 | nmdc:mga00v17_69232_c1 | 3300050491 | Bacteria | 2183 |
| 499 | nmdc:mga0yw44_272473_c1 | 3300050492 | Bacteria | 1130 |
| 500 | nmdc:mga05p37_16740_c2 | 3300050507 | Bacteria | 8124 |
| 501 | nmdc:mga09592_6944_c1 | 3300050508 | Bacteria | 9206 |
| 502 | nmdc:mga0qj67_11960_c1 | 3300050509 | Bacteria | 6522 |
| 503 | nmdc:mga06r32_9471_c1 | 3300050510 | Bacteria | 8792 |
| 504 | nmdc:mga08y16_423723_c1 | 3300050511 | Bacteria | 1360 |
| 505 | nmdc:mga0n895_87287_c1 | 3300050512 | Bacteria | 3117 |
| 506 | nmdc:mga08x19_120596_c1 | 3300050514 | Bacteria | 1758 |
| 507 | nmdc:mga0a205_5209_c1 | 3300050515 | Bacteria | 11701 |
| 508 | Ga0495601_0068803 | 3300053077 | Bacteria | 2257 |
| 509 | Ga0495612_0002846 | 3300053078 | Bacteria | 7158 |
| 510 | Ga0495612_0027464 | 3300053078 | Bacteria | 2289 |
| 511 | Ga0495619_0134340 | 3300053085 | Bacteria | 1701 |
| 512 | Ga0500644_0072743 | 3300053088 | Bacteria | 1243 |
| 513 | Ga0500583_0230068 | 3300053092 | Bacteria | 918 |
| 514 | Ga0500559_0000589 | 3300053136 | Bacteria | 24757 |
| 515 | Ga0500616_0000424 | 3300053153 | Bacteria | 56336 |
| 516 | Ga0500624_002469 | 3300053157 | Bacteria | 2503 |
| 517 | Ga0500636_0256624 | 3300053177 | Bacteria | 888 |
| 518 | Ga0501084_0018158 | 3300054114 | Bacteria | 5857 |
| 519 | Ga0501082_0073241 | 3300060353 | Bacteria | 2950 |
| 520 | Ga0501082_0233291 | 3300060353 | Bacteria | 1601 |
| 521 | Ga0466962_0002933 | 3300061719 | Bacteria | 8130 |
| 522 | Ga0466962_0023538 | 3300061719 | Bacteria | 2960 |
| 523 | Ga0466962_0075984 | 3300061719 | Bacteria | 1605 |
| 524 | Ga0466962_0194737 | 3300061719 | Bacteria | 989 |
| 525 | Ga0530510_0016341 | 3300061734 | Bacteria | 5251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0003114 | Ga0501077_0003114_1841_2488 | 204 |
| 2 | 3300005438 | Ga0070701_10119028 | Ga0070701_101190282 | 207 |
| 3 | 3300026075 | Ga0207708_10317819 | Ga0207708_103178192 | 207 |
| 4 | 3300044765 | Ga0466970_0140934 | Ga0466970_0140934_40_765 | 211 |
| 5 | 3300035242 | Ga0373962_0015841 | Ga0373962_0015841_1269_1922 | 213 |
| 6 | 3300050514 | nmdc:mga08x19_120596_c1 | nmdc:mga08x19_120596_c1_25_678 | 213 |
| 7 | 3300042131 | Ga0450894_015372 | Ga0450894_015372_26_694 | 218 |
| 8 | 3300049585 | Ga0501069_0100901 | Ga0501069_0100901_503_1234 | 219 |
| 9 | 3300049586 | Ga0501070_0006661 | Ga0501070_0006661_3396_4127 | 219 |
| 10 | 3300049589 | Ga0501073_0154471 | Ga0501073_0154471_421_1152 | 219 |
| 11 | 3300049742 | Ga0501080_0000233 | Ga0501080_0000233_37805_38536 | 219 |
| 12 | iso_pu_bacteria | 3006393351 | 3006398524 | 219 |
| 13 | 3300005435 | Ga0070714_100015013 | Ga0070714_1000150134 | 225 |
| 14 | 3300025929 | Ga0207664_10046668 | Ga0207664_100466682 | 225 |
| 15 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_91621_92421 | 228 |
| 16 | 3300044684 | Ga0466966_0059787 | Ga0466966_0059787_635_1405 | 230 |
| 17 | 3300037853 | Ga0436364_0744111 | Ga0436364_0744111_4184_4921 | 231 |
| 18 | 3300044693 | Ga0466961_0001162 | Ga0466961_0001162_9433_10221 | 231 |
| 19 | 3300044694 | Ga0466963_0103827 | Ga0466963_0103827_1102_1890 | 231 |
| 20 | 3300061719 | Ga0466962_0023538 | Ga0466962_0023538_11_799 | 231 |
| 21 | 3300044694 | Ga0466963_0096595 | Ga0466963_0096595_98_811 | 232 |
| 22 | 3300049568 | Ga0501031_0275360 | Ga0501031_0275360_31_744 | 232 |
| 23 | 3300005367 | Ga0070667_100235887 | Ga0070667_1002358872 | 233 |
| 24 | 3300005563 | Ga0068855_100068191 | Ga0068855_1000681914 | 233 |
| 25 | 3300009093 | Ga0105240_10088912 | Ga0105240_100889122 | 233 |
| 26 | 3300009098 | Ga0105245_10194155 | Ga0105245_101941553 | 233 |
| 27 | 3300013297 | Ga0157378_10299689 | Ga0157378_102996892 | 233 |
| 28 | 3300025986 | Ga0207658_10406102 | Ga0207658_104061022 | 233 |
| 29 | 3300026067 | Ga0207678_10255975 | Ga0207678_102559752 | 233 |
| 30 | iso_pu_bacteria | 2919446982 | 2919450406 | 233 |
| 31 | 3300020082 | Ga0206353_10069541 | Ga0206353_100695413 | 234 |
| 32 | 3300025945 | Ga0207679_10374671 | Ga0207679_103746712 | 234 |
| 33 | 3300044658 | Ga0466972_0076701 | Ga0466972_0076701_613_1383 | 234 |
| 34 | 3300044693 | Ga0466961_0012003 | Ga0466961_0012003_2276_3076 | 234 |
| 35 | 3300044719 | Ga0466971_0029450 | Ga0466971_0029450_1637_2437 | 234 |
| 36 | 3300045049 | Ga0466959_0308768 | Ga0466959_0308768_147_947 | 234 |
| 37 | 3300046531 | Ga0495665_0094032 | Ga0495665_0094032_52_831 | 234 |
| 38 | 3300061719 | Ga0466962_0002933 | Ga0466962_0002933_632_1432 | 234 |
| 39 | 3300005844 | Ga0068862_100000106 | Ga0068862_10000010645 | 235 |
| 40 | 3300028380 | Ga0268265_10000008 | Ga0268265_1000000837 | 235 |
| 41 | 3300044694 | Ga0466963_0104793 | Ga0466963_0104793_410_1195 | 235 |
| 42 | 3300049569 | Ga0501032_0016571 | Ga0501032_0016571_813_1544 | 235 |
| 43 | 3300049584 | Ga0501068_0135328 | Ga0501068_0135328_484_1215 | 235 |
| 44 | 3300049586 | Ga0501070_0006109 | Ga0501070_0006109_3174_3905 | 235 |
| 45 | 3300061734 | Ga0530510_0016341 | Ga0530510_0016341_3047_3820 | 236 |
| 46 | 3300005617 | Ga0068859_100000325 | Ga0068859_10000032515 | 237 |
| 47 | 3300006931 | Ga0097620_100000325 | Ga0097620_10000032527 | 237 |
| 48 | 3300009553 | Ga0105249_10108295 | Ga0105249_101082953 | 237 |
| 49 | 3300014325 | Ga0163163_10002431 | Ga0163163_100024314 | 237 |
| 50 | 3300025961 | Ga0207712_10054601 | Ga0207712_100546012 | 237 |
| 51 | 3300037418 | Ga0395900_0144945 | Ga0395900_0144945_431_1180 | 237 |
| 52 | 3300038443 | Ga0395901_0032214 | Ga0395901_0032214_3504_4253 | 237 |
| 53 | 3300042007 | Ga0439449_0125362 | Ga0439449_0125362_114_866 | 238 |
| 54 | iso_pu_bacteria | 2643221697 | 2644538146 | 238 |
| 55 | iso_pu_bacteria | 2684623035 | 2686537094 | 238 |
| 56 | iso_pu_bacteria | 2895880812 | 2895890061 | 238 |
| 57 | 3300005435 | Ga0070714_100000002 | Ga0070714_100000002319 | 239 |
| 58 | 3300005441 | Ga0070700_100000124 | Ga0070700_10000012410 | 239 |
| 59 | 3300005564 | Ga0070664_100170478 | Ga0070664_1001704782 | 239 |
| 60 | 3300006844 | Ga0075428_100015686 | Ga0075428_1000156867 | 239 |
| 61 | 3300006846 | Ga0075430_100003236 | Ga0075430_10000323610 | 239 |
| 62 | 3300006880 | Ga0075429_100005937 | Ga0075429_1000059374 | 239 |
| 63 | 3300009147 | Ga0114129_10041067 | Ga0114129_100410674 | 239 |
| 64 | 3300013307 | Ga0157372_10002366 | Ga0157372_1000236611 | 239 |
| 65 | 3300025924 | Ga0207694_10047577 | Ga0207694_100475773 | 239 |
| 66 | 3300025929 | Ga0207664_10000038 | Ga0207664_10000038113 | 239 |
| 67 | 3300026075 | Ga0207708_10000023 | Ga0207708_10000023140 | 239 |
| 68 | 3300037466 | Ga0395898_0008145 | Ga0395898_0008145_9406_10161 | 239 |
| 69 | 3300038443 | Ga0395901_0025615 | Ga0395901_0025615_1075_1830 | 239 |
| 70 | 3300048912 | Ga0496109_0331338 | Ga0496109_0331338_270_1046 | 239 |
| 71 | 3300048915 | Ga0496112_0457857 | Ga0496112_0457857_95_868 | 239 |
| 72 | 3300048916 | Ga0496113_0005476 | Ga0496113_0005476_3586_4359 | 239 |
| 73 | 3300050507 | nmdc:mga05p37_16740_c2 | nmdc:mga05p37_16740_c2_4977_5762 | 239 |
| 74 | 3300050508 | nmdc:mga09592_6944_c1 | nmdc:mga09592_6944_c1_6010_6795 | 239 |
| 75 | 3300050509 | nmdc:mga0qj67_11960_c1 | nmdc:mga0qj67_11960_c1_3403_4188 | 239 |
| 76 | 3300050510 | nmdc:mga06r32_9471_c1 | nmdc:mga06r32_9471_c1_1998_2783 | 239 |
| 77 | iso_pu_bacteria | 2643221601 | 2644019408 | 239 |
| 78 | iso_pu_bacteria | 2643221631 | 2644177732 | 239 |
| 79 | 3300021384 | Ga0213876_10024982 | Ga0213876_100249823 | 240 |
| 80 | 3300039437 | Ga0436365_1829699 | Ga0436365_1829699_4400_5149 | 240 |
| 81 | 3300041512 | Ga0451853_0147823 | Ga0451853_0147823_5901_6734 | 240 |
| 82 | 3300048929 | Ga0496126_0611550 | Ga0496126_0611550_43_792 | 240 |
| 83 | iso_pu_bacteria | 2643221694 | 2644526161 | 240 |
| 84 | iso_pu_bacteria | 2643221722 | 2644670838 | 240 |
| 85 | 3300005334 | Ga0068869_100021696 | Ga0068869_1000216962 | 241 |
| 86 | 3300005335 | Ga0070666_10033090 | Ga0070666_100330902 | 241 |
| 87 | 3300005336 | Ga0070680_100118095 | Ga0070680_1001180953 | 241 |
| 88 | 3300005337 | Ga0070682_100197636 | Ga0070682_1001976361 | 241 |
| 89 | 3300005338 | Ga0068868_100003029 | Ga0068868_10000302911 | 241 |
| 90 | 3300005339 | Ga0070660_100028983 | Ga0070660_1000289832 | 241 |
| 91 | 3300005340 | Ga0070689_100111460 | Ga0070689_1001114602 | 241 |
| 92 | 3300005341 | Ga0070691_10039916 | Ga0070691_100399162 | 241 |
| 93 | 3300005345 | Ga0070692_10140399 | Ga0070692_101403991 | 241 |
| 94 | 3300005347 | Ga0070668_100012087 | Ga0070668_1000120873 | 241 |
| 95 | 3300005356 | Ga0070674_100492111 | Ga0070674_1004921111 | 241 |
| 96 | 3300005364 | Ga0070673_100282377 | Ga0070673_1002823771 | 241 |
| 97 | 3300005366 | Ga0070659_100019627 | Ga0070659_1000196274 | 241 |
| 98 | 3300005435 | Ga0070714_100795226 | Ga0070714_1007952261 | 241 |
| 99 | 3300005439 | Ga0070711_100078684 | Ga0070711_1000786843 | 241 |
| 100 | 3300005440 | Ga0070705_100003977 | Ga0070705_1000039772 | 241 |
| 101 | 3300005455 | Ga0070663_100014932 | Ga0070663_1000149323 | 241 |
| 102 | 3300005457 | Ga0070662_100034241 | Ga0070662_1000342413 | 241 |
| 103 | 3300005459 | Ga0068867_100123477 | Ga0068867_1001234772 | 241 |
| 104 | 3300005466 | Ga0070685_10019530 | Ga0070685_100195302 | 241 |
| 105 | 3300005471 | Ga0070698_100459427 | Ga0070698_1004594272 | 241 |
| 106 | 3300005539 | Ga0068853_100205064 | Ga0068853_1002050641 | 241 |
| 107 | 3300005543 | Ga0070672_100440880 | Ga0070672_1004408802 | 241 |
| 108 | 3300005544 | Ga0070686_100081792 | Ga0070686_1000817923 | 241 |
| 109 | 3300005545 | Ga0070695_100011401 | Ga0070695_1000114013 | 241 |
| 110 | 3300005546 | Ga0070696_100023865 | Ga0070696_1000238654 | 241 |
| 111 | 3300005547 | Ga0070693_100005276 | Ga0070693_1000052761 | 241 |
| 112 | 3300005548 | Ga0070665_100059353 | Ga0070665_1000593531 | 241 |
| 113 | 3300005549 | Ga0070704_100008699 | Ga0070704_1000086995 | 241 |
| 114 | 3300005563 | Ga0068855_100032936 | Ga0068855_1000329362 | 241 |
| 115 | 3300005564 | Ga0070664_100104217 | Ga0070664_1001042173 | 241 |
| 116 | 3300005577 | Ga0068857_100629391 | Ga0068857_1006293911 | 241 |
| 117 | 3300005616 | Ga0068852_100133164 | Ga0068852_1001331642 | 241 |
| 118 | 3300005719 | Ga0068861_100006531 | Ga0068861_1000065315 | 241 |
| 119 | 3300005841 | Ga0068863_100038829 | Ga0068863_1000388295 | 241 |
| 120 | 3300005842 | Ga0068858_100050207 | Ga0068858_1000502074 | 241 |
| 121 | 3300005843 | Ga0068860_100058208 | Ga0068860_1000582081 | 241 |
| 122 | 3300005983 | Ga0081540_1001870 | Ga0081540_10018707 | 241 |
| 123 | 3300006028 | Ga0070717_10027752 | Ga0070717_100277523 | 241 |
| 124 | 3300006163 | Ga0070715_10014550 | Ga0070715_100145503 | 241 |
| 125 | 3300006175 | Ga0070712_100199821 | Ga0070712_1001998212 | 241 |
| 126 | 3300006237 | Ga0097621_100048951 | Ga0097621_1000489514 | 241 |
| 127 | 3300006358 | Ga0068871_100087272 | Ga0068871_1000872722 | 241 |
| 128 | 3300006871 | Ga0075434_100313019 | Ga0075434_1003130191 | 241 |
| 129 | 3300006881 | Ga0068865_100260815 | Ga0068865_1002608152 | 241 |
| 130 | 3300006914 | Ga0075436_100025263 | Ga0075436_1000252633 | 241 |
| 131 | 3300007076 | Ga0075435_100002135 | Ga0075435_1000021353 | 241 |
| 132 | 3300009094 | Ga0111539_10148269 | Ga0111539_101482691 | 241 |
| 133 | 3300009098 | Ga0105245_10004893 | Ga0105245_100048935 | 241 |
| 134 | 3300009098 | Ga0105245_10012793 | Ga0105245_100127935 | 241 |
| 135 | 3300009148 | Ga0105243_10056175 | Ga0105243_100561753 | 241 |
| 136 | 3300009177 | Ga0105248_10014436 | Ga0105248_100144365 | 241 |
| 137 | 3300009545 | Ga0105237_10067649 | Ga0105237_100676493 | 241 |
| 138 | 3300009551 | Ga0105238_10071058 | Ga0105238_100710582 | 241 |
| 139 | 3300009553 | Ga0105249_10003464 | Ga0105249_1000346412 | 241 |
| 140 | 3300010375 | Ga0105239_10412696 | Ga0105239_104126962 | 241 |
| 141 | 3300010375 | Ga0105239_11102387 | Ga0105239_111023871 | 241 |
| 142 | 3300011119 | Ga0105246_10017682 | Ga0105246_100176823 | 241 |
| 143 | 3300013102 | Ga0157371_10014394 | Ga0157371_100143945 | 241 |
| 144 | 3300013104 | Ga0157370_10012239 | Ga0157370_100122394 | 241 |
| 145 | 3300013105 | Ga0157369_10026043 | Ga0157369_100260436 | 241 |
| 146 | 3300013296 | Ga0157374_10110396 | Ga0157374_101103963 | 241 |
| 147 | 3300013297 | Ga0157378_10053686 | Ga0157378_100536863 | 241 |
| 148 | 3300013306 | Ga0163162_10005797 | Ga0163162_100057972 | 241 |
| 149 | 3300013307 | Ga0157372_10061089 | Ga0157372_100610893 | 241 |
| 150 | 3300013308 | Ga0157375_10085499 | Ga0157375_100854993 | 241 |
| 151 | 3300014325 | Ga0163163_10038252 | Ga0163163_100382522 | 241 |
| 152 | 3300014326 | Ga0157380_10013493 | Ga0157380_100134936 | 241 |
| 153 | 3300014968 | Ga0157379_10006815 | Ga0157379_100068154 | 241 |
| 154 | 3300014969 | Ga0157376_10030129 | Ga0157376_100301294 | 241 |
| 155 | 3300017792 | Ga0163161_10120575 | Ga0163161_101205752 | 241 |
| 156 | 3300025901 | Ga0207688_10000570 | Ga0207688_100005708 | 241 |
| 157 | 3300025911 | Ga0207654_10026989 | Ga0207654_100269893 | 241 |
| 158 | 3300025911 | Ga0207654_10147578 | Ga0207654_101475781 | 241 |
| 159 | 3300025915 | Ga0207693_10002123 | Ga0207693_100021239 | 241 |
| 160 | 3300025916 | Ga0207663_10200760 | Ga0207663_102007601 | 241 |
| 161 | 3300025923 | Ga0207681_10290731 | Ga0207681_102907312 | 241 |
| 162 | 3300025924 | Ga0207694_10286459 | Ga0207694_102864591 | 241 |
| 163 | 3300025927 | Ga0207687_10005838 | Ga0207687_100058384 | 241 |
| 164 | 3300025931 | Ga0207644_10217404 | Ga0207644_102174042 | 241 |
| 165 | 3300025933 | Ga0207706_10007205 | Ga0207706_100072052 | 241 |
| 166 | 3300025934 | Ga0207686_10256852 | Ga0207686_102568522 | 241 |
| 167 | 3300025935 | Ga0207709_10423002 | Ga0207709_104230021 | 241 |
| 168 | 3300025939 | Ga0207665_10002367 | Ga0207665_100023676 | 241 |
| 169 | 3300025940 | Ga0207691_10075098 | Ga0207691_100750982 | 241 |
| 170 | 3300025941 | Ga0207711_10123759 | Ga0207711_101237591 | 241 |
| 171 | 3300025942 | Ga0207689_10008478 | Ga0207689_100084786 | 241 |
| 172 | 3300025949 | Ga0207667_10007161 | Ga0207667_100071615 | 241 |
| 173 | 3300025972 | Ga0207668_10010928 | Ga0207668_100109282 | 241 |
| 174 | 3300026035 | Ga0207703_10357920 | Ga0207703_103579201 | 241 |
| 175 | 3300026078 | Ga0207702_10666001 | Ga0207702_106660011 | 241 |
| 176 | 3300026088 | Ga0207641_10040208 | Ga0207641_100402083 | 241 |
| 177 | 3300026089 | Ga0207648_10040754 | Ga0207648_100407543 | 241 |
| 178 | 3300026118 | Ga0207675_100005797 | Ga0207675_1000057975 | 241 |
| 179 | 3300026121 | Ga0207683_10049319 | Ga0207683_100493192 | 241 |
| 180 | 3300028379 | Ga0268266_10442788 | Ga0268266_104427881 | 241 |
| 181 | 3300028381 | Ga0268264_10299507 | Ga0268264_102995072 | 241 |
| 182 | 3300033180 | Ga0307510_10077869 | Ga0307510_100778691 | 241 |
| 183 | 3300034957 | Ga0373938_0003459 | Ga0373938_0003459_1082_1837 | 241 |
| 184 | 3300035085 | Ga0373929_0034644 | Ga0373929_0034644_150_905 | 241 |
| 185 | 3300035090 | Ga0373949_0015760 | Ga0373949_0015760_859_1614 | 241 |
| 186 | 3300035092 | Ga0373952_0036334 | Ga0373952_0036334_40_795 | 241 |
| 187 | 3300035114 | Ga0373939_0000981 | Ga0373939_0000981_779_1534 | 241 |
| 188 | 3300035241 | Ga0373961_0008233 | Ga0373961_0008233_871_1626 | 241 |
| 189 | 3300035691 | Ga0373931_0009228 | Ga0373931_0009228_2484_3239 | 241 |
| 190 | 3300035695 | Ga0373927_0205498 | Ga0373927_0205498_47_793 | 241 |
| 191 | 3300037068 | Ga0373925_0290757 | Ga0373925_0290757_35_790 | 241 |
| 192 | 3300044684 | Ga0466966_0023637 | Ga0466966_0023637_2119_2889 | 241 |
| 193 | 3300044684 | Ga0466966_0180441 | Ga0466966_0180441_493_1239 | 241 |
| 194 | 3300044684 | Ga0466966_0244437 | Ga0466966_0244437_266_1012 | 241 |
| 195 | 3300044693 | Ga0466961_0032747 | Ga0466961_0032747_1230_2000 | 241 |
| 196 | 3300044693 | Ga0466961_0037060 | Ga0466961_0037060_1998_2744 | 241 |
| 197 | 3300044693 | Ga0466961_0053518 | Ga0466961_0053518_437_1207 | 241 |
| 198 | 3300044693 | Ga0466961_0069088 | Ga0466961_0069088_259_1005 | 241 |
| 199 | 3300044693 | Ga0466961_0135324 | Ga0466961_0135324_81_827 | 241 |
| 200 | 3300044693 | Ga0466961_0221133 | Ga0466961_0221133_109_855 | 241 |
| 201 | 3300044694 | Ga0466963_0000452 | Ga0466963_0000452_11851_12597 | 241 |
| 202 | 3300044694 | Ga0466963_0113585 | Ga0466963_0113585_1026_1772 | 241 |
| 203 | 3300044765 | Ga0466970_0031492 | Ga0466970_0031492_361_1131 | 241 |
| 204 | 3300044765 | Ga0466970_0092279 | Ga0466970_0092279_196_966 | 241 |
| 205 | 3300044842 | Ga0466957_0023515 | Ga0466957_0023515_1306_2076 | 241 |
| 206 | 3300044842 | Ga0466957_0049256 | Ga0466957_0049256_1313_2059 | 241 |
| 207 | 3300045049 | Ga0466959_0148815 | Ga0466959_0148815_809_1579 | 241 |
| 208 | 3300045836 | Ga0466958_0030781 | Ga0466958_0030781_1369_2139 | 241 |
| 209 | 3300045836 | Ga0466958_0044349 | Ga0466958_0044349_762_1508 | 241 |
| 210 | 3300045836 | Ga0466958_0185881 | Ga0466958_0185881_483_1253 | 241 |
| 211 | 3300045976 | Ga0466967_0003089 | Ga0466967_0003089_4104_4850 | 241 |
| 212 | 3300045976 | Ga0466967_0466259 | Ga0466967_0466259_199_945 | 241 |
| 213 | 3300045976 | Ga0466967_0938999 | Ga0466967_0938999_38_784 | 241 |
| 214 | 3300048903 | Ga0496100_0039188 | Ga0496100_0039188_1776_2531 | 241 |
| 215 | 3300048905 | Ga0496102_0020127 | Ga0496102_0020127_1867_2622 | 241 |
| 216 | 3300048905 | Ga0496102_0023197 | Ga0496102_0023197_4573_5319 | 241 |
| 217 | 3300048906 | Ga0496103_0036404 | Ga0496103_0036404_1324_2079 | 241 |
| 218 | 3300048906 | Ga0496103_0105462 | Ga0496103_0105462_596_1342 | 241 |
| 219 | 3300048907 | Ga0496104_0035579 | Ga0496104_0035579_2509_3264 | 241 |
| 220 | 3300048909 | Ga0496106_0032469 | Ga0496106_0032469_405_1160 | 241 |
| 221 | 3300048910 | Ga0496107_0043844 | Ga0496107_0043844_450_1205 | 241 |
| 222 | 3300048911 | Ga0496108_0011996 | Ga0496108_0011996_4472_5227 | 241 |
| 223 | 3300048912 | Ga0496109_0121420 | Ga0496109_0121420_1534_2289 | 241 |
| 224 | 3300048913 | Ga0496110_0166262 | Ga0496110_0166262_140_895 | 241 |
| 225 | 3300048914 | Ga0496111_0024608 | Ga0496111_0024608_2790_3545 | 241 |
| 226 | 3300048915 | Ga0496112_0050113 | Ga0496112_0050113_1829_2584 | 241 |
| 227 | 3300048916 | Ga0496113_0476603 | Ga0496113_0476603_107_862 | 241 |
| 228 | 3300048918 | Ga0496115_0010456 | Ga0496115_0010456_6153_6908 | 241 |
| 229 | 3300048924 | Ga0496121_0006012 | Ga0496121_0006012_8212_8958 | 241 |
| 230 | 3300048929 | Ga0496126_0179904 | Ga0496126_0179904_577_1326 | 241 |
| 231 | 3300049574 | Ga0501038_0393710 | Ga0501038_0393710_318_1058 | 241 |
| 232 | 3300050511 | nmdc:mga08y16_423723_c1 | nmdc:mga08y16_423723_c1_544_1299 | 241 |
| 233 | 3300050512 | nmdc:mga0n895_87287_c1 | nmdc:mga0n895_87287_c1_1324_2079 | 241 |
| 234 | 3300050515 | nmdc:mga0a205_5209_c1 | nmdc:mga0a205_5209_c1_2009_2764 | 241 |
| 235 | 3300053177 | Ga0500636_0256624 | Ga0500636_0256624_100_852 | 241 |
| 236 | 3300061719 | Ga0466962_0075984 | Ga0466962_0075984_626_1372 | 241 |
| 237 | 3300061719 | Ga0466962_0194737 | Ga0466962_0194737_12_782 | 241 |
| 238 | iso_pu_bacteria | 2773857922 | 2774855223 | 241 |
| 239 | 3300005435 | Ga0070714_100893217 | Ga0070714_1008932171 | 242 |
| 240 | 3300005614 | Ga0068856_100102462 | Ga0068856_1001024624 | 242 |
| 241 | 3300009093 | Ga0105240_10404449 | Ga0105240_104044493 | 242 |
| 242 | 3300010375 | Ga0105239_10021135 | Ga0105239_100211353 | 242 |
| 243 | 3300025913 | Ga0207695_10078690 | Ga0207695_100786903 | 242 |
| 244 | 3300026078 | Ga0207702_10055062 | Ga0207702_100550624 | 242 |
| 245 | 3300044694 | Ga0466963_0033462 | Ga0466963_0033462_1090_1863 | 242 |
| 246 | 3300048922 | Ga0496119_0104192 | Ga0496119_0104192_235_1008 | 242 |
| 247 | 3300048924 | Ga0496121_0034330 | Ga0496121_0034330_809_1582 | 242 |
| 248 | 3300049569 | Ga0501032_0115882 | Ga0501032_0115882_402_1361 | 242 |
| 249 | 3300049571 | Ga0501034_0080870 | Ga0501034_0080870_538_1398 | 242 |
| 250 | 3300049823 | Ga0501044_0146049 | Ga0501044_0146049_625_1584 | 242 |
| 251 | 3300006038 | Ga0075365_10081507 | Ga0075365_100815072 | 243 |
| 252 | 3300013104 | Ga0157370_10034564 | Ga0157370_100345645 | 243 |
| 253 | 3300005841 | Ga0068863_100005701 | Ga0068863_1000057014 | 244 |
| 254 | 3300014968 | Ga0157379_10000203 | Ga0157379_1000020321 | 244 |
| 255 | 3300025900 | Ga0207710_10000110 | Ga0207710_1000011030 | 244 |
| 256 | 3300026035 | Ga0207703_10000005 | Ga0207703_10000005258 | 244 |
| 257 | 3300026088 | Ga0207641_10023439 | Ga0207641_100234392 | 244 |
| 258 | 3300044656 | Ga0466969_0058806 | Ga0466969_0058806_629_1492 | 244 |
| 259 | 3300044765 | Ga0466970_0166521 | Ga0466970_0166521_91_954 | 244 |
| 260 | 3300048920 | Ga0496117_0000367 | Ga0496117_0000367_60348_61145 | 244 |
| 261 | 3300053153 | Ga0500616_0000424 | Ga0500616_0000424_44343_45110 | 244 |
| 262 | iso_pu_bacteria | 2643221690 | 2644506141 | 244 |
| 263 | 3300005842 | Ga0068858_100006048 | Ga0068858_1000060482 | 245 |
| 264 | 3300006931 | Ga0097620_100015740 | Ga0097620_1000157406 | 245 |
| 265 | 3300026035 | Ga0207703_10018451 | Ga0207703_100184512 | 245 |
| 266 | 3300031649 | Ga0307514_10279601 | Ga0307514_102796011 | 245 |
| 267 | 3300045976 | Ga0466967_0017575 | Ga0466967_0017575_4311_5144 | 245 |
| 268 | 3300048906 | Ga0496103_0068217 | Ga0496103_0068217_913_1761 | 245 |
| 269 | 3300048919 | Ga0496116_0000474 | Ga0496116_0000474_49105_49953 | 245 |
| 270 | 3300048920 | Ga0496117_0020254 | Ga0496117_0020254_330_1178 | 245 |
| 271 | 3300048921 | Ga0496118_0002773 | Ga0496118_0002773_5530_6378 | 245 |
| 272 | 3300048922 | Ga0496119_0015302 | Ga0496119_0015302_4458_5306 | 245 |
| 273 | 3300048924 | Ga0496121_0052415 | Ga0496121_0052415_1846_2700 | 245 |
| 274 | iso_pu_bacteria | 2508501039 | 2508674165 | 245 |
| 275 | iso_pu_bacteria | 2517572101 | 2517764539 | 245 |
| 276 | iso_pu_bacteria | 2554235227 | 2555228692 | 245 |
| 277 | iso_pu_bacteria | 2654587600 | 2655033138 | 245 |
| 278 | iso_pu_bacteria | 2675902999 | 2676198763 | 245 |
| 279 | iso_pu_bacteria | 2773857921 | 2774843341 | 245 |
| 280 | iso_pu_bacteria | 2919538618 | 2919540579 | 245 |
| 281 | iso_pu_bacteria | 8002775197 | 8002776895 | 245 |
| 282 | iso_pu_bacteria | 8002784119 | 8002785263 | 245 |
| 283 | 3300005329 | Ga0070683_100496978 | Ga0070683_1004969781 | 246 |
| 284 | 3300020082 | Ga0206353_10926598 | Ga0206353_109265982 | 246 |
| 285 | 3300025944 | Ga0207661_10388478 | Ga0207661_103884782 | 246 |
| 286 | iso_pu_bacteria | 2643221681 | 2644456278 | 246 |
| 287 | iso_pu_bacteria | 2808606439 | 2809196734 | 246 |
| 288 | iso_pu_bacteria | 2811994878 | 2812351137 | 246 |
| 289 | 3300005466 | Ga0070685_10204967 | Ga0070685_102049671 | 247 |
| 290 | 3300009148 | Ga0105243_10007019 | Ga0105243_100070196 | 247 |
| 291 | 3300010375 | Ga0105239_11190248 | Ga0105239_111902481 | 247 |
| 292 | 3300049590 | Ga0501074_0079542 | Ga0501074_0079542_1341_2099 | 247 |
| 293 | iso_pu_bacteria | 2643221561 | 2643826160 | 247 |
| 294 | iso_pu_bacteria | 2643221696 | 2644532135 | 247 |
| 295 | iso_pu_bacteria | 2964326757 | 2964329588 | 247 |
| 296 | 3300005617 | Ga0068859_100768511 | Ga0068859_1007685111 | 248 |
| 297 | 3300006038 | Ga0075365_10103351 | Ga0075365_101033512 | 248 |
| 298 | 3300006931 | Ga0097620_100768515 | Ga0097620_1007685151 | 248 |
| 299 | 3300009094 | Ga0111539_10247192 | Ga0111539_102471922 | 248 |
| 300 | 3300011119 | Ga0105246_10001248 | Ga0105246_100012482 | 248 |
| 301 | 3300031247 | Ga0265340_10004882 | Ga0265340_100048829 | 248 |
| 302 | iso_pu_bacteria | 2739367898 | 2740168954 | 248 |
| 303 | 3300005329 | Ga0070683_100004618 | Ga0070683_10000461812 | 249 |
| 304 | 3300005548 | Ga0070665_100000522 | Ga0070665_10000052252 | 249 |
| 305 | 3300005548 | Ga0070665_100180815 | Ga0070665_1001808152 | 249 |
| 306 | 3300006051 | Ga0075364_10420583 | Ga0075364_104205831 | 249 |
| 307 | 3300030522 | Ga0307512_10001989 | Ga0307512_1000198917 | 249 |
| 308 | 3300031616 | Ga0307508_10043952 | Ga0307508_100439521 | 249 |
| 309 | 3300032002 | Ga0307416_100315022 | Ga0307416_1003150222 | 249 |
| 310 | 3300042002 | Ga0439442_000840 | Ga0439442_000840_3930_4697 | 249 |
| 311 | 3300042007 | Ga0439449_0016559 | Ga0439449_0016559_1770_2537 | 249 |
| 312 | 3300042122 | Ga0450920_000547 | Ga0450920_000547_4688_5455 | 249 |
| 313 | 3300042146 | Ga0450907_001018 | Ga0450907_001018_5296_6063 | 249 |
| 314 | 3300042435 | Ga0439434_0000331 | Ga0439434_0000331_5685_6452 | 249 |
| 315 | 3300042531 | Ga0450918_000569 | Ga0450918_000569_2590_3357 | 249 |
| 316 | 3300044706 | Ga0466964_0073772 | Ga0466964_0073772_82_846 | 249 |
| 317 | iso_pu_bacteria | 8054609563 | 8054611218 | 249 |
| 318 | 3300005327 | Ga0070658_10032723 | Ga0070658_100327231 | 250 |
| 319 | 3300005719 | Ga0068861_100214282 | Ga0068861_1002142822 | 250 |
| 320 | 3300006178 | Ga0075367_10051361 | Ga0075367_100513612 | 250 |
| 321 | 3300013105 | Ga0157369_10073728 | Ga0157369_100737283 | 250 |
| 322 | 3300049571 | Ga0501034_0021532 | Ga0501034_0021532_4863_5630 | 250 |
| 323 | 3300049573 | Ga0501037_0232326 | Ga0501037_0232326_197_964 | 250 |
| 324 | 3300049581 | Ga0501047_0094195 | Ga0501047_0094195_895_1662 | 250 |
| 325 | 3300049583 | Ga0501067_0000869 | Ga0501067_0000869_7507_8274 | 250 |
| 326 | 3300049584 | Ga0501068_0003970 | Ga0501068_0003970_6924_7691 | 250 |
| 327 | 3300049586 | Ga0501070_0004060 | Ga0501070_0004060_11002_11769 | 250 |
| 328 | 3300049587 | Ga0501071_0036344 | Ga0501071_0036344_1245_2012 | 250 |
| 329 | 3300049588 | Ga0501072_0061761 | Ga0501072_0061761_1484_2251 | 250 |
| 330 | 3300049589 | Ga0501073_0124551 | Ga0501073_0124551_356_1123 | 250 |
| 331 | 3300049590 | Ga0501074_0001389 | Ga0501074_0001389_10728_11495 | 250 |
| 332 | 3300049742 | Ga0501080_0041769 | Ga0501080_0041769_44_811 | 250 |
| 333 | 3300049744 | Ga0501083_0015685 | Ga0501083_0015685_302_1069 | 250 |
| 334 | 3300050491 | nmdc:mga00v17_69232_c1 | nmdc:mga00v17_69232_c1_1047_1814 | 250 |
| 335 | 3300054114 | Ga0501084_0018158 | Ga0501084_0018158_2044_2811 | 250 |
| 336 | 3300060353 | Ga0501082_0073241 | Ga0501082_0073241_608_1375 | 250 |
| 337 | 3300060353 | Ga0501082_0233291 | Ga0501082_0233291_790_1560 | 250 |
| 338 | iso_pu_bacteria | 2773857762 | 2774392909 | 250 |
| 339 | iso_pu_bacteria | 2855386786 | 2855387211 | 250 |
| 340 | 3300050492 | nmdc:mga0yw44_272473_c1 | nmdc:mga0yw44_272473_c1_49_834 | 251 |
| 341 | 3300053136 | Ga0500559_0000589 | Ga0500559_0000589_20616_21389 | 251 |
| 342 | 3300005455 | Ga0070663_100094687 | Ga0070663_1000946872 | 252 |
| 343 | 3300005548 | Ga0070665_100105328 | Ga0070665_1001053283 | 252 |
| 344 | 3300005563 | Ga0068855_100019090 | Ga0068855_1000190902 | 252 |
| 345 | 3300005616 | Ga0068852_100111327 | Ga0068852_1001113272 | 252 |
| 346 | 3300009093 | Ga0105240_10030309 | Ga0105240_100303093 | 252 |
| 347 | 3300009174 | Ga0105241_10002482 | Ga0105241_100024826 | 252 |
| 348 | 3300009545 | Ga0105237_10011916 | Ga0105237_100119167 | 252 |
| 349 | 3300009551 | Ga0105238_10038741 | Ga0105238_100387412 | 252 |
| 350 | 3300013296 | Ga0157374_10079604 | Ga0157374_100796043 | 252 |
| 351 | 3300025904 | Ga0207647_10040557 | Ga0207647_100405572 | 252 |
| 352 | 3300025911 | Ga0207654_10014853 | Ga0207654_100148533 | 252 |
| 353 | 3300025913 | Ga0207695_10004382 | Ga0207695_100043829 | 252 |
| 354 | 3300025914 | Ga0207671_10004661 | Ga0207671_100046618 | 252 |
| 355 | 3300025924 | Ga0207694_10021185 | Ga0207694_100211852 | 252 |
| 356 | 3300025949 | Ga0207667_10052680 | Ga0207667_100526801 | 252 |
| 357 | 3300026067 | Ga0207678_10103458 | Ga0207678_101034582 | 252 |
| 358 | 3300026142 | Ga0207698_10011853 | Ga0207698_100118534 | 252 |
| 359 | 3300028379 | Ga0268266_10133937 | Ga0268266_101339372 | 252 |
| 360 | 3300047320 | Ga0495672_0131369 | Ga0495672_0131369_96_881 | 252 |
| 361 | iso_pu_bacteria | 2585427649 | 2586061261 | 252 |
| 362 | iso_pu_bacteria | 2808606522 | 2809589652 | 252 |
| 363 | iso_pu_bacteria | 2915768154 | 2915769724 | 252 |
| 364 | 3300006038 | Ga0075365_10006894 | Ga0075365_100068944 | 253 |
| 365 | 3300048089 | Ga0495614_0112230 | Ga0495614_0112230_302_1087 | 253 |
| 366 | 3300005339 | Ga0070660_100271887 | Ga0070660_1002718872 | 254 |
| 367 | 3300005577 | Ga0068857_100239242 | Ga0068857_1002392422 | 254 |
| 368 | 3300013104 | Ga0157370_10258805 | Ga0157370_102588052 | 254 |
| 369 | 3300020082 | Ga0206353_10341763 | Ga0206353_103417631 | 254 |
| 370 | 3300025919 | Ga0207657_10114372 | Ga0207657_101143722 | 254 |
| 371 | 3300026116 | Ga0207674_10009187 | Ga0207674_1000918710 | 254 |
| 372 | iso_pu_bacteria | 2862993130 | 2862996173 | 254 |
| 373 | iso_pu_bacteria | 2795385470 | 2795786924 | 255 |
| 374 | 3300031838 | Ga0307518_10000093 | Ga0307518_1000009348 | 256 |
| 375 | 3300033179 | Ga0307507_10000081 | Ga0307507_1000008175 | 256 |
| 376 | 3300041494 | Ga0451837_0806448 | Ga0451837_0806448_467_1255 | 256 |
| 377 | 3300046660 | Ga0495625_0074275 | Ga0495625_0074275_893_1675 | 256 |
| 378 | iso_pu_bacteria | 2866612099 | 2866614948 | 256 |
| 379 | 3300046454 | Ga0495592_0001572 | Ga0495592_0001572_7902_8687 | 257 |
| 380 | 3300046476 | Ga0495662_0002086 | Ga0495662_0002086_7906_8691 | 257 |
| 381 | 3300046477 | Ga0495664_0002181 | Ga0495664_0002181_8627_9412 | 257 |
| 382 | 3300046517 | Ga0495630_0235697 | Ga0495630_0235697_279_1064 | 257 |
| 383 | 3300046529 | Ga0495652_0011673 | Ga0495652_0011673_3473_4258 | 257 |
| 384 | 3300046535 | Ga0495586_0047208 | Ga0495586_0047208_1150_1935 | 257 |
| 385 | 3300046536 | Ga0495587_0004992 | Ga0495587_0004992_3520_4305 | 257 |
| 386 | 3300046543 | Ga0495645_0065464 | Ga0495645_0065464_582_1367 | 257 |
| 387 | 3300046642 | Ga0495634_0011690 | Ga0495634_0011690_716_1501 | 257 |
| 388 | 3300046675 | Ga0495657_0000784 | Ga0495657_0000784_19557_20342 | 257 |
| 389 | 3300046678 | Ga0495599_0144608 | Ga0495599_0144608_180_965 | 257 |
| 390 | 3300046679 | Ga0495623_0152613 | Ga0495623_0152613_226_1011 | 257 |
| 391 | 3300046680 | Ga0495646_0000744 | Ga0495646_0000744_4006_4791 | 257 |
| 392 | 3300046689 | Ga0495613_0003321 | Ga0495613_0003321_885_1670 | 257 |
| 393 | 3300047315 | Ga0495581_0001059 | Ga0495581_0001059_1974_2759 | 257 |
| 394 | 3300047317 | Ga0495604_0000368 | Ga0495604_0000368_20050_20835 | 257 |
| 395 | 3300047319 | Ga0495674_0250266 | Ga0495674_0250266_285_1070 | 257 |
| 396 | 3300047321 | Ga0495676_0029396 | Ga0495676_0029396_3656_4441 | 257 |
| 397 | 3300047673 | Ga0495593_0005411 | Ga0495593_0005411_4114_4899 | 257 |
| 398 | 3300048088 | Ga0495602_0118594 | Ga0495602_0118594_1095_1880 | 257 |
| 399 | 3300053078 | Ga0495612_0027464 | Ga0495612_0027464_756_1541 | 257 |
| 400 | 3300053085 | Ga0495619_0134340 | Ga0495619_0134340_717_1502 | 257 |
| 401 | 3300053157 | Ga0500624_002469 | Ga0500624_002469_645_1430 | 257 |
| 402 | iso_pu_bacteria | 8003314358 | 8003320006 | 257 |
| 403 | 3300041494 | Ga0451837_0295870 | Ga0451837_0295870_1029_1880 | 258 |
| 404 | 3300042014 | Ga0439457_000116 | Ga0439457_000116_7787_8590 | 258 |
| 405 | 3300026088 | Ga0207641_10727337 | Ga0207641_107273372 | 259 |
| 406 | 3300033179 | Ga0307507_10230459 | Ga0307507_102304591 | 259 |
| 407 | 3300049570 | Ga0501033_0001412 | Ga0501033_0001412_18913_19719 | 259 |
| 408 | 3300049822 | Ga0501035_0040895 | Ga0501035_0040895_939_1745 | 259 |
| 409 | iso_pu_bacteria | 2799112218 | 2799186340 | 259 |
| 410 | 3300011119 | Ga0105246_10079336 | Ga0105246_100793362 | 260 |
| 411 | 3300013105 | Ga0157369_10154126 | Ga0157369_101541263 | 260 |
| 412 | 3300013307 | Ga0157372_10458253 | Ga0157372_104582532 | 260 |
| 413 | 3300031616 | Ga0307508_10298521 | Ga0307508_102985211 | 260 |
| 414 | 3300041498 | Ga0451841_1321351 | Ga0451841_1321351_618_1487 | 260 |
| 415 | 3300046457 | Ga0495590_0041099 | Ga0495590_0041099_634_1428 | 260 |
| 416 | 3300046459 | Ga0495629_0038922 | Ga0495629_0038922_164_958 | 260 |
| 417 | 3300046459 | Ga0495629_0058976 | Ga0495629_0058976_1436_2230 | 260 |
| 418 | 3300046461 | Ga0495641_0082234 | Ga0495641_0082234_98_892 | 260 |
| 419 | 3300046474 | Ga0495605_0003368 | Ga0495605_0003368_4157_4951 | 260 |
| 420 | 3300046476 | Ga0495662_0132714 | Ga0495662_0132714_234_1028 | 260 |
| 421 | 3300046499 | Ga0495594_0009594 | Ga0495594_0009594_2782_3576 | 260 |
| 422 | 3300046500 | Ga0495596_0044270 | Ga0495596_0044270_430_1224 | 260 |
| 423 | 3300046506 | Ga0495583_0091496 | Ga0495583_0091496_170_964 | 260 |
| 424 | 3300046507 | Ga0495606_0005627 | Ga0495606_0005627_4759_5553 | 260 |
| 425 | 3300046512 | Ga0495610_0012317 | Ga0495610_0012317_1418_2212 | 260 |
| 426 | 3300046515 | Ga0495620_0005492 | Ga0495620_0005492_4605_5399 | 260 |
| 427 | 3300046515 | Ga0495620_0006957 | Ga0495620_0006957_4381_5175 | 260 |
| 428 | 3300046516 | Ga0495628_0069662 | Ga0495628_0069662_1748_2542 | 260 |
| 429 | 3300046517 | Ga0495630_0167516 | Ga0495630_0167516_213_1007 | 260 |
| 430 | 3300046518 | Ga0495631_0001500 | Ga0495631_0001500_11333_12127 | 260 |
| 431 | 3300046522 | Ga0495643_0010717 | Ga0495643_0010717_1195_1989 | 260 |
| 432 | 3300046524 | Ga0495648_0071666 | Ga0495648_0071666_207_1001 | 260 |
| 433 | 3300046524 | Ga0495648_0147896 | Ga0495648_0147896_54_848 | 260 |
| 434 | 3300046526 | Ga0495666_0029566 | Ga0495666_0029566_345_1139 | 260 |
| 435 | 3300046528 | Ga0495642_0073716 | Ga0495642_0073716_341_1135 | 260 |
| 436 | 3300046530 | Ga0495654_0038740 | Ga0495654_0038740_1436_2230 | 260 |
| 437 | 3300046533 | Ga0495640_0008471 | Ga0495640_0008471_4297_5091 | 260 |
| 438 | 3300046542 | Ga0495597_0006381 | Ga0495597_0006381_2635_3429 | 260 |
| 439 | 3300046557 | Ga0495622_0004737 | Ga0495622_0004737_686_1480 | 260 |
| 440 | 3300046558 | Ga0495633_0018655 | Ga0495633_0018655_2684_3478 | 260 |
| 441 | 3300046616 | Ga0495668_0003067 | Ga0495668_0003067_10071_10865 | 260 |
| 442 | 3300046616 | Ga0495668_0030042 | Ga0495668_0030042_854_1648 | 260 |
| 443 | 3300046660 | Ga0495625_0041044 | Ga0495625_0041044_478_1272 | 260 |
| 444 | 3300046663 | Ga0495635_0047449 | Ga0495635_0047449_454_1248 | 260 |
| 445 | 3300046663 | Ga0495635_0050691 | Ga0495635_0050691_1937_2731 | 260 |
| 446 | 3300046665 | Ga0495661_0023252 | Ga0495661_0023252_1826_2620 | 260 |
| 447 | 3300046679 | Ga0495623_0073306 | Ga0495623_0073306_145_939 | 260 |
| 448 | 3300046689 | Ga0495613_0007950 | Ga0495613_0007950_2762_3556 | 260 |
| 449 | 3300046689 | Ga0495613_0149817 | Ga0495613_0149817_706_1500 | 260 |
| 450 | 3300046689 | Ga0495613_0182545 | Ga0495613_0182545_666_1460 | 260 |
| 451 | 3300046690 | Ga0495624_0023542 | Ga0495624_0023542_1095_1889 | 260 |
| 452 | 3300046691 | Ga0495670_0094886 | Ga0495670_0094886_346_1140 | 260 |
| 453 | 3300046694 | Ga0495649_0021665 | Ga0495649_0021665_610_1404 | 260 |
| 454 | 3300046694 | Ga0495649_0111253 | Ga0495649_0111253_610_1404 | 260 |
| 455 | 3300046794 | Ga0495589_0004663 | Ga0495589_0004663_1945_2739 | 260 |
| 456 | 3300046794 | Ga0495589_0078740 | Ga0495589_0078740_293_1087 | 260 |
| 457 | 3300047315 | Ga0495581_0028789 | Ga0495581_0028789_1141_1935 | 260 |
| 458 | 3300047317 | Ga0495604_0136580 | Ga0495604_0136580_650_1444 | 260 |
| 459 | 3300047317 | Ga0495604_0311938 | Ga0495604_0311938_11_805 | 260 |
| 460 | 3300047318 | Ga0495636_0079242 | Ga0495636_0079242_529_1323 | 260 |
| 461 | 3300047321 | Ga0495676_0023590 | Ga0495676_0023590_572_1366 | 260 |
| 462 | 3300047321 | Ga0495676_0134892 | Ga0495676_0134892_572_1366 | 260 |
| 463 | 3300047322 | Ga0495680_0013488 | Ga0495680_0013488_772_1566 | 260 |
| 464 | 3300047443 | Ga0495687_039239 | Ga0495687_039239_85_879 | 260 |
| 465 | 3300048091 | Ga0495626_0005502 | Ga0495626_0005502_5309_6103 | 260 |
| 466 | 3300048912 | Ga0496109_0006176 | Ga0496109_0006176_5219_6013 | 260 |
| 467 | 3300049573 | Ga0501037_0067019 | Ga0501037_0067019_115_909 | 260 |
| 468 | 3300049574 | Ga0501038_0006143 | Ga0501038_0006143_9989_10783 | 260 |
| 469 | 3300049579 | Ga0501043_0030259 | Ga0501043_0030259_2739_3533 | 260 |
| 470 | 3300049581 | Ga0501047_0210797 | Ga0501047_0210797_729_1523 | 260 |
| 471 | 3300049742 | Ga0501080_0066185 | Ga0501080_0066185_1586_2380 | 260 |
| 472 | 3300049823 | Ga0501044_0043041 | Ga0501044_0043041_1386_2180 | 260 |
| 473 | 3300005435 | Ga0070714_100128363 | Ga0070714_1001283633 | 261 |
| 474 | 3300005455 | Ga0070663_100000995 | Ga0070663_10000099516 | 261 |
| 475 | 3300005616 | Ga0068852_100218384 | Ga0068852_1002183842 | 261 |
| 476 | 3300009098 | Ga0105245_10064804 | Ga0105245_100648043 | 261 |
| 477 | 3300009148 | Ga0105243_10167657 | Ga0105243_101676572 | 261 |
| 478 | 3300009553 | Ga0105249_10755409 | Ga0105249_107554091 | 261 |
| 479 | 3300013296 | Ga0157374_10432536 | Ga0157374_104325361 | 261 |
| 480 | 3300013306 | Ga0163162_10144500 | Ga0163162_101445002 | 261 |
| 481 | 3300013308 | Ga0157375_10001577 | Ga0157375_1000157711 | 261 |
| 482 | 3300014325 | Ga0163163_10161292 | Ga0163163_101612923 | 261 |
| 483 | 3300025929 | Ga0207664_10489042 | Ga0207664_104890422 | 261 |
| 484 | 3300025935 | Ga0207709_10329133 | Ga0207709_103291331 | 261 |
| 485 | 3300026067 | Ga0207678_10000091 | Ga0207678_1000009114 | 261 |
| 486 | 3300033179 | Ga0307507_10043437 | Ga0307507_100434372 | 261 |
| 487 | 3300033180 | Ga0307510_10092527 | Ga0307510_100925272 | 261 |
| 488 | 3300044706 | Ga0466964_0048353 | Ga0466964_0048353_549_1352 | 261 |
| 489 | 3300044765 | Ga0466970_0158568 | Ga0466970_0158568_326_1123 | 261 |
| 490 | 3300045976 | Ga0466967_0247697 | Ga0466967_0247697_294_1097 | 261 |
| 491 | 3300046455 | Ga0495603_0125526 | Ga0495603_0125526_370_1173 | 261 |
| 492 | 3300048907 | Ga0496104_0194891 | Ga0496104_0194891_724_1527 | 261 |
| 493 | 3300048908 | Ga0496105_0060964 | Ga0496105_0060964_2137_2940 | 261 |
| 494 | 3300048909 | Ga0496106_0158309 | Ga0496106_0158309_659_1462 | 261 |
| 495 | 3300048911 | Ga0496108_0031072 | Ga0496108_0031072_2371_3174 | 261 |
| 496 | 3300048912 | Ga0496109_0205738 | Ga0496109_0205738_965_1768 | 261 |
| 497 | 3300048913 | Ga0496110_0004671 | Ga0496110_0004671_3872_4675 | 261 |
| 498 | 3300048914 | Ga0496111_0021434 | Ga0496111_0021434_542_1345 | 261 |
| 499 | 3300048915 | Ga0496112_0116963 | Ga0496112_0116963_995_1798 | 261 |
| 500 | 3300048917 | Ga0496114_0019850 | Ga0496114_0019850_2132_2935 | 261 |
| 501 | iso_pu_bacteria | 2582581314 | 2585315551 | 261 |
| 502 | iso_pu_bacteria | 2808606375 | 2808918596 | 261 |
| 503 | 3300006844 | Ga0075428_100331421 | Ga0075428_1003314212 | 262 |
| 504 | 3300010375 | Ga0105239_10049392 | Ga0105239_100493922 | 262 |
| 505 | 3300046462 | Ga0495651_0159257 | Ga0495651_0159257_579_1448 | 262 |
| 506 | 3300053077 | Ga0495601_0068803 | Ga0495601_0068803_393_1262 | 262 |
| 507 | 3300053078 | Ga0495612_0002846 | Ga0495612_0002846_1994_2863 | 262 |
| 508 | iso_pu_bacteria | 2784746763 | 2785345536 | 262 |
| 509 | iso_pu_bacteria | 2912723979 | 2912725931 | 262 |
| 510 | iso_pu_bacteria | 2990059506 | 2990062730 | 262 |
| 511 | iso_pu_bacteria | 8048406513 | 8048412135 | 262 |
| 512 | 3300014497 | Ga0182008_10000152 | Ga0182008_1000015245 | 263 |
| 513 | 3300015262 | Ga0182007_10010546 | Ga0182007_100105462 | 263 |
| 514 | 3300028794 | Ga0307515_10141441 | Ga0307515_101414411 | 263 |
| 515 | 3300031456 | Ga0307513_10183477 | Ga0307513_101834772 | 263 |
| 516 | iso_pu_bacteria | 2582580736 | 2583149961 | 263 |
| 517 | 3300003316 | rootH1_10006612 | rootH1_100066124 | 264 |
| 518 | 3300005347 | Ga0070668_100017099 | Ga0070668_1000170994 | 264 |
| 519 | 3300025972 | Ga0207668_10124815 | Ga0207668_101248153 | 264 |
| 520 | 3300028794 | Ga0307515_10098721 | Ga0307515_100987212 | 264 |
| 521 | 3300030522 | Ga0307512_10077296 | Ga0307512_100772962 | 264 |
| 522 | 3300031507 | Ga0307509_10325748 | Ga0307509_103257482 | 264 |
| 523 | 3300031616 | Ga0307508_10188288 | Ga0307508_101882882 | 264 |
| 524 | 3300033179 | Ga0307507_10064883 | Ga0307507_100648832 | 264 |
| 525 | 3300044658 | Ga0466972_0004125 | Ga0466972_0004125_1465_2280 | 264 |
| 526 | 3300046516 | Ga0495628_0144296 | Ga0495628_0144296_131_949 | 264 |
| 527 | 3300046533 | Ga0495640_0015588 | Ga0495640_0015588_686_1504 | 264 |
| 528 | 3300046557 | Ga0495622_0038473 | Ga0495622_0038473_50_868 | 264 |
| 529 | 3300047317 | Ga0495604_0004274 | Ga0495604_0004274_7933_8751 | 264 |
| 530 | 3300047321 | Ga0495676_0091550 | Ga0495676_0091550_641_1459 | 264 |
| 531 | 3300047444 | Ga0495675_0131653 | Ga0495675_0131653_693_1511 | 264 |
| 532 | 3300053088 | Ga0500644_0072743 | Ga0500644_0072743_371_1186 | 264 |
| 533 | 3300053092 | Ga0500583_0230068 | Ga0500583_0230068_75_893 | 264 |
| 534 | iso_pu_bacteria | 2616644814 | 2616695838 | 264 |
| 535 | iso_pu_bacteria | 2852677369 | 2852679669 | 264 |
| 536 | 3300041512 | Ga0451853_1270289 | Ga0451853_1270289_3353_4171 | 265 |
| 537 | iso_pu_bacteria | 2863404153 | 2863406791 | 265 |
| 538 | 3300046529 | Ga0495652_0012235 | Ga0495652_0012235_6158_7024 | 266 |
| 539 | 3300005548 | Ga0070665_100044237 | Ga0070665_1000442372 | 267 |
| 540 | 3300005614 | Ga0068856_100124853 | Ga0068856_1001248532 | 267 |
| 541 | 3300025904 | Ga0207647_10035719 | Ga0207647_100357192 | 267 |
| 542 | 3300025949 | Ga0207667_10453008 | Ga0207667_104530082 | 267 |
| 543 | 3300028379 | Ga0268266_10056973 | Ga0268266_100569732 | 267 |
| 544 | 3300031507 | Ga0307509_10083179 | Ga0307509_100831793 | 267 |
| 545 | 3300046452 | Ga0495617_023825 | Ga0495617_023825_159_986 | 267 |
| 546 | 3300046454 | Ga0495592_0008609 | Ga0495592_0008609_4760_5644 | 267 |
| 547 | 3300046455 | Ga0495603_0021089 | Ga0495603_0021089_1305_2171 | 267 |
| 548 | 3300046455 | Ga0495603_0064031 | Ga0495603_0064031_1261_2088 | 267 |
| 549 | 3300046476 | Ga0495662_0004744 | Ga0495662_0004744_3699_4526 | 267 |
| 550 | 3300046506 | Ga0495583_0049301 | Ga0495583_0049301_999_1826 | 267 |
| 551 | 3300046514 | Ga0495618_0176920 | Ga0495618_0176920_66_893 | 267 |
| 552 | 3300046542 | Ga0495597_0166353 | Ga0495597_0166353_42_869 | 267 |
| 553 | 3300046557 | Ga0495622_0089547 | Ga0495622_0089547_65_892 | 267 |
| 554 | 3300046559 | Ga0495667_0259497 | Ga0495667_0259497_111_977 | 267 |
| 555 | 3300046615 | Ga0495656_0150035 | Ga0495656_0150035_95_922 | 267 |
| 556 | 3300046642 | Ga0495634_0008020 | Ga0495634_0008020_2022_2906 | 267 |
| 557 | 3300046660 | Ga0495625_0108659 | Ga0495625_0108659_921_1748 | 267 |
| 558 | 3300046689 | Ga0495613_0023187 | Ga0495613_0023187_1785_2651 | 267 |
| 559 | 3300046689 | Ga0495613_0434318 | Ga0495613_0434318_22_849 | 267 |
| 560 | 3300046690 | Ga0495624_0022452 | Ga0495624_0022452_799_1665 | 267 |
| 561 | 3300047315 | Ga0495581_0040042 | Ga0495581_0040042_1150_2016 | 267 |
| 562 | 3300047317 | Ga0495604_0053164 | Ga0495604_0053164_10_894 | 267 |
| 563 | 3300047321 | Ga0495676_0022629 | Ga0495676_0022629_1970_2836 | 267 |
| 564 | 3300047443 | Ga0495687_039705 | Ga0495687_039705_54_881 | 267 |
| 565 | 3300047444 | Ga0495675_0019726 | Ga0495675_0019726_1464_2348 | 267 |
| 566 | 3300047445 | Ga0495677_0063740 | Ga0495677_0063740_420_1247 | 267 |
| 567 | 3300048911 | Ga0496108_0426134 | Ga0496108_0426134_315_1142 | 267 |
| 568 | 3300048913 | Ga0496110_0506908 | Ga0496110_0506908_141_968 | 267 |
| 569 | 3300044693 | Ga0466961_0046284 | Ga0466961_0046284_1113_2042 | 268 |
| 570 | iso_pu_bacteria | 2728369276 | 2729905068 | 268 |
| 571 | 3300049822 | Ga0501035_0016340 | Ga0501035_0016340_1416_2345 | 269 |
| 572 | 3300031456 | Ga0307513_10002561 | Ga0307513_1000256115 | 285 |
| 573 | 3300003203 | JGI25406J46586_10005917 | JGI25406J46586_100059175 | 289 |
| 574 | 3300005985 | Ga0081539_10001535 | Ga0081539_100015353 | 289 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p44-assembly1.cif.gz_B | crystal structure of ketosteroid isomerase d38n mutant from mycobacterium hassiacum (mhksi) bound to 3,4-dinitrophenol | 0.6581 | 24 | 57 |
| 5m8g-assembly1.cif.gz_A | tubulin-mtd265 complex | 0.6506 | 227 | 271 |
| 5tpj-assembly1.cif.gz_A | crystal structure of a de novo designed protein with curved beta-sheet | 0.5876 | 16 | 64 |
| 7oai-assembly1.cif.gz_A | crystal structure of pseudokinase cask in complex with pfe-pkis12 | 0.5779 | 28 | 205 |
| 5trv-assembly1.cif.gz_A | crystal structure of a de novo designed protein with curved beta-sheet | 0.5591 | 17 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06242_7_252_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9407 | 30 | 278 | 3.10.450.50 |
| af_O06242_7_252_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9295 | 30 | 278 | 3.10.450.50 |
| af_A0A0G2L6J0_559_755_1.10.1070.11 | Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain | 0.6453 | 170 | 265 | 1.10.1070.11 |
| af_Q4CL54_10_218_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.6217 | 24 | 205 | 1.10.510.10 |
| af_Q9VM90_94_421_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.6106 | 27 | 205 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G2UU79-F1-model_v4 | SCO1664 family protein | 0.9822 | 164 | 289 |
|
| AF-X8CTJ2-F1-model_v4 | Phosphatidylinositol 3-and 4-kinase family protein | 0.9709 | 163 | 289 |
GO:0016301
|
| AF-A0A7Y3P6A8-F1-model_v4 | Phosphatidylinositol kinase | 0.9707 | 14 | 99 |
GO:0016301
|
| AF-A0A6B3HDN5-F1-model_v4 | SCO1664 family protein | 0.9685 | 141 | 289 |
|
| AF-A0A7W9JGX3-F1-model_v4 | Putative repeat protein (TIGR03843 family) | 0.9674 | 165 | 289 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar